F465614

General Info

Members Datasets Scaffolds Average Seq Length
577 288 1154 355

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10048954|Ga0163162_100489542
Length 389
Sequence MLRRPATAAAAHGCAHMPSLTFVMPHWLYWAGLLLFPLIATYLVRRQLKHAPDARPSLFIAYLFWLCSGFLGIHRFYLRSGLGFAFIPVFLFVIYCNAQVREVRDDTSRTFAALEQAQHAADIAKPSETNPTPEATAQYERAQADVKKMQAEFDVAKAVTDSWNARARWGAIVLAIMLLADAVLMPTLVRRQRKHESATPHRPIAEPPPVVAEPVLAEDPTLHFHSRFTDFIEMINVKAGEYVAWWSLIAVFVYYYEVLARFVFNSPTNWVHESMFLMFGMQYMLSGAYAYREDQHVRVDVIYAKFSPRGKAIADIITSVFFFIFIGTMLVTGYRFAADAVNVGEHSFTEWGIQYWPVKLAIPIGAALLLLQGVAKLIKDILFVSRRGA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
253 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
254 2643221651 Afipia sp. Root123D2 Isolate Unclassified
255 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
256 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
257 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
258 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
259 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
260 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
261 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
262 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
263 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
264 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
265 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
266 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
267 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
268 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
269 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
270 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
271 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
272 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
273 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
274 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
275 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
276 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
277 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
278 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
279 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
280 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
281 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
282 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
283 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
284 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
285 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
286 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
287 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
288 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 0
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 5.2
Rhizoplane 3.12
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10048954 3300013306 Bacteria 4236
2 Ga0065712_10074754 3300005290 Bacteria 4018
3 Ga0065715_10097391 3300005293 Bacteria 3713
4 Ga0070658_10009579 3300005327 Bacteria 7776
5 Ga0070658_10068697 3300005327 Bacteria 2897
6 Ga0070658_10080380 3300005327 Bacteria 2678
7 Ga0070676_10060667 3300005328 Bacteria 2247
8 Ga0070683_100005874 3300005329 Bacteria 10272
9 Ga0070683_100022132 3300005329 Bacteria 5678
10 Ga0070683_100036908 3300005329 Bacteria 4471
11 Ga0070690_100010980 3300005330 Bacteria 5288
12 Ga0070690_100128128 3300005330 Bacteria 1711
13 Ga0070670_100040336 3300005331 Bacteria 4015
14 Ga0070670_100083451 3300005331 Bacteria 2745
15 Ga0070677_10024137 3300005333 Bacteria 2258
16 Ga0068869_100001503 3300005334 Bacteria 13819
17 Ga0068869_100106122 3300005334 Bacteria 2131
18 Ga0068869_100269756 3300005334 Bacteria 1365
19 Ga0070666_10006712 3300005335 Bacteria 7084
20 Ga0070680_100010191 3300005336 Bacteria 7247
21 Ga0070680_100034827 3300005336 Bacteria 4061
22 Ga0070680_100094594 3300005336 Bacteria 2477
23 Ga0070682_100141373 3300005337 Bacteria 1641
24 Ga0068868_100033960 3300005338 Bacteria 3935
25 Ga0068868_100208250 3300005338 Bacteria 1633
26 Ga0070660_100001424 3300005339 Bacteria 16292
27 Ga0070660_100006417 3300005339 Bacteria 8150
28 Ga0070660_100017014 3300005339 Bacteria 5292
29 Ga0070660_100033991 3300005339 Bacteria 3848
30 Ga0070689_100011227 3300005340 Bacteria 6410
31 Ga0070689_100070388 3300005340 Bacteria 2731
32 Ga0070661_100001831 3300005344 Bacteria 14718
33 Ga0070661_100003536 3300005344 Bacteria 10765
34 Ga0070661_100007865 3300005344 Bacteria 7360
35 Ga0070661_100009438 3300005344 Bacteria 6752
36 Ga0070661_100012354 3300005344 Bacteria 5975
37 Ga0070661_100036305 3300005344 Bacteria 3582
38 Ga0070661_100054690 3300005344 Bacteria 2923
39 Ga0070692_10026720 3300005345 Bacteria 2856
40 Ga0070669_100054090 3300005353 Bacteria 2940
41 Ga0070669_100094003 3300005353 Bacteria 2252
42 Ga0070675_100059524 3300005354 Bacteria 3151
43 Ga0070675_100061771 3300005354 Bacteria 3095
44 Ga0070671_100016774 3300005355 Bacteria 5923
45 Ga0070671_100337845 3300005355 Bacteria 1284
46 Ga0070673_100017633 3300005364 Bacteria 5083
47 Ga0070673_100040597 3300005364 Bacteria 3571
48 Ga0070688_100014952 3300005365 Bacteria 4406
49 Ga0070659_100020158 3300005366 Bacteria 5062
50 Ga0070659_100023995 3300005366 Bacteria 4672
51 Ga0070659_100028613 3300005366 Bacteria 4305
52 Ga0070659_100115143 3300005366 Bacteria 2173
53 Ga0070659_100168536 3300005366 Bacteria 1793
54 Ga0070667_100028398 3300005367 Bacteria 4657
55 Ga0070667_100044467 3300005367 Bacteria 3730
56 Ga0070709_10061870 3300005434 Bacteria 2385
57 Ga0070714_100013550 3300005435 Bacteria 6535
58 Ga0070705_100010953 3300005440 Bacteria 4556
