F465627

General Info

Members Datasets Scaffolds Average Seq Length
577 301 572 267

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10072864|Ga0307515_100728643
Length 313
Sequence MTTATRTDVGISGRFEVSREDCVRVIAAAHAAEATPGPQRDARTMTKAARPLLSVRGVTVRFGGVVALHGVSFDVEAGHVCGLIGPNGAGKTTLFNCLSRLYDYQAGDILFEGESITRTPTHRMAALGIGRTFQNLAMFRTLAVRQNIMIGAHSRSSAGFLSSALRLPSVAAEERRLRERADQIMEYLDLTPFADRPAGDLPFGTQKRVEMGRALAADPKLLLLDEPAAGLNHEELGELARLILDVQNKLGITVLLVEHHMSLVMSVSNHIVALNFGRKIAEGTPEDIQQHPDVIAAYLGVPAAKEAARGQAA

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
4 2643221683 Variovorax sp. Root473 Isolate Unclassified
5 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
193 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
194 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
197 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
198 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
204 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0.17
Rhizoplane 2.77
Rhizosphere 80.42
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10006671 3300003322 Bacteria 2548
2 Ga0055536_1000313 3300003781 Bacteria 36453
3 Ga0055534_1003181 3300003784 Bacteria 5298
4 Ga0055540_1001615 3300003792 Bacteria 13125
5 Ga0065714_10003608 3300005288 Bacteria 8165
6 Ga0070658_10034455 3300005327 Bacteria 4073
7 Ga0070658_10282909 3300005327 Bacteria 1412
8 Ga0070658_10307384 3300005327 Bacteria 1353
9 Ga0070658_10407966 3300005327 Bacteria 1167
10 Ga0070683_100340063 3300005329 Bacteria 1429
11 Ga0070690_100022845 3300005330 Bacteria 3830
12 Ga0068869_100009111 3300005334 Bacteria 6430
13 Ga0068869_100017322 3300005334 Bacteria 4882
14 Ga0068869_100081702 3300005334 Bacteria 2414
15 Ga0068869_100282207 3300005334 Bacteria 1336
16 Ga0070682_100153645 3300005337 Bacteria 1582
17 Ga0068868_100110044 3300005338 Bacteria 2238
18 Ga0068868_100225946 3300005338 Bacteria 1569
19 Ga0070660_100036521 3300005339 Bacteria 3722
20 Ga0070689_100004177 3300005340 Bacteria 9731
21 Ga0070691_10028383 3300005341 Bacteria 2614
22 Ga0070691_10096430 3300005341 Bacteria 1464
23 Ga0070687_100195970 3300005343 Bacteria 1221
24 Ga0070674_100100286 3300005356 Bacteria 2108
25 Ga0070674_100244026 3300005356 Bacteria 1408
26 Ga0070673_100074784 3300005364 Bacteria 2731
27 Ga0070667_100007601 3300005367 Bacteria 8989
28 Ga0070703_10029468 3300005406 Bacteria 1648
29 Ga0070714_100083363 3300005435 Bacteria 2787
30 Ga0070714_100283884 3300005435 Bacteria 1539
31 Ga0070701_10000991 3300005438 Bacteria 10306
32 Ga0070700_100015782 3300005441 Bacteria 4290
33 Ga0070700_100224607 3300005441 Bacteria 1333
34 Ga0070694_100005593 3300005444 Bacteria 7617
35 Ga0070708_100188668 3300005445 Bacteria 1928
36 Ga0070662_100076893 3300005457 Bacteria 2476
37 Ga0070681_10016104 3300005458 Bacteria 7453
38 Ga0068867_100008427 3300005459 Bacteria 7272
39 Ga0068867_100034633 3300005459 Bacteria 3661
40 Ga0068867_100104542 3300005459 Bacteria 2167
41 Ga0070707_100009268 3300005468 Bacteria 9136
42 Ga0070707_100051793 3300005468 Bacteria 3935
43 Ga0070698_100014017 3300005471 Bacteria 8477
44 Ga0070698_100104018 3300005471 Bacteria 2809
45 Ga0070699_100056960 3300005518 Bacteria 3385
46 Ga0070699_100150425 3300005518 Bacteria 2059
47 Ga0070679_100008970 3300005530 Bacteria 9437
48 Ga0070679_100146363 3300005530 Bacteria 2340
49 Ga0070697_100005701 3300005536 Bacteria 9591
50 Ga0070697_100155213 3300005536 Bacteria 1932
51 Ga0070697_100189476 3300005536 Bacteria 1745
52 Ga0070686_100000247 3300005544 Bacteria 36839
53 Ga0070686_100538282 3300005544 Bacteria 912
54 Ga0070695_100070207 3300005545 Bacteria 2291
55 Ga0070696_100009913 3300005546 Bacteria 6373
56 Ga0070696_100028084 3300005546 Bacteria 3837
57 Ga0070696_100037206 3300005546 Bacteria 3357
58 Ga0070693_100004863 3300005547 Bacteria 6412
59 Ga0070665_100028109 3300005548 Bacteria 5664
60 Ga0070704_100002583 3300005549 Bacteria 10212
61 Ga0070704_100042182 3300005549 Bacteria 3155
62 Ga0070704_100060877 3300005549 Bacteria 2699
63 Ga0070704_100106303 3300005549 Bacteria 2126
64 Ga0070704_100109550 3300005549 Bacteria 2098
65 Ga0070704_100145376 3300005549 Bacteria 1857
66 Ga0070704_100468507 3300005549 Bacteria 1088
67 Ga0070704_100564399 3300005549 Bacteria 996
68 Ga0068855_100004439 3300005563 Bacteria 17139
69 Ga0068855_100145252 3300005563 Bacteria 2701
70 Ga0068855_100736919 3300005563 Bacteria 1052
71 Ga0068857_100037153 3300005577 Bacteria 4315
72 Ga0068856_100121853 3300005614 Bacteria 2610
73 Ga0070702_100006616 3300005615 Bacteria 5501
74 Ga0070702_100084168 3300005615 Bacteria 1912
75 Ga0068859_100069457 3300005617 Bacteria 3558
76 Ga0068859_100081859 3300005617 Bacteria 3270
77 Ga0068864_100019005 3300005618 Bacteria 5745
78 Ga0068866_10001059 3300005718 Bacteria 12119
79 Ga0068866_10025670 3300005718 Bacteria 2773
80 Ga0068861_100069416 3300005719 Bacteria 2726
81 Ga0068861_100134711 3300005719 Bacteria 2009
82 Ga0068861_100203621 3300005719 Bacteria 1663
83 Ga0068870_10013493 3300005840 Bacteria 3841
84 Ga0068870_10280646 3300005840 Bacteria 1044
85 Ga0068863_100036422 3300005841 Bacteria 4686
86 Ga0068858_100026741 3300005842 Bacteria 5359
87 Ga0068858_100061196 3300005842 Bacteria 3480
88 Ga0068860_100029749 3300005843 Bacteria 5255
89 Ga0068860_100046184 3300005843 Bacteria 4153
90 Ga0068860_100159542 3300005843 Bacteria 2174
91 Ga0068862_100008109 3300005844 Bacteria 8690
92 Ga0068862_100203566 3300005844 Bacteria 1786
93 Ga0068862_100213431 3300005844 Bacteria 1744
94 Ga0070717_10002978 3300006028 Bacteria 12053
95 Ga0075365_10003967 3300006038 Bacteria 7748
96 Ga0075365_10017503 3300006038 Bacteria 4385
97 Ga0075365_10086770 3300006038 Bacteria 2127
98 Ga0075365_10130700 3300006038 Bacteria 1737
99 Ga0075368_10013459 3300006042 Bacteria 3005
100 Ga0075363_100019885 3300006048 Bacteria 3362
101 Ga0075363_100061483 3300006048 Bacteria 2024
102 Ga0075363_100108332 3300006048 Bacteria 1542
103 Ga0075364_10030028 3300006051 Bacteria 3487
104 Ga0075364_10134509 3300006051 Bacteria 1661
105 Ga0070716_100136160 3300006173 Bacteria 1560
106 Ga0070712_100041731 3300006175 Bacteria 3152
107 Ga0075362_10004353 3300006177 Bacteria 5074
108 Ga0075362_10046452 3300006177 Bacteria 1931
109 Ga0075362_10063066 3300006177 Bacteria 1680
110 Ga0075362_10102155 3300006177 Bacteria 1342
111 Ga0075367_10002066 3300006178 Bacteria 8992
112 Ga0075367_10009549 3300006178 Bacteria 5075
113 Ga0075367_10080579 3300006178 Bacteria 1969
114 Ga0075369_10001746 3300006186 Bacteria 7534
115 Ga0075366_10000633 3300006195 Bacteria 16535
116 Ga0075366_10010021 3300006195 Bacteria 5310
117 Ga0075366_10030651 3300006195 Bacteria 3163
118 Ga0075366_10032938 3300006195 Bacteria 3052
119 Ga0075366_10041774 3300006195 Bacteria 2715
120 Ga0075366_10045907 3300006195 Bacteria 2588
121 Ga0075366_10064742 3300006195 Bacteria 2174
122 Ga0075366_10165569 3300006195 Bacteria 1340
123 Ga0097621_100014666 3300006237 Bacteria 5872
124 Ga0097621_100048033 3300006237 Bacteria 3461
125 Ga0075370_10000323 3300006353 Bacteria 17249
126 Ga0075370_10001147 3300006353 Bacteria 11127
127 Ga0075370_10002412 3300006353 Bacteria 8657
128 Ga0068871_100008295 3300006358 Bacteria 7466
129 Ga0075428_100061243 3300006844 Bacteria 4121
130 Ga0075428_100128960 3300006844 Bacteria 2752
131 Ga0075431_100309852 3300006847 Bacteria 1594
132 Ga0075431_100701064 3300006847 Bacteria 990
133 Ga0075434_100000132 3300006871 Bacteria 44951
134 Ga0075429_100000638 3300006880 Bacteria 27089
135 Ga0075429_100135451 3300006880 Bacteria 2155
136 Ga0068865_100001393 3300006881 Bacteria 14049
137 Ga0068865_100334617 3300006881 Bacteria 1222
138 Ga0097620_100069458 3300006931 Bacteria 3558
139 Ga0097620_100081857 3300006931 Bacteria 3270
140 Ga0075435_100001341 3300007076 Bacteria 15839
141 Ga0075435_100006450 3300007076 Bacteria 8299
142 Ga0075435_100383464 3300007076 Bacteria 1207
143 Ga0099794_10004485 3300007265 Bacteria 5496
144 Ga0105240_10031668 3300009093 Bacteria 6854
145 Ga0105245_10019196 3300009098 Bacteria 5987
146 Ga0105245_10047244 3300009098 Bacteria 3847
147 Ga0105245_10082487 3300009098 Bacteria 2941
148 Ga0105245_10420648 3300009098 Bacteria 1339
149 Ga0105247_10070929 3300009101 Bacteria 2178
