F465627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 577 | 301 | 572 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10072864|Ga0307515_100728643 |
| Length | 313 |
| Sequence | MTTATRTDVGISGRFEVSREDCVRVIAAAHAAEATPGPQRDARTMTKAARPLLSVRGVTVRFGGVVALHGVSFDVEAGHVCGLIGPNGAGKTTLFNCLSRLYDYQAGDILFEGESITRTPTHRMAALGIGRTFQNLAMFRTLAVRQNIMIGAHSRSSAGFLSSALRLPSVAAEERRLRERADQIMEYLDLTPFADRPAGDLPFGTQKRVEMGRALAADPKLLLLDEPAAGLNHEELGELARLILDVQNKLGITVLLVEHHMSLVMSVSNHIVALNFGRKIAEGTPEDIQQHPDVIAAYLGVPAAKEAARGQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 4 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 5 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 181 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 182 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 183 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 187 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 188 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 189 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 190 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 191 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 192 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 193 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 194 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 195 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 196 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 197 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 198 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 199 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 200 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 201 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 202 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 203 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 204 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.17 |
| Nodule | 0.17 |
| Rhizoplane | 2.77 |
| Rhizosphere | 80.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10006671 | 3300003322 | Bacteria | 2548 |
| 2 | Ga0055536_1000313 | 3300003781 | Bacteria | 36453 |
| 3 | Ga0055534_1003181 | 3300003784 | Bacteria | 5298 |
| 4 | Ga0055540_1001615 | 3300003792 | Bacteria | 13125 |
| 5 | Ga0065714_10003608 | 3300005288 | Bacteria | 8165 |
| 6 | Ga0070658_10034455 | 3300005327 | Bacteria | 4073 |
| 7 | Ga0070658_10282909 | 3300005327 | Bacteria | 1412 |
| 8 | Ga0070658_10307384 | 3300005327 | Bacteria | 1353 |
| 9 | Ga0070658_10407966 | 3300005327 | Bacteria | 1167 |
| 10 | Ga0070683_100340063 | 3300005329 | Bacteria | 1429 |
| 11 | Ga0070690_100022845 | 3300005330 | Bacteria | 3830 |
| 12 | Ga0068869_100009111 | 3300005334 | Bacteria | 6430 |
| 13 | Ga0068869_100017322 | 3300005334 | Bacteria | 4882 |
| 14 | Ga0068869_100081702 | 3300005334 | Bacteria | 2414 |
| 15 | Ga0068869_100282207 | 3300005334 | Bacteria | 1336 |
| 16 | Ga0070682_100153645 | 3300005337 | Bacteria | 1582 |
| 17 | Ga0068868_100110044 | 3300005338 | Bacteria | 2238 |
| 18 | Ga0068868_100225946 | 3300005338 | Bacteria | 1569 |
| 19 | Ga0070660_100036521 | 3300005339 | Bacteria | 3722 |
| 20 | Ga0070689_100004177 | 3300005340 | Bacteria | 9731 |
| 21 | Ga0070691_10028383 | 3300005341 | Bacteria | 2614 |