59 Ga0070700_100055462 3300005441 Bacteria 2480
60 Ga0070694_100015830 3300005444 Bacteria 4745
61 Ga0070663_100014024 3300005455 Bacteria 5133
62 Ga0070663_100121082 3300005455 Bacteria 1977
63 Ga0070678_100003725 3300005456 Bacteria 8533
64 Ga0070678_100208449 3300005456 Bacteria 1618
65 Ga0070662_100000836 3300005457 Bacteria 18940
66 Ga0070681_10002559 3300005458 Bacteria 16698
67 Ga0070681_10047687 3300005458 Bacteria 4283
68 Ga0070681_10089843 3300005458 Bacteria 3023
69 Ga0070685_10001663 3300005466 Bacteria 11684
70 Ga0070685_10001881 3300005466 Bacteria 10953
71 Ga0070707_100031265 3300005468 Bacteria 5070
72 Ga0070699_100022222 3300005518 Bacteria 5465
73 Ga0070679_100002918 3300005530 Bacteria 15548
74 Ga0070679_100025151 3300005530 Bacteria 5840
75 Ga0070679_100035826 3300005530 Bacteria 4923
76 Ga0070679_100038208 3300005530 Bacteria 4772
77 Ga0070684_100010852 3300005535 Bacteria 7237
78 Ga0070684_100017058 3300005535 Bacteria 5952
79 Ga0070697_100016546 3300005536 Bacteria 5802
80 Ga0068853_100013069 3300005539 Bacteria 6771
81 Ga0068853_100104695 3300005539 Bacteria 2505
82 Ga0068853_100109606 3300005539 Bacteria 2451
83 Ga0068853_100183987 3300005539 Bacteria 1896
84 Ga0070672_100034784 3300005543 Bacteria 3826
85 Ga0070695_100005747 3300005545 Bacteria 7309
86 Ga0070696_100016902 3300005546 Bacteria 4921
87 Ga0070696_100023628 3300005546 Bacteria 4178
88 Ga0070693_100002563 3300005547 Bacteria 8375
89 Ga0070665_100082387 3300005548 Bacteria 3222
90 Ga0070704_100189886 3300005549 Bacteria 1650
91 Ga0068855_100002546 3300005563 Bacteria 22453
92 Ga0068855_100022311 3300005563 Bacteria 7585
93 Ga0068855_100059960 3300005563 Bacteria 4451
94 Ga0068855_100341898 3300005563 Bacteria 1650
95 Ga0070664_100008394 3300005564 Bacteria 8353
96 Ga0070664_100009647 3300005564 Bacteria 7832
97 Ga0070664_100016817 3300005564 Bacteria 6004
98 Ga0070664_100028464 3300005564 Bacteria 4648
99 Ga0070664_100065826 3300005564 Bacteria 3093
100 Ga0070664_100094650 3300005564 Bacteria 2590
101 Ga0070664_100151243 3300005564 Bacteria 2049
102 Ga0068857_100004656 3300005577 Bacteria 11621
103 Ga0068857_100122249 3300005577 Bacteria 2345
104 Ga0068854_100003076 3300005578 Bacteria 10391
105 Ga0068854_100025183 3300005578 Bacteria 4082
106 Ga0068854_100100417 3300005578 Bacteria 2168
107 Ga0068856_100001602 3300005614 Bacteria 23652
108 Ga0068856_100058259 3300005614 Bacteria 3814
109 Ga0068856_100265146 3300005614 Bacteria 1733
110 Ga0068852_100002065 3300005616 Bacteria 13708
111 Ga0068852_100007728 3300005616 Bacteria 7863
112 Ga0068852_100008311 3300005616 Bacteria 7638
113 Ga0068852_100028380 3300005616 Bacteria 4579
114 Ga0068852_100030078 3300005616 Bacteria 4467
115 Ga0068852_100119015 3300005616 Bacteria 2414
116 Ga0068852_100137041 3300005616 Bacteria 2261
117 Ga0068859_100006388 3300005617 Bacteria 11959
118 Ga0068859_100043553 3300005617 Bacteria 4511
119 Ga0068864_100023643 3300005618 Bacteria 5162
120 Ga0068866_10001382 3300005718 Bacteria 10464
121 Ga0068861_100064739 3300005719 Bacteria 2814
122 Ga0068851_10002317 3300005834 Bacteria 8380
123 Ga0068851_10010765 3300005834 Bacteria 4275
124 Ga0068851_10049004 3300005834 Bacteria 2142
125 Ga0068863_100000521 3300005841 Bacteria 39214
126 Ga0068863_100010980 3300005841 Bacteria 8784
127 Ga0068858_100002595 3300005842 Bacteria 18196
128 Ga0068858_100062480 3300005842 Bacteria 3443
129 Ga0068860_100165232 3300005843 Bacteria 2136
130 Ga0068862_100013593 3300005844 Bacteria 6740
131 Ga0081455_10221121 3300005937 Unclassified 1403
132 Ga0081540_1009885 3300005983 Bacteria 6517
133 Ga0081539_10006541 3300005985 Bacteria 11117
134 Ga0097621_100035711 3300006237 Bacteria 3973
135 Ga0097621_100303583 3300006237 Bacteria 1410
136 Ga0068871_100021589 3300006358 Bacteria 4951
137 Ga0068871_100120521 3300006358 Bacteria 2215
138 Ga0068871_100192063 3300006358 Bacteria 1759
139 Ga0068865_100005114 3300006881 Bacteria 7938
140 Ga0068865_100180912 3300006881 Bacteria 1623
141 Ga0075436_100019016 3300006914 Bacteria 4705
142 Ga0097620_100006387 3300006931 Bacteria 11959
143 Ga0097620_100043554 3300006931 Bacteria 4511
144 Ga0105240_10046619 3300009093 Bacteria 5491
145 Ga0105240_10075677 3300009093 Bacteria 4152
146 Ga0105240_10135227 3300009093 Bacteria 2952
147 Ga0105240_10170468 3300009093 Bacteria 2579
148 Ga0111539_10022960 3300009094 Bacteria 7660
149 Ga0105245_10004684 3300009098 Bacteria 12091
150 Ga0105245_10004874 3300009098 Bacteria 11811
151 Ga0105243_10240364 3300009148 Bacteria 1611
152 Ga0105241_10005054 3300009174 Bacteria 9729
153 Ga0105241_10128560 3300009174 Bacteria 2048
154 Ga0105242_10007936 3300009176 Bacteria 8175
155 Ga0105248_10046839 3300009177 Bacteria 4848
156 Ga0105237_10252927 3300009545 Bacteria 1764
157 Ga0105238_10016630 3300009551 Bacteria 7450
158 Ga0105238_10022863 3300009551 Bacteria 6373
159 Ga0105238_10121488 3300009551 Bacteria 2591
160 Ga0105246_10097819 3300011119 Bacteria 2131
161 Ga0157373_10000924 3300013100 Bacteria 22752
162 Ga0157373_10005626 3300013100 Bacteria 9396
163 Ga0157373_10010452 3300013100 Bacteria 6829
164 Ga0157371_10000522 3300013102 Bacteria 45892
165 Ga0157371_10092963 3300013102 Bacteria 2137
166 Ga0157371_10109427 3300013102 Bacteria 1961
167 Ga0157371_10110555 3300013102 Bacteria 1951
168 Ga0157370_10019308 3300013104 Bacteria 6842
169 Ga0157370_10021260 3300013104 Bacteria 6469
170 Ga0157370_10024337 3300013104 Bacteria 5996
171 Ga0157370_10026655 3300013104 Bacteria 5704
172 Ga0157370_10030822 3300013104 Bacteria 5253
173 Ga0157370_10153070 3300013104 Bacteria 2146
174 Ga0157369_10002022 3300013105 Bacteria 24464