150 Ga0114129_10007443 3300009147 Bacteria 15595
151 Ga0114129_10015516 3300009147 Bacteria 10831
152 Ga0114129_10707650 3300009147 Bacteria 1294
153 Ga0105243_10000293 3300009148 Bacteria 55165
154 Ga0105243_10001129 3300009148 Bacteria 24198
155 Ga0105243_10030887 3300009148 Bacteria 4128
156 Ga0105243_10055682 3300009148 Bacteria 3142
157 Ga0105243_10130133 3300009148 Bacteria 2134
158 Ga0105241_10148319 3300009174 Bacteria 1916
159 Ga0105241_10613204 3300009174 Bacteria 984
160 Ga0105242_10003998 3300009176 Bacteria 11461
161 Ga0105242_10117572 3300009176 Bacteria 2276
162 Ga0105248_10050176 3300009177 Bacteria 4680
163 Ga0105237_10060650 3300009545 Bacteria 3783
164 Ga0105237_10063038 3300009545 Bacteria 3705
165 Ga0105238_10030346 3300009551 Bacteria 5502
166 Ga0105249_10019624 3300009553 Bacteria 6033
167 Ga0105249_10074689 3300009553 Bacteria 3138
168 Ga0105239_10023366 3300010375 Bacteria 6808
169 Ga0105239_11158724 3300010375 Bacteria 890
170 Ga0105246_10647558 3300011119 Bacteria 919
171 Ga0157374_10050050 3300013296 Bacteria 3882
172 Ga0157374_10303774 3300013296 Bacteria 1579
173 Ga0157378_10001828 3300013297 Bacteria 19102
174 Ga0157378_10201519 3300013297 Bacteria 1882
175 Ga0157372_10079010 3300013307 Bacteria 3719
176 Ga0157375_10135257 3300013308 Bacteria 2588
177 Ga0157375_10396034 3300013308 Bacteria 1548
178 Ga0157375_10461385 3300013308 Bacteria 1436
179 Ga0163163_10402264 3300014325 Bacteria 1427
180 Ga0163163_10638938 3300014325 Bacteria 1128
181 Ga0157380_10135584 3300014326 Bacteria 2106
182 Ga0182008_10000057 3300014497 Bacteria 100700
183 Ga0157379_10014502 3300014968 Bacteria 6916
184 Ga0157379_10084096 3300014968 Bacteria 2852
185 Ga0157379_10203363 3300014968 Bacteria 1791
186 Ga0157379_10328619 3300014968 Bacteria 1397
187 Ga0157376_10016416 3300014969 Bacteria 5621
188 Ga0157376_10028875 3300014969 Bacteria 4413
189 Ga0157376_10127060 3300014969 Bacteria 2269
190 Ga0163161_10104436 3300017792 Bacteria 2112
191 Ga0213876_10034134 3300021384 Bacteria 2683
192 Ga0213875_10151085 3300021388 Bacteria 1088
193 Ga0209130_1001720 3300025284 Bacteria 13127
194 Ga0209675_1002415 3300025291 Bacteria 9634
195 Ga0209676_1000267 3300025292 Bacteria 109237
196 Ga0209676_1006250 3300025292 Bacteria 5935
197 Ga0209050_1009624 3300025298 Bacteria 4912
198 Ga0209050_1015410 3300025298 Bacteria 3213
199 Ga0209051_1000230 3300025303 Bacteria 94027
200 Ga0209051_1005092 3300025303 Bacteria 7811
201 Ga0209257_1004695 3300025304 Bacteria 10259
202 Ga0209257_1005713 3300025304 Bacteria 8541
203 Ga0207653_10050829 3300025885 Bacteria 1379
204 Ga0207642_10001218 3300025899 Bacteria 7965
205 Ga0207688_10074308 3300025901 Bacteria 1933
206 Ga0207645_10045172 3300025907 Bacteria 2816
207 Ga0207645_10097740 3300025907 Bacteria 1892
208 Ga0207643_10021144 3300025908 Bacteria 3572
209 Ga0207705_10027375 3300025909 Bacteria 4065
210 Ga0207705_10230280 3300025909 Bacteria 1409
211 Ga0207705_10235817 3300025909 Bacteria 1393
212 Ga0207684_10009615 3300025910 Bacteria 8528
213 Ga0207695_10060434 3300025913 Bacteria 3923
214 Ga0207695_10067326 3300025913 Bacteria 3674
215 Ga0207671_10019856 3300025914 Bacteria 5128
216 Ga0207671_10037914 3300025914 Bacteria 3573
217 Ga0207693_10028490 3300025915 Bacteria 4412
218 Ga0207662_10218292 3300025918 Bacteria 1241
219 Ga0207657_10045873 3300025919 Bacteria 3831
220 Ga0207652_10096073 3300025921 Bacteria 2611
221 Ga0207652_10383708 3300025921 Bacteria 1268
222 Ga0207646_10004415 3300025922 Bacteria 15298
223 Ga0207646_10008771 3300025922 Bacteria 10091
224 Ga0207646_10011967 3300025922 Bacteria 8364
225 Ga0207650_10204212 3300025925 Bacteria 1584
226 Ga0207687_10013443 3300025927 Bacteria 5344
227 Ga0207687_10130250 3300025927 Bacteria 1895
228 Ga0207687_10372130 3300025927 Bacteria 1168
229 Ga0207664_10173970 3300025929 Bacteria 1844
230 Ga0207664_10386367 3300025929 Bacteria 1243
231 Ga0207664_10533396 3300025929 Bacteria 1052
232 Ga0207706_10079522 3300025933 Bacteria 2883
233 Ga0207709_10000076 3300025935 Bacteria 173292
234 Ga0207709_10090791 3300025935 Bacteria 1996
235 Ga0207709_10095580 3300025935 Bacteria 1953
236 Ga0207709_10234822 3300025935 Bacteria 1330
237 Ga0207670_10122254 3300025936 Bacteria 1894
238 Ga0207669_10117932 3300025937 Bacteria 1795
239 Ga0207669_10275419 3300025937 Bacteria 1266
240 Ga0207704_10196429 3300025938 Bacteria 1472
241 Ga0207689_10000673 3300025942 Bacteria 32601
242 Ga0207689_10007510 3300025942 Bacteria 9558
243 Ga0207689_10073455 3300025942 Bacteria 2810
244 Ga0207689_10136195 3300025942 Bacteria 2022
245 Ga0207689_10177754 3300025942 Bacteria 1755
246 Ga0207661_10458954 3300025944 Bacteria 1161
247 Ga0207667_10206428 3300025949 Bacteria 2014
248 Ga0207667_10208201 3300025949 Bacteria 2005
249 Ga0207667_10366929 3300025949 Bacteria 1468
250 Ga0207651_10028252 3300025960 Bacteria 3536
251 Ga0207712_10041781 3300025961 Bacteria 3153
252 Ga0207712_10557531 3300025961 Bacteria 986
253 Ga0207677_10100644 3300026023 Bacteria 2126
254 Ga0207703_10004160 3300026035 Bacteria 11933
255 Ga0207703_10031793 3300026035 Bacteria 4175
256 Ga0207703_10194450 3300026035 Bacteria 1799
257 Ga0207639_10156859 3300026041 Bacteria 1913
258 Ga0207708_10000998 3300026075 Bacteria 21173
259 Ga0207708_10003798 3300026075 Bacteria 11139
260 Ga0207708_10031092 3300026075 Bacteria 4051
261 Ga0207702_10070769 3300026078 Bacteria 3001
262 Ga0207641_10120412 3300026088 Bacteria 2341
263 Ga0207648_10001170 3300026089 Bacteria 29352
264 Ga0207648_10017778 3300026089 Bacteria 6456
265 Ga0207648_10018068 3300026089 Bacteria 6388
266 Ga0207648_10075312 3300026089 Bacteria 2942
267 Ga0207648_10329754 3300026089 Bacteria 1373
268 Ga0207674_10006174 3300026116 Bacteria 14144
269 Ga0207674_10065127 3300026116 Bacteria 3674
270 Ga0207675_100000583 3300026118 Bacteria 35648
271 Ga0207675_100041652 3300026118 Bacteria 4288
272 Ga0207675_100135758 3300026118 Bacteria 2334
273 Ga0209995_1023511 3300027471 Bacteria 1025
274 Ga0209999_1000946 3300027543 Bacteria 4895
275 Ga0209983_1013262 3300027665 Bacteria 1694
276 Ga0268266_10132081 3300028379 Bacteria 2234
277 Ga0268265_10005090 3300028380 Bacteria 9014
278 Ga0268265_10166724 3300028380 Bacteria 1878
279 Ga0268264_10053528 3300028381 Bacteria 3367
280 Ga0268264_10188658 3300028381 Bacteria 1878
281 Ga0268264_10357694 3300028381 Bacteria 1391
282 Ga0307515_10000014 3300028794 Bacteria 562358
283 Ga0307515_10072864 3300028794 Bacteria 4627
284 Ga0265325_10063097 3300031241 Bacteria 1876
285 Ga0265329_10043310 3300031242 Bacteria 1440
286 Ga0265340_10056503 3300031247 Bacteria 1888
287 Ga0307513_10001376 3300031456 Bacteria 35012
288 Ga0307513_10013819 3300031456 Bacteria 9897
289 Ga0307513_10026911 3300031456 Bacteria 6615
290 Ga0307408_100480043 3300031548 Bacteria 1084
291 Ga0307408_100667485 3300031548 Bacteria 931
292 Ga0265313_10000007 3300031595 Bacteria 178640
293 Ga0265314_10020787 3300031711 Bacteria 5062
294 Ga0265314_10039722 3300031711 Bacteria 3385
295 Ga0265342_10032558 3300031712 Bacteria 3215
296 Ga0265342_10068057 3300031712 Bacteria 2082
297 Ga0307516_10014503 3300031730 Bacteria 8332
298 Ga0307405_10046349 3300031731 Bacteria 2670
299 Ga0307414_10281076 3300032004 Bacteria 1398
300 Ga0307411_10043524 3300032005 Bacteria 2873
301 Ga0373957_0056246 3300035120 Bacteria 1514
302 Ga0373943_0028923 3300035170 Bacteria 2615
303 Ga0373955_0004531 3300035172 Bacteria 6156
304 Ga0373924_0003359 3300035410 Bacteria 5498
305 Ga0373931_0196023 3300035691 Bacteria 1204
306 Ga0373933_0002353 3300035724 Bacteria 10700
307 Ga0373937_0003134 3300036401 Bacteria 13831
308 Ga0373937_0055911 3300036401 Bacteria 3623
309 Ga0373937_0773515 3300036401 Bacteria 908
310 Ga0395900_0024795 3300037418 Bacteria 6139
311 Ga0395900_0392675 3300037418 Bacteria 1353
312 Ga0395898_0017213 3300037466 Bacteria 7381
313 Ga0395898_0050626 3300037466 Bacteria 4065
314 Ga0395905_0000180 3300037471 Bacteria 100693
315 Ga0395905_0001562 3300037471 Bacteria 27356
316 Ga0395905_0087967 3300037471 Bacteria 2912
317 Ga0395905_0153818 3300037471 Bacteria 2163
318 Ga0395905_0210323 3300037471 Bacteria 1822
319 Ga0395905_0230355 3300037471 Bacteria 1732
320 Ga0436364_0448380 3300037853 Bacteria 2128