| 22 | Ga0070691_10096430 | 3300005341 | Bacteria | 1464 |
| 23 | Ga0070687_100195970 | 3300005343 | Bacteria | 1221 |
| 24 | Ga0070674_100100286 | 3300005356 | Bacteria | 2108 |
| 25 | Ga0070674_100244026 | 3300005356 | Bacteria | 1408 |
| 26 | Ga0070673_100074784 | 3300005364 | Bacteria | 2731 |
| 27 | Ga0070667_100007601 | 3300005367 | Bacteria | 8989 |
| 28 | Ga0070703_10029468 | 3300005406 | Bacteria | 1648 |
| 29 | Ga0070714_100083363 | 3300005435 | Bacteria | 2787 |
| 30 | Ga0070714_100283884 | 3300005435 | Bacteria | 1539 |
| 31 | Ga0070701_10000991 | 3300005438 | Bacteria | 10306 |
| 32 | Ga0070700_100015782 | 3300005441 | Bacteria | 4290 |
| 33 | Ga0070700_100224607 | 3300005441 | Bacteria | 1333 |
| 34 | Ga0070694_100005593 | 3300005444 | Bacteria | 7617 |
| 35 | Ga0070708_100188668 | 3300005445 | Bacteria | 1928 |
| 36 | Ga0070662_100076893 | 3300005457 | Bacteria | 2476 |
| 37 | Ga0070681_10016104 | 3300005458 | Bacteria | 7453 |
| 38 | Ga0068867_100008427 | 3300005459 | Bacteria | 7272 |
| 39 | Ga0068867_100034633 | 3300005459 | Bacteria | 3661 |
| 40 | Ga0068867_100104542 | 3300005459 | Bacteria | 2167 |
| 41 | Ga0070707_100009268 | 3300005468 | Bacteria | 9136 |
| 42 | Ga0070707_100051793 | 3300005468 | Bacteria | 3935 |
| 43 | Ga0070698_100014017 | 3300005471 | Bacteria | 8477 |
| 44 | Ga0070698_100104018 | 3300005471 | Bacteria | 2809 |
| 45 | Ga0070699_100056960 | 3300005518 | Bacteria | 3385 |
| 46 | Ga0070699_100150425 | 3300005518 | Bacteria | 2059 |
| 47 | Ga0070679_100008970 | 3300005530 | Bacteria | 9437 |
| 48 | Ga0070679_100146363 | 3300005530 | Bacteria | 2340 |
| 49 | Ga0070697_100005701 | 3300005536 | Bacteria | 9591 |
| 50 | Ga0070697_100155213 | 3300005536 | Bacteria | 1932 |
| 51 | Ga0070697_100189476 | 3300005536 | Bacteria | 1745 |
| 52 | Ga0070686_100000247 | 3300005544 | Bacteria | 36839 |
| 53 | Ga0070686_100538282 | 3300005544 | Bacteria | 912 |
| 54 | Ga0070695_100070207 | 3300005545 | Bacteria | 2291 |
| 55 | Ga0070696_100009913 | 3300005546 | Bacteria | 6373 |
| 56 | Ga0070696_100028084 | 3300005546 | Bacteria | 3837 |
| 57 | Ga0070696_100037206 | 3300005546 | Bacteria | 3357 |
| 58 | Ga0070693_100004863 | 3300005547 | Bacteria | 6412 |
| 59 | Ga0070665_100028109 | 3300005548 | Bacteria | 5664 |
| 60 | Ga0070704_100002583 | 3300005549 | Bacteria | 10212 |
| 61 | Ga0070704_100042182 | 3300005549 | Bacteria | 3155 |
| 62 | Ga0070704_100060877 | 3300005549 | Bacteria | 2699 |
| 63 | Ga0070704_100106303 | 3300005549 | Bacteria | 2126 |
| 64 | Ga0070704_100109550 | 3300005549 | Bacteria | 2098 |
| 65 | Ga0070704_100145376 | 3300005549 | Bacteria | 1857 |
| 66 | Ga0070704_100468507 | 3300005549 | Bacteria | 1088 |
| 67 | Ga0070704_100564399 | 3300005549 | Bacteria | 996 |
| 68 | Ga0068855_100004439 | 3300005563 | Bacteria | 17139 |
| 69 | Ga0068855_100145252 | 3300005563 | Bacteria | 2701 |
| 70 | Ga0068855_100736919 | 3300005563 | Bacteria | 1052 |
| 71 | Ga0068857_100037153 | 3300005577 | Bacteria | 4315 |
| 72 | Ga0068856_100121853 | 3300005614 | Bacteria | 2610 |
| 73 | Ga0070702_100006616 | 3300005615 | Bacteria | 5501 |
| 74 | Ga0070702_100084168 | 3300005615 | Bacteria | 1912 |
| 75 | Ga0068859_100069457 | 3300005617 | Bacteria | 3558 |