175 Ga0157369_10013944 3300013105 Bacteria 9082
176 Ga0157369_10052019 3300013105 Bacteria 4432
177 Ga0157369_10105364 3300013105 Bacteria 3002
178 Ga0157369_10111519 3300013105 Bacteria 2907
179 Ga0157374_10004205 3300013296 Bacteria 12099
180 Ga0157374_10104198 3300013296 Bacteria 2723
181 Ga0157378_10011028 3300013297 Bacteria 7909
182 Ga0157378_10016424 3300013297 Bacteria 6481
183 Ga0157378_10157456 3300013297 Bacteria 2121
184 Ga0163162_10005749 3300013306 Bacteria 11996
185 Ga0163162_10019620 3300013306 Bacteria 6636
186 Ga0157372_10000791 3300013307 Bacteria 34366
187 Ga0157372_10009509 3300013307 Bacteria 10336
188 Ga0157372_10023388 3300013307 Bacteria 6698
189 Ga0157372_10043976 3300013307 Bacteria 4947
190 Ga0157372_10133216 3300013307 Bacteria 2861
191 Ga0157372_10202722 3300013307 Bacteria 2298
192 Ga0157372_10212922 3300013307 Bacteria 2239
193 Ga0157372_10243311 3300013307 Bacteria 2087
194 Ga0157372_10298891 3300013307 Bacteria 1873
195 Ga0157375_10219422 3300013308 Bacteria 2060
196 Ga0163163_10047688 3300014325 Bacteria 4212
197 Ga0157379_10002212 3300014968 Bacteria 16183
198 Ga0157379_10009512 3300014968 Bacteria 8464
199 Ga0157376_10012087 3300014969 Bacteria 6391
200 Ga0163161_10025411 3300017792 Bacteria 4192
201 Ga0207697_10000450 3300025315 Bacteria 23178
202 Ga0207656_10005762 3300025321 Bacteria 4407
203 Ga0207656_10014690 3300025321 Bacteria 3022
204 Ga0207642_10001187 3300025899 Bacteria 8031
205 Ga0207688_10010358 3300025901 Bacteria 5074
206 Ga0207680_10048735 3300025903 Bacteria 2518
207 Ga0207680_10056941 3300025903 Bacteria 2363
208 Ga0207680_10074458 3300025903 Bacteria 2114
209 Ga0207699_10108194 3300025906 Bacteria 1777
210 Ga0207645_10001587 3300025907 Bacteria 18531
211 Ga0207643_10000429 3300025908 Bacteria 27769
212 Ga0207705_10012215 3300025909 Bacteria 6206
213 Ga0207705_10118089 3300025909 Bacteria 1965
214 Ga0207705_10138788 3300025909 Bacteria 1814
215 Ga0207684_10033492 3300025910 Bacteria 4368
216 Ga0207654_10004312 3300025911 Bacteria 7172
217 Ga0207654_10008078 3300025911 Bacteria 5305
218 Ga0207707_10003585 3300025912 Bacteria 13765
219 Ga0207707_10005932 3300025912 Bacteria 10689
220 Ga0207707_10033524 3300025912 Bacteria 4493
221 Ga0207695_10014512 3300025913 Bacteria 9326
222 Ga0207695_10038581 3300025913 Bacteria 5140
223 Ga0207695_10070564 3300025913 Bacteria 3571
224 Ga0207663_10024134 3300025916 Bacteria 3499
225 Ga0207660_10002460 3300025917 Bacteria 12166
226 Ga0207660_10118138 3300025917 Bacteria 2005
227 Ga0207660_10123786 3300025917 Bacteria 1961
228 Ga0207662_10022596 3300025918 Bacteria 3607
229 Ga0207662_10111683 3300025918 Bacteria 1705
230 Ga0207657_10000297 3300025919 Bacteria 52991
231 Ga0207657_10000657 3300025919 Bacteria 36802
232 Ga0207657_10004018 3300025919 Bacteria 15631
233 Ga0207657_10005722 3300025919 Bacteria 12970
234 Ga0207657_10015368 3300025919 Bacteria 7418
235 Ga0207657_10193448 3300025919 Bacteria 1640
236 Ga0207649_10003651 3300025920 Bacteria 8404
237 Ga0207649_10007402 3300025920 Bacteria 5973
238 Ga0207649_10032774 3300025920 Bacteria 3099
239 Ga0207649_10039934 3300025920 Bacteria 2848
240 Ga0207649_10117885 3300025920 Bacteria 1785
241 Ga0207649_10118456 3300025920 Bacteria 1781
242 Ga0207652_10011598 3300025921 Bacteria 7110
243 Ga0207652_10015423 3300025921 Bacteria 6208
244 Ga0207652_10023700 3300025921 Bacteria 5087
245 Ga0207652_10046377 3300025921 Bacteria 3708
246 Ga0207652_10184286 3300025921 Bacteria 1877
247 Ga0207681_10016827 3300025923 Bacteria 4584
248 Ga0207694_10041058 3300025924 Bacteria 3564
249 Ga0207650_10000503 3300025925 Bacteria 32602
250 Ga0207659_10001307 3300025926 Bacteria 14875
251 Ga0207687_10011244 3300025927 Bacteria 5846
252 Ga0207687_10014035 3300025927 Bacteria 5237
253 Ga0207664_10008715 3300025929 Bacteria 7091
254 Ga0207644_10007750 3300025931 Bacteria 7008
255 Ga0207644_10092409 3300025931 Bacteria 2257
256 Ga0207690_10000412 3300025932 Bacteria 28034
257 Ga0207690_10004753 3300025932 Bacteria 8016
258 Ga0207690_10032515 3300025932 Bacteria 3348
259 Ga0207690_10090755 3300025932 Bacteria 2158
260 Ga0207690_10151460 3300025932 Bacteria 1720
261 Ga0207706_10000164 3300025933 Bacteria 73885
262 Ga0207706_10066056 3300025933 Bacteria 3184
263 Ga0207686_10002716 3300025934 Bacteria 9600
264 Ga0207670_10003032 3300025936 Bacteria 8859
265 Ga0207691_10071179 3300025940 Bacteria 3139
266 Ga0207711_10000654 3300025941 Bacteria 34558
267 Ga0207689_10003889 3300025942 Bacteria 13608
268 Ga0207689_10021399 3300025942 Bacteria 5438
269 Ga0207689_10133337 3300025942 Bacteria 2045
270 Ga0207661_10009378 3300025944 Bacteria 7017
271 Ga0207661_10157323 3300025944 Bacteria 1969
272 Ga0207679_10000601 3300025945 Bacteria 24040
273 Ga0207679_10009854 3300025945 Bacteria 6134
274 Ga0207679_10011564 3300025945 Bacteria 5724
275 Ga0207679_10026327 3300025945 Bacteria 4009
276 Ga0207679_10052132 3300025945 Bacteria 2999
277 Ga0207667_10000695 3300025949 Bacteria 43623
278 Ga0207667_10003052 3300025949 Bacteria 20782
279 Ga0207667_10184620 3300025949 Bacteria 2141
280 Ga0207667_10203916 3300025949 Bacteria 2028
281 Ga0207667_10250929 3300025949 Bacteria 1810
282 Ga0207667_10274172 3300025949 Bacteria 1724
283 Ga0207667_10286994 3300025949 Bacteria 1682
284 Ga0207651_10034709 3300025960 Bacteria 3270
285 Ga0207651_10052331 3300025960 Bacteria 2783
286 Ga0207640_10005704 3300025981 Bacteria 6783
287 Ga0207640_10082952 3300025981 Bacteria 2196
288 Ga0207658_10004210 3300025986 Bacteria 10022
289 Ga0207658_10045089 3300025986 Bacteria 3213
290 Ga0207658_10064037 3300025986 Bacteria 2756