321 Ga0436364_1070606 3300037853 Bacteria 1216
322 Ga0395901_0024791 3300038443 Bacteria 6157
323 Ga0395901_0028082 3300038443 Bacteria 5788
324 Ga0395901_0069423 3300038443 Bacteria 3670
325 Ga0395901_0151258 3300038443 Bacteria 2439
326 Ga0395901_0269744 3300038443 Bacteria 1770
327 Ga0395901_0327505 3300038443 Bacteria 1584
328 Ga0395901_0416674 3300038443 Bacteria 1378
329 Ga0436365_1295484 3300039437 Bacteria 1027
330 Ga0436360_0964426 3300039438 Bacteria 2063
331 Ga0436361_0213696 3300039447 Bacteria 1478
332 Ga0436361_0670097 3300039447 Bacteria 1076
333 Ga0436361_1140218 3300039447 Bacteria 3155
334 Ga0439436_0007642 3300041404 Bacteria 3326
335 Ga0439439_0037914 3300041406 Bacteria 1243
336 Ga0439447_017604 3300041407 Bacteria 1944
337 Ga0439453_0003181 3300041408 Bacteria 2338
338 Ga0439466_0026535 3300041411 Bacteria 2013
339 Ga0439465_0003028 3300041413 Bacteria 5494
340 Ga0439465_0045727 3300041413 Bacteria 1424
341 Ga0439433_0001968 3300041999 Bacteria 4306
342 Ga0439445_0000586 3300042004 Bacteria 7445
343 Ga0439449_0008794 3300042007 Bacteria 3830
344 Ga0439452_002437 3300042010 Bacteria 6858
345 Ga0439457_004343 3300042014 Bacteria 3714
346 Ga0439462_0000724 3300042015 Bacteria 6805
347 Ga0450911_000599 3300042115 Bacteria 10973
348 Ga0450920_015251 3300042122 Bacteria 1461
349 Ga0450923_001005 3300042125 Bacteria 3516
350 Ga0450898_017083 3300042134 Bacteria 1245
351 Ga0450899_007976 3300042135 Bacteria 1157
352 Ga0450899_010541 3300042135 Bacteria 1026
353 Ga0450903_015703 3300042138 Bacteria 1191
354 Ga0450906_006060 3300042145 Bacteria 2456
355 Ga0439446_0026452 3300042156 Bacteria 1662
356 Ga0439446_0064259 3300042156 Bacteria 1114
357 Ga0450908_009248 3300042184 Bacteria 1832
358 Ga0439434_0002341 3300042435 Bacteria 5514
359 Ga0439434_0004891 3300042435 Bacteria 3919
360 Ga0439435_0000049 3300042436 Bacteria 13342
361 Ga0439435_0058171 3300042436 Bacteria 1121
362 Ga0439444_0003193 3300042437 Bacteria 2302
363 Ga0450893_0005996 3300042532 Bacteria 1959
364 Ga0451577_0003923 3300042876 Bacteria 16072
365 Ga0451577_0099058 3300042876 Bacteria 2603
366 Ga0451577_0139425 3300042876 Bacteria 2178
367 Ga0451577_0679033 3300042876 Bacteria 933
368 Ga0466969_0015338 3300044656 Bacteria 4016
369 Ga0466966_0003903 3300044684 Bacteria 9843
370 Ga0466964_0202035 3300044706 Bacteria 955
371 Ga0453684_0098821 3300044712 Bacteria 3577
372 Ga0453684_0114391 3300044712 Bacteria 3271
373 Ga0453684_0140881 3300044712 Bacteria 2880
374 Ga0466970_0185710 3300044765 Bacteria 1154
375 Ga0466960_0036523 3300044901 Bacteria 2301
376 Ga0466959_0008562 3300045049 Bacteria 7240
377 Ga0451576_0058153 3300045051 Bacteria 4041
378 Ga0451576_0118671 3300045051 Bacteria 2754
379 Ga0495653_0169056 3300046463 Bacteria 1511
380 Ga0495653_0337828 3300046463 Bacteria 972
381 Ga0495650_0039724 3300046471 Bacteria 2028
382 Ga0495580_0261645 3300046472 Bacteria 1183
383 Ga0495630_0088712 3300046517 Bacteria 2336
384 Ga0495642_0023443 3300046528 Bacteria 2436
385 Ga0495621_0010736 3300046539 Bacteria 2813
386 Ga0495621_0015071 3300046539 Bacteria 2459
387 Ga0495597_0011926 3300046542 Bacteria 4204
388 Ga0495667_0087137 3300046559 Bacteria 2025
389 Ga0495667_0326430 3300046559 Bacteria 971
390 Ga0495656_0000163 3300046615 Bacteria 24459
391 Ga0495656_0003746 3300046615 Bacteria 5163
392 Ga0495625_0056474 3300046660 Bacteria 2794
393 Ga0495635_0193792 3300046663 Bacteria 1379
394 Ga0495661_0265790 3300046665 Bacteria 870
395 Ga0495588_0031332 3300046674 Bacteria 2676
396 Ga0495669_0082404 3300046684 Bacteria 1478
397 Ga0495670_0154673 3300046691 Bacteria 1203
398 Ga0495649_0000541 3300046694 Bacteria 32077
399 Ga0495600_0287915 3300046809 Bacteria 1038
400 Ga0495604_0132267 3300047317 Bacteria 1792
401 Ga0495687_000174 3300047443 Bacteria 95031
402 Ga0495675_0284099 3300047444 Bacteria 986
403 Ga0495684_0277771 3300047471 Bacteria 1210
404 Ga0495615_0002109 3300048090 Bacteria 3120
405 Ga0495626_0083205 3300048091 Bacteria 1418
406 Ga0495626_0093038 3300048091 Bacteria 1324
407 Ga0495626_0136050 3300048091 Bacteria 1045
408 Ga0496101_0061948 3300048904 Bacteria 2719
409 Ga0496102_0007327 3300048905 Bacteria 9419
410 Ga0496102_0027593 3300048905 Bacteria 5070
411 Ga0496102_0101591 3300048905 Bacteria 2672
412 Ga0496104_0498048 3300048907 Bacteria 1129
413 Ga0496104_0533919 3300048907 Bacteria 1084
414 Ga0496105_0040504 3300048908 Bacteria 3842
415 Ga0496105_0155266 3300048908 Bacteria 1880
416 Ga0496105_0293714 3300048908 Bacteria 1308
417 Ga0496106_0157216 3300048909 Bacteria 1796
418 Ga0496109_0080718 3300048912 Bacteria 2997
419 Ga0496109_0185560 3300048912 Bacteria 1954
420 Ga0496109_0214020 3300048912 Bacteria 1812
421 Ga0496110_0124275 3300048913 Bacteria 2327
422 Ga0496111_0148736 3300048914 Bacteria 1737
423 Ga0496112_0540589 3300048915 Bacteria 1099
424 Ga0496121_0002968 3300048924 Bacteria 24705
425 Ga0496125_0004911 3300048928 Bacteria 15140
426 Ga0496125_0026075 3300048928 Bacteria 5337
427 Ga0496125_0047579 3300048928 Bacteria 3584
428 Ga0496126_0061462 3300048929 Bacteria 3374
429 Ga0496126_0277110 3300048929 Bacteria 1390
430 Ga0501033_0054334 3300049570 Bacteria 2963
431 Ga0501033_0316274 3300049570 Bacteria 1097
432 Ga0501034_0101591 3300049571 Bacteria 2869
433 Ga0501034_0118040 3300049571 Bacteria 2640
434 Ga0501036_0004009 3300049572 Bacteria 11843
435 Ga0501036_0025927 3300049572 Bacteria 4946
436 Ga0501036_0097383 3300049572 Bacteria 2486
437 Ga0501038_0010789 3300049574 Bacteria 8350
438 Ga0501038_0020071 3300049574 Bacteria 6013
439 Ga0501038_0083616 3300049574 Bacteria 2686
440 Ga0501038_0103088 3300049574 Bacteria 2373
441 Ga0501039_0025900 3300049575 Bacteria 4510
442 Ga0501039_0033134 3300049575 Bacteria 3985
443 Ga0501039_0085997 3300049575 Bacteria 2449
444 Ga0501040_0030527 3300049576 Bacteria 3641
445 Ga0501041_0022444 3300049577 Bacteria 3779
446 Ga0501042_0254032 3300049578 Bacteria 1268
447 Ga0501043_0001183 3300049579 Bacteria 22974
448 Ga0501043_0005068 3300049579 Bacteria 10654
449 Ga0501043_0005128 3300049579 Bacteria 10602
450 Ga0501043_0049809 3300049579 Bacteria 3293
451 Ga0501043_0082393 3300049579 Bacteria 2528
452 Ga0501043_0250656 3300049579 Bacteria 1364
453 Ga0501046_0072755 3300049580 Bacteria 2668
454 Ga0501046_0079051 3300049580 Bacteria 2543
455 Ga0501046_0110210 3300049580 Bacteria 2104
456 Ga0501046_0154325 3300049580 Bacteria 1731
457 Ga0501047_0000363 3300049581 Bacteria 51477
458 Ga0501047_0006481 3300049581 Bacteria 11015
459 Ga0501047_0065184 3300049581 Bacteria 3511
460 Ga0501047_0093289 3300049581 Bacteria 2889
461 Ga0501047_0114524 3300049581 Bacteria 2579
462 Ga0501047_0207716 3300049581 Bacteria 1817
463 Ga0501048_0015399 3300049582 Bacteria 5647
464 Ga0501067_0095181 3300049583 Bacteria 1653
465 Ga0501068_0027028 3300049584 Bacteria 3385
466 Ga0501069_0082267 3300049585 Bacteria 1814
467 Ga0501069_0119348 3300049585 Bacteria 1506
468 Ga0501070_0015722 3300049586 Bacteria 6364
469 Ga0501070_0050177 3300049586 Bacteria 3464
470 Ga0501070_0065748 3300049586 Bacteria 3003
471 Ga0501070_0088225 3300049586 Bacteria 2567
472 Ga0501070_0159434 3300049586 Bacteria 1860
473 Ga0501070_0173877 3300049586 Bacteria 1773
474 Ga0501071_0139162 3300049587 Bacteria 1807
475 Ga0501072_0090486 3300049588 Bacteria 2429
476 Ga0501072_0122300 3300049588 Bacteria 2074
477 Ga0501072_0124630 3300049588 Bacteria 2052
478 Ga0501072_0198083 3300049588 Bacteria 1601
479 Ga0501072_0287700 3300049588 Bacteria 1307
480 Ga0501073_0026703 3300049589 Bacteria 4134
481 Ga0501073_0078745 3300049589 Bacteria 2294
482 Ga0501073_0331116 3300049589 Bacteria 1051
483 Ga0501074_0006091 3300049590 Bacteria 8709
484 Ga0501074_0008422 3300049590 Bacteria 7478
485 Ga0501075_0000078 3300049591 Bacteria 43796
486 Ga0501076_0000002 3300049592 Bacteria 165396
487 Ga0501076_0187614 3300049592 Bacteria 1687
488 Ga0501077_0283605 3300049593 Bacteria 1054
489 Ga0501079_0019020 3300049741 Bacteria 5246
490 Ga0501079_0020967 3300049741 Bacteria 4995
491 Ga0501080_0000279 3300049742 Bacteria 38549
492 Ga0501080_0027798 3300049742 Bacteria 5259
493 Ga0501080_0448674 3300049742 Bacteria 1156
494 Ga0501081_0101605 3300049743 Bacteria 2033