| 76 | Ga0068859_100081859 | 3300005617 | Bacteria | 3270 |
| 77 | Ga0068864_100019005 | 3300005618 | Bacteria | 5745 |
| 78 | Ga0068866_10001059 | 3300005718 | Bacteria | 12119 |
| 79 | Ga0068866_10025670 | 3300005718 | Bacteria | 2773 |
| 80 | Ga0068861_100069416 | 3300005719 | Bacteria | 2726 |
| 81 | Ga0068861_100134711 | 3300005719 | Bacteria | 2009 |
| 82 | Ga0068861_100203621 | 3300005719 | Bacteria | 1663 |
| 83 | Ga0068870_10013493 | 3300005840 | Bacteria | 3841 |
| 84 | Ga0068870_10280646 | 3300005840 | Bacteria | 1044 |
| 85 | Ga0068863_100036422 | 3300005841 | Bacteria | 4686 |
| 86 | Ga0068858_100026741 | 3300005842 | Bacteria | 5359 |
| 87 | Ga0068858_100061196 | 3300005842 | Bacteria | 3480 |
| 88 | Ga0068860_100029749 | 3300005843 | Bacteria | 5255 |
| 89 | Ga0068860_100046184 | 3300005843 | Bacteria | 4153 |
| 90 | Ga0068860_100159542 | 3300005843 | Bacteria | 2174 |
| 91 | Ga0068862_100008109 | 3300005844 | Bacteria | 8690 |
| 92 | Ga0068862_100203566 | 3300005844 | Bacteria | 1786 |
| 93 | Ga0068862_100213431 | 3300005844 | Bacteria | 1744 |
| 94 | Ga0070717_10002978 | 3300006028 | Bacteria | 12053 |
| 95 | Ga0075365_10003967 | 3300006038 | Bacteria | 7748 |
| 96 | Ga0075365_10017503 | 3300006038 | Bacteria | 4385 |
| 97 | Ga0075365_10086770 | 3300006038 | Bacteria | 2127 |
| 98 | Ga0075365_10130700 | 3300006038 | Bacteria | 1737 |
| 99 | Ga0075368_10013459 | 3300006042 | Bacteria | 3005 |
| 100 | Ga0075363_100019885 | 3300006048 | Bacteria | 3362 |
| 101 | Ga0075363_100061483 | 3300006048 | Bacteria | 2024 |
| 102 | Ga0075363_100108332 | 3300006048 | Bacteria | 1542 |
| 103 | Ga0075364_10030028 | 3300006051 | Bacteria | 3487 |
| 104 | Ga0075364_10134509 | 3300006051 | Bacteria | 1661 |
| 105 | Ga0070716_100136160 | 3300006173 | Bacteria | 1560 |
| 106 | Ga0070712_100041731 | 3300006175 | Bacteria | 3152 |
| 107 | Ga0075362_10004353 | 3300006177 | Bacteria | 5074 |
| 108 | Ga0075362_10046452 | 3300006177 | Bacteria | 1931 |
| 109 | Ga0075362_10063066 | 3300006177 | Bacteria | 1680 |
| 110 | Ga0075362_10102155 | 3300006177 | Bacteria | 1342 |
| 111 | Ga0075367_10002066 | 3300006178 | Bacteria | 8992 |
| 112 | Ga0075367_10009549 | 3300006178 | Bacteria | 5075 |
| 113 | Ga0075367_10080579 | 3300006178 | Bacteria | 1969 |
| 114 | Ga0075369_10001746 | 3300006186 | Bacteria | 7534 |
| 115 | Ga0075366_10000633 | 3300006195 | Bacteria | 16535 |
| 116 | Ga0075366_10010021 | 3300006195 | Bacteria | 5310 |
| 117 | Ga0075366_10030651 | 3300006195 | Bacteria | 3163 |
| 118 | Ga0075366_10032938 | 3300006195 | Bacteria | 3052 |
| 119 | Ga0075366_10041774 | 3300006195 | Bacteria | 2715 |
| 120 | Ga0075366_10045907 | 3300006195 | Bacteria | 2588 |
| 121 | Ga0075366_10064742 | 3300006195 | Bacteria | 2174 |
| 122 | Ga0075366_10165569 | 3300006195 | Bacteria | 1340 |
| 123 | Ga0097621_100014666 | 3300006237 | Bacteria | 5872 |
| 124 | Ga0097621_100048033 | 3300006237 | Bacteria | 3461 |
| 125 | Ga0075370_10000323 | 3300006353 | Bacteria | 17249 |
| 126 | Ga0075370_10001147 | 3300006353 | Bacteria | 11127 |
| 127 | Ga0075370_10002412 | 3300006353 | Bacteria | 8657 |
| 128 | Ga0068871_100008295 | 3300006358 | Bacteria | 7466 |
| 129 | Ga0075428_100061243 | 3300006844 | Bacteria | 4121 |