291 Ga0207677_10000162 3300026023 Bacteria 53309
292 Ga0207677_10029584 3300026023 Bacteria 3483
293 Ga0207703_10010978 3300026035 Bacteria 7058
294 Ga0207639_10013780 3300026041 Bacteria 5669
295 Ga0207639_10069988 3300026041 Bacteria 2739
296 Ga0207639_10423179 3300026041 Bacteria 1204
297 Ga0207678_10011759 3300026067 Bacteria 7683
298 Ga0207678_10148156 3300026067 Bacteria 2003
299 Ga0207678_10163519 3300026067 Bacteria 1901
300 Ga0207678_10294787 3300026067 Bacteria 1393
301 Ga0207708_10057134 3300026075 Bacteria 2977
302 Ga0207708_10351074 3300026075 Bacteria 1210
303 Ga0207702_10001837 3300026078 Bacteria 20897
304 Ga0207702_10042852 3300026078 Bacteria 3798
305 Ga0207702_10181386 3300026078 Bacteria 1939
306 Ga0207641_10002418 3300026088 Bacteria 17241
307 Ga0207648_10068279 3300026089 Bacteria 3097
308 Ga0207676_10000845 3300026095 Bacteria 23780
309 Ga0207676_10049890 3300026095 Bacteria 3259
310 Ga0207674_10000396 3300026116 Bacteria 56376
311 Ga0207674_10014843 3300026116 Bacteria 8591
312 Ga0207674_10105737 3300026116 Bacteria 2792
313 Ga0207675_100004233 3300026118 Bacteria 13885
314 Ga0207683_10001007 3300026121 Bacteria 25719
315 Ga0207698_10000732 3300026142 Bacteria 19003
316 Ga0207698_10007413 3300026142 Bacteria 6872
317 Ga0207698_10021638 3300026142 Bacteria 4453
318 Ga0207698_10027156 3300026142 Bacteria 4060
319 Ga0207698_10095682 3300026142 Bacteria 2445
320 Ga0207698_10294985 3300026142 Bacteria 1507
321 Ga0209974_10004530 3300027876 Bacteria 4946
322 Ga0268264_10005787 3300028381 Bacteria 10481
323 Ga0268264_10053425 3300028381 Bacteria 3370
324 Ga0268264_10162997 3300028381 Bacteria 2010
325 Ga0307408_100187220 3300031548 Bacteria 1665
326 Ga0307410_10015234 3300031852 Bacteria 4554
327 Ga0307407_10015800 3300031903 Bacteria 3743
328 Ga0307412_10010002 3300031911 Bacteria 5456
329 Ga0307409_100000903 3300031995 Bacteria 13753
330 Ga0307415_100004603 3300032126 Bacteria 7195
331 Ga0373923_0006384 3300035111 Bacteria 4072
332 Ga0373923_0021739 3300035111 Bacteria 2508
333 Ga0373936_0018609 3300035113 Bacteria 2684
334 Ga0373945_0034565 3300035116 Bacteria 1802
335 Ga0373945_0043741 3300035116 Bacteria 1626
336 Ga0373953_0002065 3300035117 Bacteria 5990
337 Ga0373954_0000001 3300035118 Bacteria 158201
338 Ga0373954_0005441 3300035118 Bacteria 5509
339 Ga0373954_0009183 3300035118 Bacteria 4349
340 Ga0373954_0018297 3300035118 Bacteria 3152
341 Ga0373956_0006326 3300035119 Bacteria 4740
342 Ga0373956_0010448 3300035119 Bacteria 3805
343 Ga0373943_0033098 3300035170 Bacteria 2460
344 Ga0373943_0036182 3300035170 Bacteria 2363
345 Ga0373955_0008460 3300035172 Bacteria 4781
346 Ga0373955_0017595 3300035172 Bacteria 3540
347 Ga0373955_0018192 3300035172 Bacteria 3491
348 Ga0373955_0026361 3300035172 Bacteria 2993
349 Ga0373924_0000883 3300035410 Bacteria 9450
350 Ga0373924_0006601 3300035410 Bacteria 4161
351 Ga0373924_0016434 3300035410 Bacteria 2824
352 Ga0373935_0031819 3300035692 Bacteria 3276
353 Ga0373927_0010594 3300035695 Bacteria 6144
354 Ga0373927_0127253 3300035695 Bacteria 1663
355 Ga0373933_0012221 3300035724 Bacteria 4743
356 Ga0373933_0037569 3300035724 Bacteria 2841
357 Ga0373933_0186966 3300035724 Bacteria 1322
358 Ga0373947_0015771 3300035725 Bacteria 4340
359 Ga0373947_0039702 3300035725 Bacteria 2801
360 Ga0373947_0041584 3300035725 Bacteria 2741
361 Ga0373937_0005181 3300036401 Bacteria 11122
362 Ga0373937_0020151 3300036401 Bacteria 5976
363 Ga0373937_0028653 3300036401 Bacteria 5040
364 Ga0373937_0032018 3300036401 Bacteria 4767
365 Ga0373937_0047293 3300036401 Bacteria 3936
366 Ga0373937_0227667 3300036401 Bacteria 1755
367 Ga0316584_0010926 3300036712 Bacteria 6359
368 Ga0373925_0010065 3300037068 Bacteria 6868
369 Ga0373925_0025023 3300037068 Bacteria 4360
370 Ga0373925_0033237 3300037068 Bacteria 3802
371 Ga0373925_0149014 3300037068 Bacteria 1836
372 Ga0373925_0218660 3300037068 Bacteria 1520
373 Ga0373925_0233943 3300037068 Bacteria 1470
374 Ga0395899_0001564 3300037312 Bacteria 19269
375 Ga0395900_0018529 3300037418 Bacteria 7099
376 Ga0395900_0262605 3300037418 Bacteria 1724
377 Ga0395898_0003262 3300037466 Bacteria 18232
378 Ga0395898_0053882 3300037466 Bacteria 3927
379 Ga0395905_0000126 3300037471 Bacteria 126035
380 Ga0395905_0005168 3300037471 Bacteria 13388
381 Ga0395905_0017017 3300037471 Bacteria 6902
382 Ga0395905_0041120 3300037471 Bacteria 4337
383 Ga0395901_0069291 3300038443 Bacteria 3673
384 Ga0439448_0053765 3300042005 Bacteria 1322
385 Ga0495592_0063538 3300046454 Bacteria 2707
386 Ga0495592_0066301 3300046454 Bacteria 2642
387 Ga0495592_0165457 3300046454 Bacteria 1518
388 Ga0495629_0020556 3300046459 Bacteria 4715
389 Ga0495651_0002598 3300046462 Bacteria 13965
390 Ga0495651_0007571 3300046462 Bacteria 8307
391 Ga0495651_0125247 3300046462 Bacteria 1882
392 Ga0495653_0007240 3300046463 Bacteria 9090
393 Ga0495653_0203989 3300046463 Bacteria 1340
394 Ga0495580_0012254 3300046472 Bacteria 6584
395 Ga0495580_0023199 3300046472 Bacteria 4559
396 Ga0495582_0003184 3300046473 Bacteria 9225
397 Ga0495582_0015855 3300046473 Bacteria 4132
398 Ga0495639_0024590 3300046475 Bacteria 2652
399 Ga0495664_0002776 3300046477 Bacteria 9425
400 Ga0495664_0033125 3300046477 Bacteria 3036
401 Ga0495594_0050909 3300046499 Bacteria 2279
402 Ga0495608_0010400 3300046511 Bacteria 6494
403 Ga0495608_0016080 3300046511 Bacteria 5176
404 Ga0495618_0011734 3300046514 Bacteria 5319
405 Ga0495628_0023409 3300046516 Bacteria 5069
406 Ga0495628_0033001 3300046516 Bacteria 4175
407 Ga0495628_0227203 3300046516 Bacteria 1400
408 Ga0495630_0018764 3300046517 Bacteria 5083