495 Ga0501081_0147609 3300049743 Bacteria 1688
496 Ga0501081_0308044 3300049743 Bacteria 1162
497 Ga0501081_0398076 3300049743 Bacteria 1019
498 Ga0501083_0000567 3300049744 Bacteria 23671
499 Ga0501083_0050253 3300049744 Bacteria 2807
500 Ga0501083_0054146 3300049744 Bacteria 2693
501 Ga0501083_0103885 3300049744 Bacteria 1872
502 Ga0501035_0017995 3300049822 Bacteria 6515
503 Ga0501035_0025466 3300049822 Bacteria 5424
504 Ga0501035_0080034 3300049822 Bacteria 2885
505 Ga0501035_0105640 3300049822 Bacteria 2469
506 Ga0501044_0001849 3300049823 Bacteria 24605
507 Ga0501044_0104177 3300049823 Bacteria 2851
508 Ga0501044_0108878 3300049823 Bacteria 2780
509 Ga0501044_0183746 3300049823 Bacteria 2056
510 Ga0501045_0098720 3300049824 Bacteria 2160
511 Ga0501045_0314498 3300049824 Bacteria 1165
512 nmdc:mga03683_14888_c1 3300050489 Bacteria 2889
513 nmdc:mga03683_1540_c1 3300050489 Bacteria 6871
514 nmdc:mga03683_5161_c1 3300050489 Bacteria 4391
515 nmdc:mga03683_56278_c1 3300050489 Bacteria 1653
516 nmdc:mga03683_59256_c1 3300050489 Bacteria 1615
517 nmdc:mga03683_88628_c1 3300050489 Bacteria 1346
518 nmdc:mga03n38_193261_c1 3300050490 Bacteria 1049
519 nmdc:mga03n38_6527_c1 3300050490 Bacteria 4061
520 nmdc:mga03n38_70248_c1 3300050490 Bacteria 1619
521 nmdc:mga00v17_349361_c1 3300050491 Bacteria 961
522 nmdc:mga00v17_9302_c1 3300050491 Bacteria 5314
523 nmdc:mga00v17_97174_c1 3300050491 Bacteria 1856
524 nmdc:mga0yw44_1966_c1 3300050492 Bacteria 8521
525 nmdc:mga0yw44_56202_c1 3300050492 Bacteria 2397
526 nmdc:mga0yw44_70861_c1 3300050492 Bacteria 2163
527 nmdc:mga0k408_11155_c1 3300050493 Bacteria 4885
528 nmdc:mga0k408_148282_c1 3300050493 Bacteria 1397
529 nmdc:mga0k408_178433_c1 3300050493 Bacteria 1267
530 nmdc:mga0k408_2967_c1 3300050493 Bacteria 9000
531 nmdc:mga0k408_5135_c1 3300050493 Bacteria 3674
532 nmdc:mga0k408_63245_c1 3300050493 Bacteria 2153
533 nmdc:mga0k408_84667_c1 3300050493 Bacteria 1439
534 nmdc:mga0k408_9816_c1 3300050493 Bacteria 5170
535 nmdc:mga06z11_67391_c1 3300050494 Bacteria 1884
536 nmdc:mga06z11_85826_c1 3300050494 Bacteria 1699
537 nmdc:mga07m45_132261_c1 3300050496 Bacteria 1444
538 nmdc:mga07m45_298073_c1 3300050496 Bacteria 938
539 nmdc:mga07m45_33632_c1 3300050496 Bacteria 2848
540 nmdc:mga07m45_5562_c1 3300050496 Bacteria 6287
541 nmdc:mga07m45_756_c1 3300050496 Bacteria 13842
542 nmdc:mga07m45_8395_c1 3300050496 Bacteria 5307
543 nmdc:mga05p37_21838_c1 3300050507 Bacteria 7754
544 nmdc:mga05p37_980_c1 3300050507 Bacteria 32442
545 nmdc:mga09592_136871_c1 3300050508 Bacteria 2110
546 nmdc:mga09592_947_c1 3300050508 Bacteria 22820
547 nmdc:mga0qj67_705_c1 3300050509 Bacteria 22775
548 nmdc:mga06r32_2106_c1 3300050510 Bacteria 17820
549 nmdc:mga06r32_210852_c1 3300050510 Bacteria 1930
550 nmdc:mga06r32_393827_c1 3300050510 Bacteria 1367
551 nmdc:mga06r32_85802_c1 3300050510 Bacteria 3070
552 nmdc:mga0n895_393151_c1 3300050512 Bacteria 1403
553 nmdc:mga0n895_698018_c1 3300050512 Bacteria 1011
554 nmdc:mga0rr50_26750_c1 3300050513 Bacteria 4031
555 nmdc:mga0rr50_475609_c1 3300050513 Bacteria 1061
556 nmdc:mga0rr50_65593_c1 3300050513 Bacteria 2751
557 nmdc:mga08x19_115910_c1 3300050514 Bacteria 1791
558 nmdc:mga08x19_15018_c1 3300050514 Bacteria 4703
559 nmdc:mga0sz30_6027_c1 3300050516 Bacteria 4479
560 Ga0495601_0026917 3300053077 Bacteria 3554
561 Ga0495601_0224374 3300053077 Bacteria 1227
562 Ga0495595_0026874 3300053084 Bacteria 2560
563 Ga0495595_0056279 3300053084 Bacteria 1832
564 Ga0495619_0022146 3300053085 Bacteria 4063
565 Ga0500618_012879 3300053125 Bacteria 2178
566 Ga0500568_0017764 3300053139 Bacteria 3131
567 Ga0501084_0125361 3300054114 Bacteria 2161
568 Ga0501084_0179077 3300054114 Bacteria 1789
569 Ga0501084_0468826 3300054114 Bacteria 1064
570 Ga0501082_0000013 3300060353 Bacteria 119623
571 Ga0501082_0012631 3300060353 Bacteria 7260
572 Ga0530510_0000024 3300061734 Bacteria 68684

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0118671 Ga0451576_0118671_1248_2135 233
2 3300042876 Ga0451577_0099058 Ga0451577_0099058_484_1338 238
3 3300044712 Ga0453684_0098821 Ga0453684_0098821_2418_3272 238
4 3300045051 Ga0451576_0058153 Ga0451576_0058153_2394_3248 238
5 3300006177 Ga0075362_10063066 Ga0075362_100630662 244
6 3300006178 Ga0075367_10002066 Ga0075367_100020668 244
7 3300006186 Ga0075369_10001746 Ga0075369_100017463 244
8 3300006195 Ga0075366_10010021 Ga0075366_100100213 244
9 3300006195 Ga0075366_10041774 Ga0075366_100417742 244
10 3300006353 Ga0075370_10001147 Ga0075370_1000114710 244
11 3300005343 Ga0070687_100195970 Ga0070687_1001959701 246
12 3300006353 Ga0075370_10000323 Ga0075370_1000032318 246
13 3300025918 Ga0207662_10218292 Ga0207662_102182922 246
14 3300042135 Ga0450899_007976 Ga0450899_007976_123_911 246
15 3300042135 Ga0450899_010541 Ga0450899_010541_51_815 246
16 3300046694 Ga0495649_0000541 Ga0495649_0000541_6756_7541 246
17 3300048091 Ga0495626_0093038 Ga0495626_0093038_283_1068 246
18 3300050489 nmdc:mga03683_5161_c1 nmdc:mga03683_5161_c1_1544_2317 246
19 3300050493 nmdc:mga0k408_5135_c1 nmdc:mga0k408_5135_c1_1065_1838 246
20 3300050493 nmdc:mga0k408_9816_c1 nmdc:mga0k408_9816_c1_2319_3092 246
21 3300050496 nmdc:mga07m45_756_c1 nmdc:mga07m45_756_c1_12914_13687 246
22 3300050516 nmdc:mga0sz30_6027_c1 nmdc:mga0sz30_6027_c1_762_1535 246
23 3300053139 Ga0500568_0017764 Ga0500568_0017764_2189_2974 246
24 3300006048 Ga0075363_100061483 Ga0075363_1000614833 248
25 3300006177 Ga0075362_10004353 Ga0075362_100043533 248
26 3300050489 nmdc:mga03683_1540_c1 nmdc:mga03683_1540_c1_1720_2538 248
27 3300050490 nmdc:mga03n38_70248_c1 nmdc:mga03n38_70248_c1_461_1279 248
28 3300009545 Ga0105237_10063038 Ga0105237_100630382 251
29 3300010375 Ga0105239_10023366 Ga0105239_100233662 251
30 3300031456 Ga0307513_10013819 Ga0307513_1001381910 251
31 3300038443 Ga0395901_0028082 Ga0395901_0028082_3576_4337 251
32 3300041408 Ga0439453_0003181 Ga0439453_0003181_17_772 251
33 3300042156 Ga0439446_0064259 Ga0439446_0064259_85_840 251
34 3300042437 Ga0439444_0003193 Ga0439444_0003193_1382_2137 251
35 3300046559 Ga0495667_0087137 Ga0495667_0087137_506_1261 251
36 3300048905 Ga0496102_0007327 Ga0496102_0007327_5477_6232 251
37 3300049572 Ga0501036_0004009 Ga0501036_0004009_527_1285 251
38 3300049574 Ga0501038_0010789 Ga0501038_0010789_5391_6149 251
39 3300049575 Ga0501039_0025900 Ga0501039_0025900_1001_1759 251
40 3300049576 Ga0501040_0030527 Ga0501040_0030527_2636_3394 251
41 3300049577 Ga0501041_0022444 Ga0501041_0022444_229_987 251
42 3300049578 Ga0501042_0254032 Ga0501042_0254032_476_1234 251
43 3300049579 Ga0501043_0250656 Ga0501043_0250656_579_1337 251
44 3300049580 Ga0501046_0110210 Ga0501046_0110210_97_855 251
45 3300049582 Ga0501048_0015399 Ga0501048_0015399_1434_2192 251
46 3300049587 Ga0501071_0139162 Ga0501071_0139162_939_1697 251
47 3300049588 Ga0501072_0124630 Ga0501072_0124630_367_1125 251
48 3300049591 Ga0501075_0000078 Ga0501075_0000078_207_965 251
49 3300049592 Ga0501076_0000002 Ga0501076_0000002_123398_124156 251
50 3300049593 Ga0501077_0283605 Ga0501077_0283605_53_811 251
51 3300049741 Ga0501079_0020967 Ga0501079_0020967_1959_2717 251
52 3300049743 Ga0501081_0101605 Ga0501081_0101605_117_875 251
53 3300049824 Ga0501045_0098720 Ga0501045_0098720_330_1088 251
54 3300050510 nmdc:mga06r32_85802_c1 nmdc:mga06r32_85802_c1_1972_2727 251
55 3300054114 Ga0501084_0179077 Ga0501084_0179077_680_1438 251
56 3300060353 Ga0501082_0012631 Ga0501082_0012631_3797_4555 251
57 3300061734 Ga0530510_0000024 Ga0530510_0000024_52434_53192 251
58 3300009147 Ga0114129_10007443 Ga0114129_1000744310 252
59 3300035691 Ga0373931_0196023 Ga0373931_0196023_289_1065 252
60 3300046542 Ga0495597_0011926 Ga0495597_0011926_256_1047 252
61 3300047443 Ga0495687_000174 Ga0495687_000174_85913_86704 252
62 3300048091 Ga0495626_0136050 Ga0495626_0136050_128_919 252
63 3300048907 Ga0496104_0498048 Ga0496104_0498048_271_1029 252
64 3300048908 Ga0496105_0040504 Ga0496105_0040504_505_1275 252
65 3300048909 Ga0496106_0157216 Ga0496106_0157216_91_849 252
66 3300048912 Ga0496109_0185560 Ga0496109_0185560_585_1355 252
67 3300049570 Ga0501033_0316274 Ga0501033_0316274_174_935 252
68 3300049581 Ga0501047_0006481 Ga0501047_0006481_6579_7340 252
69 3300049586 Ga0501070_0065748 Ga0501070_0065748_1225_1986 252
70 3300049586 Ga0501070_0159434 Ga0501070_0159434_70_831 252
71 3300049589 Ga0501073_0331116 Ga0501073_0331116_280_1041 252
72 3300049822 Ga0501035_0105640 Ga0501035_0105640_19_780 252
73 3300050493 nmdc:mga0k408_148282_c1 nmdc:mga0k408_148282_c1_535_1326 252
74 3300050507 nmdc:mga05p37_980_c1 nmdc:mga05p37_980_c1_23610_24368 252
75 3300050508 nmdc:mga09592_947_c1 nmdc:mga09592_947_c1_8272_9030 252
76 3300050510 nmdc:mga06r32_2106_c1 nmdc:mga06r32_2106_c1_8444_9202 252
77 3300050510 nmdc:mga06r32_393827_c1 nmdc:mga06r32_393827_c1_290_1048 252
78 iso_pu_bacteria 2917699015 2917701097 252
79 3300005406 Ga0070703_10029468 Ga0070703_100294682 253
80 3300005445 Ga0070708_100188668 Ga0070708_1001886682 253
81 3300005468 Ga0070707_100009268 Ga0070707_1000092683 253
82 3300005468 Ga0070707_100051793 Ga0070707_1000517935 253
83 3300005471 Ga0070698_100104018 Ga0070698_1001040184 253
84 3300005518 Ga0070699_100150425 Ga0070699_1001504253 253
85 3300005536 Ga0070697_100155213 Ga0070697_1001552132 253
86 3300005536 Ga0070697_100189476 Ga0070697_1001894762 253
87 3300005549 Ga0070704_100564399 Ga0070704_1005643991 253
88 3300006028 Ga0070717_10002978 Ga0070717_100029789 253
89 3300025885 Ga0207653_10050829 Ga0207653_100508291 253
90 3300025910 Ga0207684_10009615 Ga0207684_100096153 253
91 3300025921 Ga0207652_10383708 Ga0207652_103837082 253
92 3300025922 Ga0207646_10004415 Ga0207646_100044158 253
93 3300025922 Ga0207646_10008771 Ga0207646_100087717 253
94 3300025922 Ga0207646_10011967 Ga0207646_100119678 253
95 3300042134 Ga0450898_017083 Ga0450898_017083_170_1009 253
96 3300014497 Ga0182008_10000057 Ga0182008_1000005755 254
97 3300025929 Ga0207664_10173970 Ga0207664_101739702 254
98 3300050514 nmdc:mga08x19_115910_c1 nmdc:mga08x19_115910_c1_484_1248 254
99 3300006175 Ga0070712_100041731 Ga0070712_1000417313 255
100 3300014325 Ga0163163_10402264 Ga0163163_104022642 255
101 3300021384 Ga0213876_10034134 Ga0213876_100341343 255
102 3300021388 Ga0213875_10151085 Ga0213875_101510852 255
103 3300025915 Ga0207693_10028490 Ga0207693_100284904 255
104 3300026116 Ga0207674_10065127 Ga0207674_100651273 255
105 3300035170 Ga0373943_0028923 Ga0373943_0028923_695_1465 255
106 3300036401 Ga0373937_0773515 Ga0373937_0773515_70_843 255
107 3300037853 Ga0436364_0448380 Ga0436364_0448380_1282_2055 255
108 3300037853 Ga0436364_1070606 Ga0436364_1070606_64_834 255
109 3300038443 Ga0395901_0069423 Ga0395901_0069423_2346_3113 255
110 3300039437 Ga0436365_1295484 Ga0436365_1295484_192_965 255
111 3300039438 Ga0436360_0964426 Ga0436360_0964426_331_1104 255
112 3300039447 Ga0436361_0670097 Ga0436361_0670097_206_976 255
113 3300046472 Ga0495580_0261645 Ga0495580_0261645_216_986 255
114 3300046517 Ga0495630_0088712 Ga0495630_0088712_114_884 255
115 3300046559 Ga0495667_0326430 Ga0495667_0326430_138_911 255
116 3300046809 Ga0495600_0287915 Ga0495600_0287915_231_1004 255
117 3300047444 Ga0495675_0284099 Ga0495675_0284099_39_812 255
118 3300047471 Ga0495684_0277771 Ga0495684_0277771_59_832 255
119 3300048904 Ga0496101_0061948 Ga0496101_0061948_1116_1886 255
120 3300048905 Ga0496102_0027593 Ga0496102_0027593_2690_3460 255
121 3300048907 Ga0496104_0533919 Ga0496104_0533919_132_902 255
122 3300048908 Ga0496105_0155266 Ga0496105_0155266_1068_1838 255
123 3300048912 Ga0496109_0214020 Ga0496109_0214020_809_1579 255
124 3300048915 Ga0496112_0540589 Ga0496112_0540589_318_1088 255
125 3300050493 nmdc:mga0k408_63245_c1 nmdc:mga0k408_63245_c1_56_868 255
126 3300053077 Ga0495601_0224374 Ga0495601_0224374_59_829 255
127 3300053084 Ga0495595_0056279 Ga0495595_0056279_841_1614 255
128 3300005327 Ga0070658_10307384 Ga0070658_103073842 256
129 3300005334 Ga0068869_100017322 Ga0068869_1000173224 256
130 3300005338 Ga0068868_100110044 Ga0068868_1001100442 256
131 3300005341 Ga0070691_10096430 Ga0070691_100964302 256
132 3300005356 Ga0070674_100244026 Ga0070674_1002440262 256
133 3300005364 Ga0070673_100074784 Ga0070673_1000747842 256
134 3300005459 Ga0068867_100104542 Ga0068867_1001045422 256
135 3300005548 Ga0070665_100028109 Ga0070665_1000281093 256
136 3300005549 Ga0070704_100060877 Ga0070704_1000608772 256
137 3300005563 Ga0068855_100736919 Ga0068855_1007369192 256
138 3300005614 Ga0068856_100121853 Ga0068856_1001218533 256
139 3300005617 Ga0068859_100081859 Ga0068859_1000818593 256
140 3300005618 Ga0068864_100019005 Ga0068864_1000190052 256
141 3300005719 Ga0068861_100203621 Ga0068861_1002036212 256
142 3300005840 Ga0068870_10280646 Ga0068870_102806461 256
143 3300005841 Ga0068863_100036422 Ga0068863_1000364223 256
144 3300005842 Ga0068858_100026741 Ga0068858_1000267412 256
145 3300005843 Ga0068860_100029749 Ga0068860_1000297495 256
146 3300005844 Ga0068862_100203566 Ga0068862_1002035661 256
147 3300006237 Ga0097621_100048033 Ga0097621_1000480333 256
148 3300006881 Ga0068865_100334617 Ga0068865_1003346171 256
149 3300006931 Ga0097620_100081857 Ga0097620_1000818573 256
150 3300009098 Ga0105245_10420648 Ga0105245_104206482 256
151 3300009101 Ga0105247_10070929 Ga0105247_100709293 256
152 3300009176 Ga0105242_10117572 Ga0105242_101175722 256
153 3300013296 Ga0157374_10050050 Ga0157374_100500502 256
154 3300013297 Ga0157378_10201519 Ga0157378_102015192 256
155 3300013308 Ga0157375_10135257 Ga0157375_101352572 256
156 3300014968 Ga0157379_10084096 Ga0157379_100840963 256
157 3300014969 Ga0157376_10016416 Ga0157376_100164164 256
158 3300014969 Ga0157376_10028875 Ga0157376_100288752 256
159 3300025927 Ga0207687_10372130 Ga0207687_103721301 256
160 3300025937 Ga0207669_10117932 Ga0207669_101179321 256
161 3300025938 Ga0207704_10196429 Ga0207704_101964292 256
162 3300025942 Ga0207689_10007510 Ga0207689_100075102 256
163 3300025949 Ga0207667_10206428 Ga0207667_102064282 256
164 3300025960 Ga0207651_10028252 Ga0207651_100282522 256
165 3300026023 Ga0207677_10100644 Ga0207677_101006442 256
166 3300026035 Ga0207703_10031793 Ga0207703_100317932 256
167 3300026078 Ga0207702_10070769 Ga0207702_100707693 256
168 3300026088 Ga0207641_10120412 Ga0207641_101204121 256
169 3300026089 Ga0207648_10075312 Ga0207648_100753122 256
170 3300026089 Ga0207648_10329754 Ga0207648_103297542 256
171 3300026118 Ga0207675_100041652 Ga0207675_1000416522 256
172 3300028381 Ga0268264_10053528 Ga0268264_100535281 256
173 3300031548 Ga0307408_100480043 Ga0307408_1004800432 256
174 3300037418 Ga0395900_0024795 Ga0395900_0024795_70_840 256
175 3300037418 Ga0395900_0392675 Ga0395900_0392675_293_1063 256
176 3300037466 Ga0395898_0017213 Ga0395898_0017213_3665_4435 256
177 3300037471 Ga0395905_0001562 Ga0395905_0001562_19136_19906 256
178 3300037471 Ga0395905_0087967 Ga0395905_0087967_302_1072 256
179 3300037471 Ga0395905_0230355 Ga0395905_0230355_195_965 256
180 3300038443 Ga0395901_0024791 Ga0395901_0024791_1811_2581 256
181 3300038443 Ga0395901_0269744 Ga0395901_0269744_657_1427 256
182 3300046528 Ga0495642_0023443 Ga0495642_0023443_1384_2166 256
183 3300046665 Ga0495661_0265790 Ga0495661_0265790_34_816 256
184 3300046674 Ga0495588_0031332 Ga0495588_0031332_641_1423 256
185 3300049571 Ga0501034_0118040 Ga0501034_0118040_1748_2518 256
186 3300049580 Ga0501046_0079051 Ga0501046_0079051_555_1325 256
187 3300049589 Ga0501073_0078745 Ga0501073_0078745_687_1457 256
188 3300049742 Ga0501080_0027798 Ga0501080_0027798_4316_5086 256
189 3300049822 Ga0501035_0025466 Ga0501035_0025466_703_1473 256
190 3300049823 Ga0501044_0104177 Ga0501044_0104177_782_1552 256
191 3300005327 Ga0070658_10034455 Ga0070658_100344554 257
192 3300005327 Ga0070658_10282909 Ga0070658_102829091 257
193 3300005327 Ga0070658_10407966 Ga0070658_104079662 257
194 3300005339 Ga0070660_100036521 Ga0070660_1000365213 257
195 3300005367 Ga0070667_100007601 Ga0070667_1000076012 257
196 3300005435 Ga0070714_100283884 Ga0070714_1002838842 257
197 3300005441 Ga0070700_100224607 Ga0070700_1002246071 257
198 3300005458 Ga0070681_10016104 Ga0070681_100161043 257
199 3300005530 Ga0070679_100008970 Ga0070679_1000089705 257
200 3300005530 Ga0070679_100146363 Ga0070679_1001463632 257
201 3300005563 Ga0068855_100004439 Ga0068855_10000443917 257
202 3300005563 Ga0068855_100145252 Ga0068855_1001452522 257