409 Ga0495630_0025880 3300046517 Bacteria 4341
410 Ga0495666_0041781 3300046526 Bacteria 2219
411 Ga0495652_0016901 3300046529 Bacteria 6519
412 Ga0495652_0036330 3300046529 Bacteria 4285
413 Ga0495652_0134326 3300046529 Bacteria 1954
414 Ga0495665_0010123 3300046531 Bacteria 5109
415 Ga0495665_0011441 3300046531 Bacteria 4802
416 Ga0495665_0105710 3300046531 Bacteria 1477
417 Ga0495640_0014254 3300046533 Bacteria 6022
418 Ga0495640_0015001 3300046533 Bacteria 5839
419 Ga0495586_0006225 3300046535 Bacteria 6379
420 Ga0495587_0002421 3300046536 Bacteria 12435
421 Ga0495587_0034279 3300046536 Bacteria 3062
422 Ga0495621_0005862 3300046539 Bacteria 3558
423 Ga0495645_0000056 3300046543 Bacteria 81955
424 Ga0495645_0004831 3300046543 Bacteria 9208
425 Ga0495645_0005680 3300046543 Bacteria 8589
426 Ga0495645_0010684 3300046543 Bacteria 6446
427 Ga0495667_0000293 3300046559 Bacteria 32233
428 Ga0495667_0016751 3300046559 Bacteria 4950
429 Ga0495667_0135517 3300046559 Bacteria 1587
430 Ga0495634_0026307 3300046642 Bacteria 4062
431 Ga0495634_0069400 3300046642 Bacteria 2325
432 Ga0495635_0037690 3300046663 Bacteria 3346
433 Ga0495635_0063114 3300046663 Bacteria 2544
434 Ga0495635_0168396 3300046663 Bacteria 1490
435 Ga0495657_0027802 3300046675 Bacteria 3987
436 Ga0495657_0041951 3300046675 Bacteria 3127
437 Ga0495657_0214335 3300046675 Bacteria 1169
438 Ga0495599_0016654 3300046678 Bacteria 4565
439 Ga0495599_0029876 3300046678 Bacteria 3418
440 Ga0495623_0018229 3300046679 Bacteria 4533
441 Ga0495623_0073494 3300046679 Bacteria 2125
442 Ga0495646_0001995 3300046680 Bacteria 12333
443 Ga0495647_0002608 3300046681 Bacteria 5712
444 Ga0495647_0014894 3300046681 Bacteria 2715
445 Ga0495658_0003919 3300046683 Bacteria 7348
446 Ga0495658_0012866 3300046683 Bacteria 4250
447 Ga0495658_0013527 3300046683 Bacteria 4154
448 Ga0495613_0061734 3300046689 Bacteria 2744
449 Ga0495613_0078920 3300046689 Bacteria 2394
450 Ga0495600_0010886 3300046809 Bacteria 5657
451 Ga0495600_0032156 3300046809 Bacteria 3403
452 Ga0495581_0001661 3300047315 Bacteria 12389
453 Ga0495604_0003730 3300047317 Bacteria 12131
454 Ga0495604_0022595 3300047317 Bacteria 5022
455 Ga0495604_0089663 3300047317 Bacteria 2285
456 Ga0495674_0001667 3300047319 Bacteria 21836
457 Ga0495674_0001748 3300047319 Bacteria 21384
458 Ga0495676_0059396 3300047321 Bacteria 3003
459 Ga0495680_0003160 3300047322 Bacteria 16401
460 Ga0495680_0026771 3300047322 Bacteria 4748
461 Ga0495680_0044134 3300047322 Bacteria 3526
462 Ga0495675_0013454 3300047444 Bacteria 5165
463 Ga0495675_0021285 3300047444 Bacteria 4129
464 Ga0495684_0002788 3300047471 Bacteria 13787
465 Ga0495684_0020748 3300047471 Bacteria 5062
466 Ga0495684_0055876 3300047471 Bacteria 3010
467 Ga0495684_0177721 3300047471 Bacteria 1579
468 Ga0495602_0003569 3300048088 Bacteria 16101
469 Ga0496101_0009607 3300048904 Bacteria 6363
470 Ga0496102_0011937 3300048905 Bacteria 7502
471 Ga0496102_0028354 3300048905 Bacteria 4999
472 Ga0496102_0166516 3300048905 Bacteria 2074
473 Ga0496104_0091398 3300048907 Bacteria 2909
474 Ga0496104_0285634 3300048907 Bacteria 1563
475 Ga0496105_0062729 3300048908 Bacteria 3067
476 Ga0496106_0005422 3300048909 Bacteria 9436
477 Ga0496106_0069303 3300048909 Bacteria 2692
478 Ga0496106_0173454 3300048909 Bacteria 1710
479 Ga0496107_0038768 3300048910 Bacteria 3417
480 Ga0496108_0213061 3300048911 Bacteria 1677
481 Ga0496109_0101135 3300048912 Bacteria 2675
482 Ga0496109_0316525 3300048912 Bacteria 1472
483 Ga0496110_0034960 3300048913 Bacteria 4356
484 Ga0496112_0018662 3300048915 Bacteria 6537
485 Ga0496112_0124275 3300048915 Bacteria 2551
486 Ga0501032_0240288 3300049569 Bacteria 1177
487 Ga0501034_0207641 3300049571 Bacteria 1914
488 Ga0501036_0364036 3300049572 Bacteria 1207
489 Ga0501038_0176593 3300049574 Bacteria 1726
490 Ga0501043_0000009 3300049579 Bacteria 214823
491 Ga0501043_0020921 3300049579 Bacteria 5130
492 Ga0501046_0000022 3300049580 Bacteria 215451
493 Ga0501046_0044864 3300049580 Bacteria 3514
494 Ga0501047_0000021 3300049581 Bacteria 254841
495 Ga0501047_0020495 3300049581 Bacteria 6348
496 Ga0501047_0023869 3300049581 Bacteria 5873
497 Ga0501047_0067747 3300049581 Bacteria 3439
498 Ga0501047_0104367 3300049581 Bacteria 2714
499 Ga0501047_0242429 3300049581 Bacteria 1653
500 Ga0501048_0003510 3300049582 Bacteria 11922
501 Ga0501070_0000979 3300049586 Bacteria 25649
502 Ga0501070_0031620 3300049586 Bacteria 4434
503 Ga0501070_0069169 3300049586 Bacteria 2923
504 Ga0501070_0158494 3300049586 Bacteria 1866
505 Ga0501071_0145867 3300049587 Bacteria 1764
506 Ga0501072_0004295 3300049588 Bacteria 10819
507 Ga0501073_0042997 3300049589 Bacteria 3187
508 Ga0501073_0054936 3300049589 Bacteria 2787
509 Ga0501074_0006077 3300049590 Bacteria 8719
510 Ga0501079_0008169 3300049741 Bacteria 7933
511 Ga0501080_0010364 3300049742 Bacteria 8524
512 Ga0501080_0022597 3300049742 Bacteria 5826
513 Ga0501080_0109168 3300049742 Bacteria 2564
514 Ga0501080_0285865 3300049742 Bacteria 1498
515 Ga0501083_0112604 3300049744 Bacteria 1788
516 Ga0501083_0158264 3300049744 Bacteria 1482
517 Ga0501035_0060482 3300049822 Bacteria 3372
518 Ga0501035_0068818 3300049822 Bacteria 3139
519 Ga0501035_0147680 3300049822 Bacteria 2041
520 Ga0501044_0055738 3300049823 Bacteria 4059
521 Ga0501044_0076337 3300049823 Bacteria 3401
522 Ga0501044_0129214 3300049823 Bacteria 2522
523 Ga0501044_0257803 3300049823 Bacteria 1683
524 Ga0501044_0298528 3300049823 Bacteria 1540
525 nmdc:mga08y16_332360_c1 3300050511 Bacteria 1563
526 nmdc:mga0n895_191062_c1 3300050512 Bacteria 2078
527 nmdc:mga08x19_45651_c1 3300050514 Bacteria 2800