203 3300005577 Ga0068857_100037153 Ga0068857_1000371533 257
204 3300005615 Ga0070702_100084168 Ga0070702_1000841683 257
205 3300005718 Ga0068866_10025670 Ga0068866_100256703 257
206 3300005842 Ga0068858_100061196 Ga0068858_1000611963 257
207 3300005843 Ga0068860_100159542 Ga0068860_1001595422 257
208 3300006195 Ga0075366_10000633 Ga0075366_100006338 257
209 3300006195 Ga0075366_10030651 Ga0075366_100306512 257
210 3300006195 Ga0075366_10064742 Ga0075366_100647422 257
211 3300007076 Ga0075435_100001341 Ga0075435_1000013413 257
212 3300009093 Ga0105240_10031668 Ga0105240_100316685 257
213 3300009098 Ga0105245_10047244 Ga0105245_100472444 257
214 3300009148 Ga0105243_10030887 Ga0105243_100308873 257
215 3300009148 Ga0105243_10130133 Ga0105243_101301332 257
216 3300009174 Ga0105241_10613204 Ga0105241_106132041 257
217 3300009551 Ga0105238_10030346 Ga0105238_100303466 257
218 3300013296 Ga0157374_10303774 Ga0157374_103037742 257
219 3300013308 Ga0157375_10461385 Ga0157375_104613851 257
220 3300014968 Ga0157379_10203363 Ga0157379_102033632 257
221 3300014968 Ga0157379_10328619 Ga0157379_103286192 257
222 3300025901 Ga0207688_10074308 Ga0207688_100743082 257
223 3300025907 Ga0207645_10097740 Ga0207645_100977402 257
224 3300025909 Ga0207705_10027375 Ga0207705_100273755 257
225 3300025909 Ga0207705_10230280 Ga0207705_102302802 257
226 3300025909 Ga0207705_10235817 Ga0207705_102358171 257
227 3300025913 Ga0207695_10060434 Ga0207695_100604344 257
228 3300025914 Ga0207671_10019856 Ga0207671_100198562 257
229 3300025919 Ga0207657_10045873 Ga0207657_100458734 257
230 3300025921 Ga0207652_10096073 Ga0207652_100960733 257
231 3300025927 Ga0207687_10130250 Ga0207687_101302502 257
232 3300025929 Ga0207664_10386367 Ga0207664_103863671 257
233 3300025935 Ga0207709_10234822 Ga0207709_102348221 257
234 3300025937 Ga0207669_10275419 Ga0207669_102754192 257
235 3300025942 Ga0207689_10073455 Ga0207689_100734552 257
236 3300025949 Ga0207667_10208201 Ga0207667_102082011 257
237 3300025949 Ga0207667_10366929 Ga0207667_103669292 257
238 3300026035 Ga0207703_10194450 Ga0207703_101944502 257
239 3300026041 Ga0207639_10156859 Ga0207639_101568592 257
240 3300026075 Ga0207708_10031092 Ga0207708_100310923 257
241 3300026089 Ga0207648_10017778 Ga0207648_100177785 257
242 3300026116 Ga0207674_10006174 Ga0207674_100061748 257
243 3300028380 Ga0268265_10166724 Ga0268265_101667241 257
244 3300028381 Ga0268264_10357694 Ga0268264_103576941 257
245 3300031711 Ga0265314_10020787 Ga0265314_100207873 257
246 3300031711 Ga0265314_10039722 Ga0265314_100397222 257
247 3300031712 Ga0265342_10032558 Ga0265342_100325584 257
248 3300031712 Ga0265342_10068057 Ga0265342_100680573 257
249 3300031730 Ga0307516_10014503 Ga0307516_100145036 257
250 3300035120 Ga0373957_0056246 Ga0373957_0056246_617_1396 257
251 3300035410 Ga0373924_0003359 Ga0373924_0003359_1894_2673 257
252 3300035724 Ga0373933_0002353 Ga0373933_0002353_4504_5283 257
253 3300036401 Ga0373937_0003134 Ga0373937_0003134_3031_3810 257
254 3300037466 Ga0395898_0050626 Ga0395898_0050626_227_1012 257
255 3300037471 Ga0395905_0000180 Ga0395905_0000180_97130_97903 257
256 3300037471 Ga0395905_0153818 Ga0395905_0153818_401_1174 257
257 3300037471 Ga0395905_0210323 Ga0395905_0210323_910_1695 257
258 3300038443 Ga0395901_0151258 Ga0395901_0151258_1236_2021 257
259 3300038443 Ga0395901_0327505 Ga0395901_0327505_527_1309 257
260 3300038443 Ga0395901_0416674 Ga0395901_0416674_223_1002 257
261 3300039447 Ga0436361_0213696 Ga0436361_0213696_386_1243 257
262 3300042435 Ga0439434_0004891 Ga0439434_0004891_2205_2990 257
263 3300042436 Ga0439435_0000049 Ga0439435_0000049_764_1549 257
264 3300042876 Ga0451577_0679033 Ga0451577_0679033_24_806 257
265 3300044656 Ga0466969_0015338 Ga0466969_0015338_3011_3784 257
266 3300044684 Ga0466966_0003903 Ga0466966_0003903_4920_5693 257
267 3300044706 Ga0466964_0202035 Ga0466964_0202035_41_814 257
268 3300044765 Ga0466970_0185710 Ga0466970_0185710_263_1036 257
269 3300045049 Ga0466959_0008562 Ga0466959_0008562_5295_6068 257
270 3300046463 Ga0495653_0169056 Ga0495653_0169056_443_1222 257
271 3300046463 Ga0495653_0337828 Ga0495653_0337828_22_795 257
272 3300046539 Ga0495621_0015071 Ga0495621_0015071_589_1512 257
273 3300046615 Ga0495656_0000163 Ga0495656_0000163_6522_7445 257
274 3300046660 Ga0495625_0056474 Ga0495625_0056474_46_987 257
275 3300046663 Ga0495635_0193792 Ga0495635_0193792_529_1308 257
276 3300046691 Ga0495670_0154673 Ga0495670_0154673_33_956 257
277 3300048090 Ga0495615_0002109 Ga0495615_0002109_142_1065 257
278 3300050489 nmdc:mga03683_14888_c1 nmdc:mga03683_14888_c1_81_989 257
279 3300050489 nmdc:mga03683_88628_c1 nmdc:mga03683_88628_c1_416_1219 257
280 3300050493 nmdc:mga0k408_11155_c1 nmdc:mga0k408_11155_c1_4029_4844 257
281 3300050493 nmdc:mga0k408_178433_c1 nmdc:mga0k408_178433_c1_173_1081 257
282 3300050493 nmdc:mga0k408_2967_c1 nmdc:mga0k408_2967_c1_3947_4750 257
283 3300050496 nmdc:mga07m45_132261_c1 nmdc:mga07m45_132261_c1_269_1177 257
284 3300050513 nmdc:mga0rr50_26750_c1 nmdc:mga0rr50_26750_c1_1472_2248 257
285 3300005334 Ga0068869_100282207 Ga0068869_1002822072 258
286 3300005435 Ga0070714_100083363 Ga0070714_1000833631 258
287 3300005444 Ga0070694_100005593 Ga0070694_1000055933 258
288 3300005545 Ga0070695_100070207 Ga0070695_1000702072 258
289 3300005546 Ga0070696_100028084 Ga0070696_1000280844 258
290 3300005549 Ga0070704_100106303 Ga0070704_1001063032 258
291 3300006173 Ga0070716_100136160 Ga0070716_1001361602 258
292 3300006353 Ga0075370_10002412 Ga0075370_100024122 258
293 3300006844 Ga0075428_100061243 Ga0075428_1000612432 258
294 3300006847 Ga0075431_100309852 Ga0075431_1003098522 258
295 3300010375 Ga0105239_11158724 Ga0105239_111587241 258
296 3300025929 Ga0207664_10533396 Ga0207664_105333962 258
297 3300025961 Ga0207712_10557531 Ga0207712_105575311 258
298 3300027665 Ga0209983_1013262 Ga0209983_10132622 258
299 3300028794 Ga0307515_10072864 Ga0307515_100728643 258
300 3300031456 Ga0307513_10001376 Ga0307513_1000137637 258
301 3300031456 Ga0307513_10026911 Ga0307513_100269113 258
302 3300042876 Ga0451577_0003923 Ga0451577_0003923_5322_6107 258
303 3300044712 Ga0453684_0114391 Ga0453684_0114391_306_1091 258
304 3300044901 Ga0466960_0036523 Ga0466960_0036523_714_1505 258
305 3300048905 Ga0496102_0101591 Ga0496102_0101591_1657_2463 258
306 3300049588 Ga0501072_0122300 Ga0501072_0122300_184_960 258
307 3300049588 Ga0501072_0287700 Ga0501072_0287700_221_1087 258
308 3300049743 Ga0501081_0147609 Ga0501081_0147609_314_1096 258
309 3300050490 nmdc:mga03n38_193261_c1 nmdc:mga03n38_193261_c1_29_814 258
310 3300050496 nmdc:mga07m45_5562_c1 nmdc:mga07m45_5562_c1_217_1002 258
311 3300050509 nmdc:mga0qj67_705_c1 nmdc:mga0qj67_705_c1_21524_22306 258
312 3300050510 nmdc:mga06r32_210852_c1 nmdc:mga06r32_210852_c1_367_1149 258
313 3300005329 Ga0070683_100340063 Ga0070683_1003400631 259
314 3300005457 Ga0070662_100076893 Ga0070662_1000768932 259
315 3300005471 Ga0070698_100014017 Ga0070698_1000140172 259
316 3300005518 Ga0070699_100056960 Ga0070699_1000569603 259
317 3300005536 Ga0070697_100005701 Ga0070697_1000057019 259
318 3300005544 Ga0070686_100538282 Ga0070686_1005382821 259
319 3300005546 Ga0070696_100009913 Ga0070696_1000099135 259
320 3300005549 Ga0070704_100002583 Ga0070704_1000025838 259
321 3300005549 Ga0070704_100109550 Ga0070704_1001095503 259
322 3300005549 Ga0070704_100468507 Ga0070704_1004685072 259
323 3300005719 Ga0068861_100134711 Ga0068861_1001347112 259
324 3300005844 Ga0068862_100213431 Ga0068862_1002134312 259
325 3300006038 Ga0075365_10086770 Ga0075365_100867703 259
326 3300006042 Ga0075368_10013459 Ga0075368_100134593 259
327 3300006048 Ga0075363_100019885 Ga0075363_1000198852 259
328 3300006178 Ga0075367_10080579 Ga0075367_100805792 259
329 3300006844 Ga0075428_100128960 Ga0075428_1001289602 259
330 3300006871 Ga0075434_100000132 Ga0075434_1000001326 259
331 3300006880 Ga0075429_100000638 Ga0075429_10000063818 259
332 3300006880 Ga0075429_100135451 Ga0075429_1001354512 259
333 3300007076 Ga0075435_100006450 Ga0075435_1000064507 259
334 3300007076 Ga0075435_100383464 Ga0075435_1003834641 259
335 3300007265 Ga0099794_10004485 Ga0099794_100044855 259
336 3300009098 Ga0105245_10082487 Ga0105245_100824873 259
337 3300009147 Ga0114129_10015516 Ga0114129_100155163 259
338 3300009147 Ga0114129_10707650 Ga0114129_107076501 259
339 3300009553 Ga0105249_10074689 Ga0105249_100746891 259
340 3300013307 Ga0157372_10079010 Ga0157372_100790102 259
341 3300014325 Ga0163163_10638938 Ga0163163_106389381 259
342 3300014326 Ga0157380_10135584 Ga0157380_101355842 259
343 3300025933 Ga0207706_10079522 Ga0207706_100795222 259
344 3300025942 Ga0207689_10136195 Ga0207689_101361952 259
345 3300025944 Ga0207661_10458954 Ga0207661_104589542 259
346 3300025961 Ga0207712_10041781 Ga0207712_100417814 259
347 3300026118 Ga0207675_100135758 Ga0207675_1001357581 259
348 3300027471 Ga0209995_1023511 Ga0209995_10235112 259
349 3300027543 Ga0209999_1000946 Ga0209999_10009462 259
350 3300028379 Ga0268266_10132081 Ga0268266_101320813 259
351 3300031242 Ga0265329_10043310 Ga0265329_100433102 259
352 3300042876 Ga0451577_0139425 Ga0451577_0139425_745_1557 259
353 3300044712 Ga0453684_0140881 Ga0453684_0140881_1169_1981 259
354 3300046684 Ga0495669_0082404 Ga0495669_0082404_509_1357 259
355 3300047317 Ga0495604_0132267 Ga0495604_0132267_764_1612 259
356 3300048908 Ga0496105_0293714 Ga0496105_0293714_410_1258 259
357 3300048913 Ga0496110_0124275 Ga0496110_0124275_354_1202 259
358 3300048914 Ga0496111_0148736 Ga0496111_0148736_144_992 259
359 3300049585 Ga0501069_0119348 Ga0501069_0119348_246_1028 259
360 3300050492 nmdc:mga0yw44_70861_c1 nmdc:mga0yw44_70861_c1_1101_1949 259
361 3300050494 nmdc:mga06z11_85826_c1 nmdc:mga06z11_85826_c1_213_1061 259
362 3300050496 nmdc:mga07m45_298073_c1 nmdc:mga07m45_298073_c1_69_917 259
363 3300050507 nmdc:mga05p37_21838_c1 nmdc:mga05p37_21838_c1_4610_5392 259
364 3300050508 nmdc:mga09592_136871_c1 nmdc:mga09592_136871_c1_503_1285 259
365 3300050512 nmdc:mga0n895_393151_c1 nmdc:mga0n895_393151_c1_584_1363 259
366 3300050512 nmdc:mga0n895_698018_c1 nmdc:mga0n895_698018_c1_154_936 259
367 3300050513 nmdc:mga0rr50_475609_c1 nmdc:mga0rr50_475609_c1_237_1019 259
368 3300050513 nmdc:mga0rr50_65593_c1 nmdc:mga0rr50_65593_c1_136_915 259
369 3300050514 nmdc:mga08x19_15018_c1 nmdc:mga08x19_15018_c1_3044_3826 259
370 3300053077 Ga0495601_0026917 Ga0495601_0026917_866_1714 259
371 iso_pu_bacteria 2512047030 2512352318 259
372 iso_pu_bacteria 2513020051 2513229603 259
373 3300006038 Ga0075365_10017503 Ga0075365_100175032 260
374 3300031595 Ga0265313_10000007 Ga0265313_1000000715 260
375 3300039447 Ga0436361_1140218 Ga0436361_1140218_1501_2304 260
376 3300049575 Ga0501039_0085997 Ga0501039_0085997_226_1047 260
377 3300049581 Ga0501047_0114524 Ga0501047_0114524_417_1235 260
378 3300049743 Ga0501081_0398076 Ga0501081_0398076_157_978 260
379 3300049744 Ga0501083_0054146 Ga0501083_0054146_1410_2234 260
380 3300050492 nmdc:mga0yw44_56202_c1 nmdc:mga0yw44_56202_c1_711_1520 260
381 3300060353 Ga0501082_0000013 Ga0501082_0000013_100486_101310 260
382 3300006847 Ga0075431_100701064 Ga0075431_1007010641 261
383 3300035172 Ga0373955_0004531 Ga0373955_0004531_2924_3751 261
384 3300036401 Ga0373937_0055911 Ga0373937_0055911_1356_2183 261
385 3300048929 Ga0496126_0061462 Ga0496126_0061462_2129_2965 261
386 3300049570 Ga0501033_0054334 Ga0501033_0054334_1376_2215 261
387 3300049571 Ga0501034_0101591 Ga0501034_0101591_990_1817 261
388 3300049572 Ga0501036_0025927 Ga0501036_0025927_2230_3069 261
389 3300049572 Ga0501036_0097383 Ga0501036_0097383_1544_2383 261
390 3300049574 Ga0501038_0020071 Ga0501038_0020071_2421_3248 261
391 3300049574 Ga0501038_0083616 Ga0501038_0083616_234_1061 261
392 3300049574 Ga0501038_0103088 Ga0501038_0103088_590_1429 261
393 3300049575 Ga0501039_0033134 Ga0501039_0033134_1889_2716 261
394 3300049579 Ga0501043_0001183 Ga0501043_0001183_14772_15611 261
395 3300049579 Ga0501043_0005068 Ga0501043_0005068_6664_7491 261
396 3300049579 Ga0501043_0005128 Ga0501043_0005128_3974_4813 261
397 3300049579 Ga0501043_0049809 Ga0501043_0049809_1816_2643 261
398 3300049579 Ga0501043_0082393 Ga0501043_0082393_456_1283 261
399 3300049580 Ga0501046_0072755 Ga0501046_0072755_1611_2438 261
400 3300049580 Ga0501046_0154325 Ga0501046_0154325_195_1034 261
401 3300049581 Ga0501047_0000363 Ga0501047_0000363_25585_26424 261
402 3300049581 Ga0501047_0065184 Ga0501047_0065184_2645_3472 261
403 3300049581 Ga0501047_0093289 Ga0501047_0093289_1393_2220 261
404 3300049581 Ga0501047_0207716 Ga0501047_0207716_920_1759 261
405 3300049583 Ga0501067_0095181 Ga0501067_0095181_736_1563 261
406 3300049584 Ga0501068_0027028 Ga0501068_0027028_877_1716 261
407 3300049585 Ga0501069_0082267 Ga0501069_0082267_317_1156 261
408 3300049586 Ga0501070_0015722 Ga0501070_0015722_935_1774 261
409 3300049586 Ga0501070_0050177 Ga0501070_0050177_1119_1946 261
410 3300049586 Ga0501070_0088225 Ga0501070_0088225_1320_2159 261
411 3300049586 Ga0501070_0173877 Ga0501070_0173877_308_1135 261
412 3300049588 Ga0501072_0090486 Ga0501072_0090486_209_1036 261
413 3300049588 Ga0501072_0198083 Ga0501072_0198083_738_1577 261
414 3300049589 Ga0501073_0026703 Ga0501073_0026703_2424_3263 261
415 3300049590 Ga0501074_0006091 Ga0501074_0006091_4298_5137 261
416 3300049590 Ga0501074_0008422 Ga0501074_0008422_988_1827 261
417 3300049592 Ga0501076_0187614 Ga0501076_0187614_539_1366 261
418 3300049741 Ga0501079_0019020 Ga0501079_0019020_738_1577 261
419 3300049742 Ga0501080_0000279 Ga0501080_0000279_27424_28263 261
420 3300049742 Ga0501080_0448674 Ga0501080_0448674_283_1110 261
421 3300049743 Ga0501081_0308044 Ga0501081_0308044_243_1070 261
422 3300049744 Ga0501083_0000567 Ga0501083_0000567_11067_11906 261
423 3300049744 Ga0501083_0050253 Ga0501083_0050253_1079_1906 261
424 3300049744 Ga0501083_0103885 Ga0501083_0103885_360_1187 261
425 3300049822 Ga0501035_0017995 Ga0501035_0017995_5442_6281 261
426 3300049822 Ga0501035_0080034 Ga0501035_0080034_869_1696 261
427 3300049823 Ga0501044_0001849 Ga0501044_0001849_15320_16159 261
428 3300049823 Ga0501044_0108878 Ga0501044_0108878_395_1222 261
429 3300049823 Ga0501044_0183746 Ga0501044_0183746_47_874 261
430 3300049824 Ga0501045_0314498 Ga0501045_0314498_221_1060 261
431 3300050491 nmdc:mga00v17_349361_c1 nmdc:mga00v17_349361_c1_68_895 261
432 3300053084 Ga0495595_0026874 Ga0495595_0026874_730_1557 261
433 3300053085 Ga0495619_0022146 Ga0495619_0022146_2984_3811 261
434 3300053125 Ga0500618_012879 Ga0500618_012879_910_1707 261
435 3300054114 Ga0501084_0125361 Ga0501084_0125361_633_1472 261
436 3300054114 Ga0501084_0468826 Ga0501084_0468826_49_876 261
437 iso_pu_bacteria 2643221683 2644466703 261
438 3300031247 Ga0265340_10056503 Ga0265340_100565032 262
439 3300042115 Ga0450911_000599 Ga0450911_000599_9264_10070 262
440 3300048924 Ga0496121_0002968 Ga0496121_0002968_20483_21289 262
441 3300048928 Ga0496125_0026075 Ga0496125_0026075_458_1264 262
442 3300048928 Ga0496125_0047579 Ga0496125_0047579_446_1252 262
443 3300048929 Ga0496126_0277110 Ga0496126_0277110_201_1007 262
444 3300050489 nmdc:mga03683_59256_c1 nmdc:mga03683_59256_c1_84_938 262
445 3300005330 Ga0070690_100022845 Ga0070690_1000228452 263
446 3300005334 Ga0068869_100009111 Ga0068869_1000091114 263
447 3300005337 Ga0070682_100153645 Ga0070682_1001536452 263
448 3300005338 Ga0068868_100225946 Ga0068868_1002259462 263
449 3300005340 Ga0070689_100004177 Ga0070689_1000041777 263
450 3300005341 Ga0070691_10028383 Ga0070691_100283832 263
451 3300005356 Ga0070674_100100286 Ga0070674_1001002862 263
452 3300005438 Ga0070701_10000991 Ga0070701_1000099110 263
453 3300005441 Ga0070700_100015782 Ga0070700_1000157822 263
454 3300005459 Ga0068867_100008427 Ga0068867_1000084272 263
455 3300005544 Ga0070686_100000247 Ga0070686_10000024726 263
456 3300005546 Ga0070696_100037206 Ga0070696_1000372062 263
457 3300005547 Ga0070693_100004863 Ga0070693_1000048634 263
458 3300005549 Ga0070704_100042182 Ga0070704_1000421823 263
459 3300005549 Ga0070704_100145376 Ga0070704_1001453762 263
460 3300005615 Ga0070702_100006616 Ga0070702_1000066163 263
461 3300005617 Ga0068859_100069457 Ga0068859_1000694572 263
462 3300005718 Ga0068866_10001059 Ga0068866_100010599 263
463 3300005719 Ga0068861_100069416 Ga0068861_1000694163 263
464 3300005840 Ga0068870_10013493 Ga0068870_100134934 263
465 3300005843 Ga0068860_100046184 Ga0068860_1000461842 263