528 Ga0495601_0004409 3300053077 Bacteria 8134
529 Ga0495601_0023907 3300053077 Bacteria 3758
530 Ga0495612_0002196 3300053078 Bacteria 8023
531 Ga0495612_0102634 3300053078 Bacteria 1219
532 Ga0495595_0001285 3300053084 Bacteria 9794
533 Ga0495619_0007680 3300053085 Bacteria 6827
534 Ga0495619_0008116 3300053085 Bacteria 6646
535 Ga0495619_0012565 3300053085 Bacteria 5332
536 Ga0495619_0017076 3300053085 Bacteria 4601
537 Ga0495619_0042548 3300053085 Bacteria 2975
538 Ga0495619_0070169 3300053085 Bacteria 2343
539 Ga0501084_0253460 3300054114 Bacteria 1485
540 Ga0501082_0077085 3300060353 Bacteria 2874
541 2513643176 2513237094 Bacteria 8789602
542 2599940885 2599185301 Bacteria 6161860
543 2644287152 2643221651 Bacteria 4798932
544 2792584770 2791355082 Bacteria 5973319
545 2804755278 2802429268 Bacteria 6094027
546 2847675386 2847670302 Bacteria 6165597
547 2847692002 2847686936 Bacteria 6278406
548 2856320307 2856314179 Bacteria 6477897
549 2871446624 2871444079 Bacteria 6423508
550 2874103760 2874102143 Bacteria 6342645
551 2874127119 2874123672 Bacteria 7238285
552 2876371127 2876369609 Bacteria 6807521
553 2878042617 2878035449 Bacteria 6555736
554 2881149372 2881147464 Bacteria 7779814
555 2885332234 2885326080 Bacteria 7134805
556 2888354510 2888350351 Bacteria 7372807
557 2906330261 2906328253 Bacteria 6585166
558 2906420913 2906414383 Bacteria 6580790
559 2906634842 2906626472 Bacteria 8826946
560 2913296021 2913295892 Bacteria 6333755
561 2922132073 2922130491 Bacteria 7173936
562 2922165267 2922158528 Bacteria 6573167
563 2924727541 2924726620 Bacteria 6271473
564 2937893881 2937891427 Bacteria 6357007
565 2958118208 2958115193 Bacteria 6923548
566 2965066409 2965062239 Bacteria 7412989
567 2965123502 2965119406 Bacteria 6956431
568 2968092112 2968091066 Bacteria 6052692
569 2968098614 2968097103 Bacteria 6107094
570 2968130766 2968128360 Bacteria 6270294
571 2977860599 2977858184 Bacteria 6215359
572 2979750839 2979742915 Bacteria 7301278
573 2979782498 2979779861 Bacteria 6219781
574 2996346521 2996341866 Bacteria 6643098
575 8004451291 8004445564 Bacteria 6322258
576 8004709111 8004703790 Bacteria 8006957
577 8049297900 8049293176 Bacteria 6128433
578 Ga0163162_10048954
579 Ga0065712_10074754
580 Ga0065715_10097391
581 Ga0070658_10009579
582 Ga0070658_10068697
583 Ga0070658_10080380
584 Ga0070676_10060667
585 Ga0070683_100005874
586 Ga0070683_100022132
587 Ga0070683_100036908
588 Ga0070690_100010980
589 Ga0070690_100128128
590 Ga0070670_100040336
591 Ga0070670_100083451
592 Ga0070677_10024137
593 Ga0068869_100001503
594 Ga0068869_100106122
595 Ga0068869_100269756
596 Ga0070666_10006712
597 Ga0070680_100010191
598 Ga0070680_100034827
599 Ga0070680_100094594
600 Ga0070682_100141373
601 Ga0068868_100033960
602 Ga0068868_100208250
603 Ga0070660_100001424
604 Ga0070660_100006417
605 Ga0070660_100017014
606 Ga0070660_100033991
607 Ga0070689_100011227
608 Ga0070689_100070388
609 Ga0070661_100001831
610 Ga0070661_100003536
611 Ga0070661_100007865
612 Ga0070661_100009438
613 Ga0070661_100012354
614 Ga0070661_100036305
615 Ga0070661_100054690
616 Ga0070692_10026720
617 Ga0070669_100054090
618 Ga0070669_100094003
619 Ga0070675_100059524
620 Ga0070675_100061771
621 Ga0070671_100016774
622 Ga0070671_100337845
623 Ga0070673_100017633
624 Ga0070673_100040597
625 Ga0070688_100014952
626 Ga0070659_100020158
627 Ga0070659_100023995
628 Ga0070659_100028613
629 Ga0070659_100115143
630 Ga0070659_100168536
631 Ga0070667_100028398
632 Ga0070667_100044467
633 Ga0070709_10061870
634 Ga0070714_100013550
635 Ga0070705_100010953
636 Ga0070700_100055462
637 Ga0070694_100015830
638 Ga0070663_100014024
639 Ga0070663_100121082
640 Ga0070678_100003725
641 Ga0070678_100208449
642 Ga0070662_100000836
643 Ga0070681_10002559
644 Ga0070681_10047687
645 Ga0070681_10089843
646 Ga0070685_10001663
647 Ga0070685_10001881
648 Ga0070707_100031265
649 Ga0070699_100022222
650 Ga0070679_100002918
651 Ga0070679_100025151
652 Ga0070679_100035826
653 Ga0070679_100038208
654 Ga0070684_100010852
655 Ga0070684_100017058
656 Ga0070697_100016546
657 Ga0068853_100013069
658 Ga0068853_100104695
659 Ga0068853_100109606
660 Ga0068853_100183987
661 Ga0070672_100034784
662 Ga0070695_100005747
663 Ga0070696_100016902
664 Ga0070696_100023628
665 Ga0070693_100002563
666 Ga0070665_100082387
667 Ga0070704_100189886
668 Ga0068855_100002546
669 Ga0068855_100022311
670 Ga0068855_100059960
671 Ga0068855_100341898
672 Ga0070664_100008394
673 Ga0070664_100009647
674 Ga0070664_100016817
675 Ga0070664_100028464
676 Ga0070664_100065826
677 Ga0070664_100094650
678 Ga0070664_100151243
679 Ga0068857_100004656
680 Ga0068857_100122249
681 Ga0068854_100003076
682 Ga0068854_100025183
683 Ga0068854_100100417
684 Ga0068856_100001602
685 Ga0068856_100058259
686 Ga0068856_100265146
687 Ga0068852_100002065
688 Ga0068852_100007728
689 Ga0068852_100008311
690 Ga0068852_100028380
691 Ga0068852_100030078
692 Ga0068852_100119015
693 Ga0068852_100137041
694 Ga0068859_100006388
695 Ga0068859_100043553
696 Ga0068864_100023643
697 Ga0068866_10001382
698 Ga0068861_100064739
699 Ga0068851_10002317
700 Ga0068851_10010765
701 Ga0068851_10049004
702 Ga0068863_100000521
703 Ga0068863_100010980
704 Ga0068858_100002595
705 Ga0068858_100062480
706 Ga0068860_100165232
707 Ga0068862_100013593
708 Ga0081455_10221121
709 Ga0081540_1009885
710 Ga0081539_10006541
711 Ga0097621_100035711
712 Ga0097621_100303583
713 Ga0068871_100021589
714 Ga0068871_100120521
715 Ga0068871_100192063
716 Ga0068865_100005114
717 Ga0068865_100180912
718 Ga0075436_100019016
719 Ga0097620_100006387
720 Ga0097620_100043554
721 Ga0105240_10046619
722 Ga0105240_10075677
723 Ga0105240_10135227
724 Ga0105240_10170468
725 Ga0111539_10022960
726 Ga0105245_10004684
727 Ga0105245_10004874
728 Ga0105243_10240364
729 Ga0105241_10005054
730 Ga0105241_10128560
731 Ga0105242_10007936
732 Ga0105248_10046839
733 Ga0105237_10252927
734 Ga0105238_10016630
735 Ga0105238_10022863
736 Ga0105238_10121488
737 Ga0105246_10097819
738 Ga0157373_10000924
739 Ga0157373_10005626
740 Ga0157373_10010452
741 Ga0157371_10000522
742 Ga0157371_10092963
743 Ga0157371_10109427
744 Ga0157371_10110555
745 Ga0157370_10019308
746 Ga0157370_10021260
747 Ga0157370_10024337
748 Ga0157370_10026655
749 Ga0157370_10030822
750 Ga0157370_10153070
751 Ga0157369_10002022
752 Ga0157369_10013944
753 Ga0157369_10052019
754 Ga0157369_10105364
755 Ga0157369_10111519
756 Ga0157374_10004205
757 Ga0157374_10104198
758 Ga0157378_10011028
759 Ga0157378_10016424
760 Ga0157378_10157456
761 Ga0163162_10005749
762 Ga0163162_10019620
763 Ga0157372_10000791
764 Ga0157372_10009509
765 Ga0157372_10023388
766 Ga0157372_10043976
767 Ga0157372_10133216
768 Ga0157372_10202722
769 Ga0157372_10212922
770 Ga0157372_10243311
771 Ga0157372_10298891
772 Ga0157375_10219422
773 Ga0163163_10047688
774 Ga0157379_10002212
775 Ga0157379_10009512
776 Ga0157376_10012087
777 Ga0163161_10025411
778 Ga0207697_10000450
779 Ga0207656_10005762
780 Ga0207656_10014690
781 Ga0207642_10001187
782 Ga0207688_10010358
783 Ga0207680_10048735
784 Ga0207680_10056941
785 Ga0207680_10074458
786 Ga0207699_10108194
787 Ga0207645_10001587
788 Ga0207643_10000429
789 Ga0207705_10012215
790 Ga0207705_10118089
791 Ga0207705_10138788
792 Ga0207684_10033492
793 Ga0207654_10004312
794 Ga0207654_10008078
795 Ga0207707_10003585
796 Ga0207707_10005932
797 Ga0207707_10033524
798 Ga0207695_10014512
799 Ga0207695_10038581
800 Ga0207695_10070564
801 Ga0207663_10024134
802 Ga0207660_10002460
803 Ga0207660_10118138
804 Ga0207660_10123786
805 Ga0207662_10022596
806 Ga0207662_10111683
807 Ga0207657_10000297
808 Ga0207657_10000657
809 Ga0207657_10004018
810 Ga0207657_10005722
811 Ga0207657_10015368
812 Ga0207657_10193448
813 Ga0207649_10003651
814 Ga0207649_10007402
815 Ga0207649_10032774
816 Ga0207649_10039934
817 Ga0207649_10117885
818 Ga0207649_10118456
819 Ga0207652_10011598
820 Ga0207652_10015423
821 Ga0207652_10023700
822 Ga0207652_10046377
823 Ga0207652_10184286
824 Ga0207681_10016827
825 Ga0207694_10041058
826 Ga0207650_10000503
827 Ga0207659_10001307
828 Ga0207687_10011244
829 Ga0207687_10014035
830 Ga0207664_10008715
831 Ga0207644_10007750
832 Ga0207644_10092409
833 Ga0207690_10000412
834 Ga0207690_10004753
835 Ga0207690_10032515
836 Ga0207690_10090755
837 Ga0207690_10151460
838 Ga0207706_10000164
839 Ga0207706_10066056
840 Ga0207686_10002716
841 Ga0207670_10003032
842 Ga0207691_10071179
843 Ga0207711_10000654
844 Ga0207689_10003889
845 Ga0207689_10021399
846 Ga0207689_10133337
847 Ga0207661_10009378
848 Ga0207661_10157323
849 Ga0207679_10000601
850 Ga0207679_10009854
851 Ga0207679_10011564
852 Ga0207679_10026327
853 Ga0207679_10052132
854 Ga0207667_10000695
855 Ga0207667_10003052
856 Ga0207667_10184620
857 Ga0207667_10203916
858 Ga0207667_10250929
859 Ga0207667_10274172
860 Ga0207667_10286994
861 Ga0207651_10034709
862 Ga0207651_10052331
863 Ga0207640_10005704
864 Ga0207640_10082952
865 Ga0207658_10004210
866 Ga0207658_10045089
867 Ga0207658_10064037
868 Ga0207677_10000162
869 Ga0207677_10029584
870 Ga0207703_10010978
871 Ga0207639_10013780
872 Ga0207639_10069988
873 Ga0207639_10423179
874 Ga0207678_10011759
875 Ga0207678_10148156
876 Ga0207678_10163519
877 Ga0207678_10294787
878 Ga0207708_10057134
879 Ga0207708_10351074
880 Ga0207702_10001837
881 Ga0207702_10042852
882 Ga0207702_10181386
883 Ga0207641_10002418
884 Ga0207648_10068279
885 Ga0207676_10000845
886 Ga0207676_10049890
887 Ga0207674_10000396
888 Ga0207674_10014843
889 Ga0207674_10105737
890 Ga0207675_100004233
891 Ga0207683_10001007
892 Ga0207698_10000732
893 Ga0207698_10007413
894 Ga0207698_10021638
895 Ga0207698_10027156
896 Ga0207698_10095682
897 Ga0207698_10294985
898 Ga0209974_10004530
899 Ga0268264_10005787
900 Ga0268264_10053425
901 Ga0268264_10162997
902 Ga0307408_100187220
903 Ga0307410_10015234
904 Ga0307407_10015800
905 Ga0307412_10010002
906 Ga0307409_100000903
907 Ga0307415_100004603
908 Ga0373923_0006384
909 Ga0373923_0021739
910 Ga0373936_0018609
911 Ga0373945_0034565
912 Ga0373945_0043741
913 Ga0373953_0002065
914 Ga0373954_0000001
915 Ga0373954_0005441
916 Ga0373954_0009183
917 Ga0373954_0018297
918 Ga0373956_0006326
919 Ga0373956_0010448
920 Ga0373943_0033098
921 Ga0373943_0036182
922 Ga0373955_0008460
923 Ga0373955_0017595
924 Ga0373955_0018192
925 Ga0373955_0026361
926 Ga0373924_0000883
927 Ga0373924_0006601
928 Ga0373924_0016434
929 Ga0373935_0031819
930 Ga0373927_0010594
931 Ga0373927_0127253
932 Ga0373933_0012221
933 Ga0373933_0037569
934 Ga0373933_0186966
935 Ga0373947_0015771
936 Ga0373947_0039702
937 Ga0373947_0041584
938 Ga0373937_0005181
939 Ga0373937_0020151
940 Ga0373937_0028653
941 Ga0373937_0032018
942 Ga0373937_0047293
943 Ga0373937_0227667
944 Ga0316584_0010926
945 Ga0373925_0010065
946 Ga0373925_0025023
947 Ga0373925_0033237
948 Ga0373925_0149014
949 Ga0373925_0218660
950 Ga0373925_0233943
951 Ga0395899_0001564
952 Ga0395900_0018529
953 Ga0395900_0262605
954 Ga0395898_0003262
955 Ga0395898_0053882
956 Ga0395905_0000126
957 Ga0395905_0005168
958 Ga0395905_0017017
959 Ga0395905_0041120
960 Ga0395901_0069291
961 Ga0439448_0053765
962 Ga0495592_0063538
963 Ga0495592_0066301
964 Ga0495592_0165457
965 Ga0495629_0020556