466 3300005844 Ga0068862_100008109 Ga0068862_1000081097 263
467 3300006237 Ga0097621_100014666 Ga0097621_1000146664 263
468 3300006358 Ga0068871_100008295 Ga0068871_1000082954 263
469 3300006881 Ga0068865_100001393 Ga0068865_10000139311 263
470 3300006931 Ga0097620_100069458 Ga0097620_1000694582 263
471 3300009098 Ga0105245_10019196 Ga0105245_100191964 263
472 3300009148 Ga0105243_10001129 Ga0105243_100011299 263
473 3300009148 Ga0105243_10055682 Ga0105243_100556822 263
474 3300009174 Ga0105241_10148319 Ga0105241_101483192 263
475 3300009176 Ga0105242_10003998 Ga0105242_100039983 263
476 3300009177 Ga0105248_10050176 Ga0105248_100501763 263
477 3300009553 Ga0105249_10019624 Ga0105249_100196244 263
478 3300011119 Ga0105246_10647558 Ga0105246_106475581 263
479 3300013297 Ga0157378_10001828 Ga0157378_1000182810 263
480 3300013308 Ga0157375_10396034 Ga0157375_103960342 263
481 3300014968 Ga0157379_10014502 Ga0157379_100145024 263
482 3300014969 Ga0157376_10127060 Ga0157376_101270602 263
483 3300017792 Ga0163161_10104436 Ga0163161_101044362 263
484 3300025899 Ga0207642_10001218 Ga0207642_100012183 263
485 3300025908 Ga0207643_10021144 Ga0207643_100211443 263
486 3300025925 Ga0207650_10204212 Ga0207650_102042122 263
487 3300025927 Ga0207687_10013443 Ga0207687_100134433 263
488 3300025935 Ga0207709_10090791 Ga0207709_100907911 263
489 3300025935 Ga0207709_10095580 Ga0207709_100955802 263
490 3300025936 Ga0207670_10122254 Ga0207670_101222541 263
491 3300025942 Ga0207689_10000673 Ga0207689_100006739 263
492 3300026035 Ga0207703_10004160 Ga0207703_100041609 263
493 3300026075 Ga0207708_10000998 Ga0207708_1000099810 263
494 3300026075 Ga0207708_10003798 Ga0207708_100037989 263
495 3300026089 Ga0207648_10001170 Ga0207648_1000117017 263
496 3300026118 Ga0207675_100000583 Ga0207675_10000058319 263
497 3300028380 Ga0268265_10005090 Ga0268265_100050905 263
498 3300028381 Ga0268264_10188658 Ga0268264_101886582 263
499 3300031548 Ga0307408_100667485 Ga0307408_1006674851 263
500 3300046471 Ga0495650_0039724 Ga0495650_0039724_874_1677 263
501 3300046539 Ga0495621_0010736 Ga0495621_0010736_1866_2672 263
502 3300048912 Ga0496109_0080718 Ga0496109_0080718_191_997 263
503 3300048928 Ga0496125_0004911 Ga0496125_0004911_10953_11756 263
504 iso_pu_bacteria 2643221628 2644159760 263
505 3300005459 Ga0068867_100034633 Ga0068867_1000346331 264
506 3300006038 Ga0075365_10130700 Ga0075365_101307002 264
507 3300006177 Ga0075362_10046452 Ga0075362_100464522 264
508 3300006177 Ga0075362_10102155 Ga0075362_101021552 264
509 3300006178 Ga0075367_10009549 Ga0075367_100095492 264
510 3300006195 Ga0075366_10032938 Ga0075366_100329383 264
511 3300025907 Ga0207645_10045172 Ga0207645_100451722 264
512 3300025942 Ga0207689_10177754 Ga0207689_101777542 264
513 3300026089 Ga0207648_10018068 Ga0207648_100180685 264
514 3300028794 Ga0307515_10000014 Ga0307515_10000014311 264
515 3300031241 Ga0265325_10063097 Ga0265325_100630972 264
516 3300041404 Ga0439436_0007642 Ga0439436_0007642_975_1775 264
517 3300041406 Ga0439439_0037914 Ga0439439_0037914_59_859 264
518 3300041407 Ga0439447_017604 Ga0439447_017604_1007_1807 264
519 3300041411 Ga0439466_0026535 Ga0439466_0026535_962_1762 264
520 3300041413 Ga0439465_0003028 Ga0439465_0003028_3127_3927 264
521 3300041999 Ga0439433_0001968 Ga0439433_0001968_139_939 264
522 3300042004 Ga0439445_0000586 Ga0439445_0000586_1555_2355 264
523 3300042007 Ga0439449_0008794 Ga0439449_0008794_2504_3304 264
524 3300042010 Ga0439452_002437 Ga0439452_002437_3161_3961 264
525 3300042014 Ga0439457_004343 Ga0439457_004343_329_1129 264
526 3300042015 Ga0439462_0000724 Ga0439462_0000724_3499_4299 264
527 3300042156 Ga0439446_0026452 Ga0439446_0026452_603_1403 264
528 3300050494 nmdc:mga06z11_67391_c1 nmdc:mga06z11_67391_c1_857_1657 264
529 3300050496 nmdc:mga07m45_8395_c1 nmdc:mga07m45_8395_c1_238_1038 264
530 3300003781 Ga0055536_1000313 Ga0055536_10003133 265
531 3300003784 Ga0055534_1003181 Ga0055534_10031814 265
532 3300003792 Ga0055540_1001615 Ga0055540_10016154 265
533 3300009148 Ga0105243_10000293 Ga0105243_1000029310 265
534 3300009545 Ga0105237_10060650 Ga0105237_100606504 265
535 3300025284 Ga0209130_1001720 Ga0209130_100172013 265
536 3300025291 Ga0209675_1002415 Ga0209675_10024155 265
537 3300025292 Ga0209676_1000267 Ga0209676_100026733 265
538 3300025292 Ga0209676_1006250 Ga0209676_10062503 265
539 3300025298 Ga0209050_1009624 Ga0209050_10096244 265
540 3300025298 Ga0209050_1015410 Ga0209050_10154103 265
541 3300025303 Ga0209051_1000230 Ga0209051_100023060 265
542 3300025303 Ga0209051_1005092 Ga0209051_10050924 265
543 3300025304 Ga0209257_1004695 Ga0209257_10046954 265
544 3300025304 Ga0209257_1005713 Ga0209257_10057134 265
545 3300025913 Ga0207695_10067326 Ga0207695_100673263 265
546 3300025914 Ga0207671_10037914 Ga0207671_100379144 265
547 3300025935 Ga0207709_10000076 Ga0207709_1000007671 265
548 3300031731 Ga0307405_10046349 Ga0307405_100463492 265
549 3300032005 Ga0307411_10043524 Ga0307411_100435242 265
550 3300046615 Ga0495656_0003746 Ga0495656_0003746_2601_3497 265
551 3300003322 rootL2_10006671 rootL2_100066713 266
552 3300005288 Ga0065714_10003608 Ga0065714_100036086 266
553 3300005334 Ga0068869_100081702 Ga0068869_1000817023 266
554 3300006038 Ga0075365_10003967 Ga0075365_100039678 266
555 3300006048 Ga0075363_100108332 Ga0075363_1001083322 266
556 3300006051 Ga0075364_10030028 Ga0075364_100300283 266
557 3300006051 Ga0075364_10134509 Ga0075364_101345092 266
558 3300006195 Ga0075366_10045907 Ga0075366_100459072 266
559 3300006195 Ga0075366_10165569 Ga0075366_101655692 266
560 3300032004 Ga0307414_10281076 Ga0307414_102810762 266
561 3300041413 Ga0439465_0045727 Ga0439465_0045727_49_876 266
562 3300042122 Ga0450920_015251 Ga0450920_015251_62_907 266
563 3300042125 Ga0450923_001005 Ga0450923_001005_2487_3314 266
564 3300042138 Ga0450903_015703 Ga0450903_015703_251_1069 266
565 3300042145 Ga0450906_006060 Ga0450906_006060_1500_2327 266
566 3300042184 Ga0450908_009248 Ga0450908_009248_300_1127 266
567 3300042435 Ga0439434_0002341 Ga0439434_0002341_3342_4169 266
568 3300042436 Ga0439435_0058171 Ga0439435_0058171_231_1058 266
569 3300042532 Ga0450893_0005996 Ga0450893_0005996_947_1774 266
570 3300048091 Ga0495626_0083205 Ga0495626_0083205_368_1219 266
571 3300050489 nmdc:mga03683_56278_c1 nmdc:mga03683_56278_c1_734_1561 266
572 3300050490 nmdc:mga03n38_6527_c1 nmdc:mga03n38_6527_c1_806_1633 266
573 3300050491 nmdc:mga00v17_9302_c1 nmdc:mga00v17_9302_c1_2034_2861 266
574 3300050491 nmdc:mga00v17_97174_c1 nmdc:mga00v17_97174_c1_523_1368 266
575 3300050492 nmdc:mga0yw44_1966_c1 nmdc:mga0yw44_1966_c1_2043_2870 266
576 3300050493 nmdc:mga0k408_84667_c1 nmdc:mga0k408_84667_c1_167_994 266
577 3300050496 nmdc:mga07m45_33632_c1 nmdc:mga07m45_33632_c1_252_1070 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

68

229

0.97

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

278

304

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9375 16 262
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9312 16 250
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9295 16 263
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9273 14 250
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.926 16 262
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9605 15 264 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 15 264 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9393 16 252 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9303 13 252 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9294 16 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3G1KQ69-F1-model_v4 ABC transporter domain-containing protein 0.9754 14 263 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A522SVT7-F1-model_v4 ABC transporter ATP-binding protein 0.9708 14 263 GO:0005524
GO:0005886
GO:0016887
AF-A0A1I6ERF8-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.965 13 265 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A435TXS8-F1-model_v4 ABC transporter ATP-binding protein 0.9644 14 263 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9587 17 263 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.46 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map