966 Ga0495651_0002598
967 Ga0495651_0007571
968 Ga0495651_0125247
969 Ga0495653_0007240
970 Ga0495653_0203989
971 Ga0495580_0012254
972 Ga0495580_0023199
973 Ga0495582_0003184
974 Ga0495582_0015855
975 Ga0495639_0024590
976 Ga0495664_0002776
977 Ga0495664_0033125
978 Ga0495594_0050909
979 Ga0495608_0010400
980 Ga0495608_0016080
981 Ga0495618_0011734
982 Ga0495628_0023409
983 Ga0495628_0033001
984 Ga0495628_0227203
985 Ga0495630_0018764
986 Ga0495630_0025880
987 Ga0495666_0041781
988 Ga0495652_0016901
989 Ga0495652_0036330
990 Ga0495652_0134326
991 Ga0495665_0010123
992 Ga0495665_0011441
993 Ga0495665_0105710
994 Ga0495640_0014254
995 Ga0495640_0015001
996 Ga0495586_0006225
997 Ga0495587_0002421
998 Ga0495587_0034279
999 Ga0495621_0005862
1000 Ga0495645_0000056
1001 Ga0495645_0004831
1002 Ga0495645_0005680
1003 Ga0495645_0010684
1004 Ga0495667_0000293
1005 Ga0495667_0016751
1006 Ga0495667_0135517
1007 Ga0495634_0026307
1008 Ga0495634_0069400
1009 Ga0495635_0037690
1010 Ga0495635_0063114
1011 Ga0495635_0168396
1012 Ga0495657_0027802
1013 Ga0495657_0041951
1014 Ga0495657_0214335
1015 Ga0495599_0016654
1016 Ga0495599_0029876
1017 Ga0495623_0018229
1018 Ga0495623_0073494
1019 Ga0495646_0001995
1020 Ga0495647_0002608
1021 Ga0495647_0014894
1022 Ga0495658_0003919
1023 Ga0495658_0012866
1024 Ga0495658_0013527
1025 Ga0495613_0061734
1026 Ga0495613_0078920
1027 Ga0495600_0010886
1028 Ga0495600_0032156
1029 Ga0495581_0001661
1030 Ga0495604_0003730
1031 Ga0495604_0022595
1032 Ga0495604_0089663
1033 Ga0495674_0001667
1034 Ga0495674_0001748
1035 Ga0495676_0059396
1036 Ga0495680_0003160
1037 Ga0495680_0026771
1038 Ga0495680_0044134
1039 Ga0495675_0013454
1040 Ga0495675_0021285
1041 Ga0495684_0002788
1042 Ga0495684_0020748
1043 Ga0495684_0055876
1044 Ga0495684_0177721
1045 Ga0495602_0003569
1046 Ga0496101_0009607
1047 Ga0496102_0011937
1048 Ga0496102_0028354
1049 Ga0496102_0166516
1050 Ga0496104_0091398
1051 Ga0496104_0285634
1052 Ga0496105_0062729
1053 Ga0496106_0005422
1054 Ga0496106_0069303
1055 Ga0496106_0173454
1056 Ga0496107_0038768
1057 Ga0496108_0213061
1058 Ga0496109_0101135
1059 Ga0496109_0316525
1060 Ga0496110_0034960
1061 Ga0496112_0018662
1062 Ga0496112_0124275
1063 Ga0501032_0240288
1064 Ga0501034_0207641
1065 Ga0501036_0364036
1066 Ga0501038_0176593
1067 Ga0501043_0000009
1068 Ga0501043_0020921
1069 Ga0501046_0000022
1070 Ga0501046_0044864
1071 Ga0501047_0000021
1072 Ga0501047_0020495
1073 Ga0501047_0023869
1074 Ga0501047_0067747
1075 Ga0501047_0104367
1076 Ga0501047_0242429
1077 Ga0501048_0003510
1078 Ga0501070_0000979
1079 Ga0501070_0031620
1080 Ga0501070_0069169
1081 Ga0501070_0158494
1082 Ga0501071_0145867
1083 Ga0501072_0004295
1084 Ga0501073_0042997
1085 Ga0501073_0054936
1086 Ga0501074_0006077
1087 Ga0501079_0008169
1088 Ga0501080_0010364
1089 Ga0501080_0022597
1090 Ga0501080_0109168
1091 Ga0501080_0285865
1092 Ga0501083_0112604
1093 Ga0501083_0158264
1094 Ga0501035_0060482
1095 Ga0501035_0068818
1096 Ga0501035_0147680
1097 Ga0501044_0055738
1098 Ga0501044_0076337
1099 Ga0501044_0129214
1100 Ga0501044_0257803
1101 Ga0501044_0298528
1102 nmdc:mga08y16_332360_c1
1103 nmdc:mga0n895_191062_c1
1104 nmdc:mga08x19_45651_c1
1105 Ga0495601_0004409
1106 Ga0495601_0023907
1107 Ga0495612_0002196
1108 Ga0495612_0102634
1109 Ga0495595_0001285
1110 Ga0495619_0007680
1111 Ga0495619_0008116
1112 Ga0495619_0012565
1113 Ga0495619_0017076
1114 Ga0495619_0042548
1115 Ga0495619_0070169
1116 Ga0501084_0253460
1117 Ga0501082_0077085
1118 2513643176
1119 2599940885
1120 2644287152
1121 2792584770
1122 2804755278
1123 2847675386
1124 2847692002
1125 2856320307
1126 2871446624
1127 2874103760
1128 2874127119
1129 2876371127
1130 2878042617
1131 2881149372
1132 2885332234
1133 2888354510
1134 2906330261
1135 2906420913
1136 2906634842
1137 2913296021
1138 2922132073
1139 2922165267
1140 2924727541
1141 2937893881
1142 2958118208
1143 2965066409
1144 2965123502
1145 2968092112
1146 2968098614
1147 2968130766
1148 2977860599
1149 2979750839
1150 2979782498
1151 2996346521
1152 8004451291
1153 8004709111
1154 8049297900

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

250

383

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.8047 79 152
4i9q-assembly2.cif.gz_B crystal structure of the ternary complex of the d714a mutant of rb69 dna polymerase 0.7244 82 154
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.7025 79 152
2zdi-assembly1.cif.gz_B-2 crystal structure of prefoldin from pyrococcus horikoshii ot3 0.6725 72 160
6vjf-assembly2.cif.gz_C the p-loop k to a mutation of c. therm vps1 gtpase-bse 0.6412 67 142
ID Description Score Start End Superfamily
2rmkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8047 79 152 1.10.287.160
5x60A03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7718 71 156 1.10.287.80
2x0lA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7662 71 156 1.10.287.80
5h6rA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7638 71 156 1.10.287.80
5lhhA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7614 71 156 1.10.287.80
ID Description Score Start End GO Terms
AF-H9ZS63-F1-model_v4 TRAP-type mannitol/chloroaromatic compound transport system, small permease component 0.896 193 355 GO:0005886
AF-A0A1V5DVT7-F1-model_v4 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM 0.8918 193 354 GO:0005886
AF-A0A661RPS1-F1-model_v4 Transporter 0.8907 193 350 GO:0005886
AF-A0A1J5DU15-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.8905 193 350 GO:0005886
AF-A0A1H0SP04-F1-model_v4 TRAP-type mannitol/chloroaromatic compound transport system, small permease component 0.887 193 354 GO:0005886

Map