| 130 | Ga0075428_100128960 | 3300006844 | Bacteria | 2752 |
| 131 | Ga0075431_100309852 | 3300006847 | Bacteria | 1594 |
| 132 | Ga0075431_100701064 | 3300006847 | Bacteria | 990 |
| 133 | Ga0075434_100000132 | 3300006871 | Bacteria | 44951 |
| 134 | Ga0075429_100000638 | 3300006880 | Bacteria | 27089 |
| 135 | Ga0075429_100135451 | 3300006880 | Bacteria | 2155 |
| 136 | Ga0068865_100001393 | 3300006881 | Bacteria | 14049 |
| 137 | Ga0068865_100334617 | 3300006881 | Bacteria | 1222 |
| 138 | Ga0097620_100069458 | 3300006931 | Bacteria | 3558 |
| 139 | Ga0097620_100081857 | 3300006931 | Bacteria | 3270 |
| 140 | Ga0075435_100001341 | 3300007076 | Bacteria | 15839 |
| 141 | Ga0075435_100006450 | 3300007076 | Bacteria | 8299 |
| 142 | Ga0075435_100383464 | 3300007076 | Bacteria | 1207 |
| 143 | Ga0099794_10004485 | 3300007265 | Bacteria | 5496 |
| 144 | Ga0105240_10031668 | 3300009093 | Bacteria | 6854 |
| 145 | Ga0105245_10019196 | 3300009098 | Bacteria | 5987 |
| 146 | Ga0105245_10047244 | 3300009098 | Bacteria | 3847 |
| 147 | Ga0105245_10082487 | 3300009098 | Bacteria | 2941 |
| 148 | Ga0105245_10420648 | 3300009098 | Bacteria | 1339 |
| 149 | Ga0105247_10070929 | 3300009101 | Bacteria | 2178 |
| 150 | Ga0114129_10007443 | 3300009147 | Bacteria | 15595 |
| 151 | Ga0114129_10015516 | 3300009147 | Bacteria | 10831 |
| 152 | Ga0114129_10707650 | 3300009147 | Bacteria | 1294 |
| 153 | Ga0105243_10000293 | 3300009148 | Bacteria | 55165 |
| 154 | Ga0105243_10001129 | 3300009148 | Bacteria | 24198 |
| 155 | Ga0105243_10030887 | 3300009148 | Bacteria | 4128 |
| 156 | Ga0105243_10055682 | 3300009148 | Bacteria | 3142 |
| 157 | Ga0105243_10130133 | 3300009148 | Bacteria | 2134 |
| 158 | Ga0105241_10148319 | 3300009174 | Bacteria | 1916 |
| 159 | Ga0105241_10613204 | 3300009174 | Bacteria | 984 |
| 160 | Ga0105242_10003998 | 3300009176 | Bacteria | 11461 |
| 161 | Ga0105242_10117572 | 3300009176 | Bacteria | 2276 |
| 162 | Ga0105248_10050176 | 3300009177 | Bacteria | 4680 |
| 163 | Ga0105237_10060650 | 3300009545 | Bacteria | 3783 |
| 164 | Ga0105237_10063038 | 3300009545 | Bacteria | 3705 |
| 165 | Ga0105238_10030346 | 3300009551 | Bacteria | 5502 |
| 166 | Ga0105249_10019624 | 3300009553 | Bacteria | 6033 |
| 167 | Ga0105249_10074689 | 3300009553 | Bacteria | 3138 |
| 168 | Ga0105239_10023366 | 3300010375 | Bacteria | 6808 |
| 169 | Ga0105239_11158724 | 3300010375 | Bacteria | 890 |
| 170 | Ga0105246_10647558 | 3300011119 | Bacteria | 919 |
| 171 | Ga0157374_10050050 | 3300013296 | Bacteria | 3882 |
| 172 | Ga0157374_10303774 | 3300013296 | Bacteria | 1579 |
| 173 | Ga0157378_10001828 | 3300013297 | Bacteria | 19102 |
| 174 | Ga0157378_10201519 | 3300013297 | Bacteria | 1882 |
| 175 | Ga0157372_10079010 | 3300013307 | Bacteria | 3719 |
| 176 | Ga0157375_10135257 | 3300013308 | Bacteria | 2588 |
| 177 | Ga0157375_10396034 | 3300013308 | Bacteria | 1548 |
| 178 | Ga0157375_10461385 | 3300013308 | Bacteria | 1436 |
| 179 | Ga0163163_10402264 | 3300014325 | Bacteria | 1427 |
| 180 | Ga0163163_10638938 | 3300014325 | Bacteria | 1128 |
| 181 | Ga0157380_10135584 | 3300014326 | Bacteria | 2106 |
| 182 | Ga0182008_10000057 | 3300014497 | Bacteria | 100700 |
| 183 | Ga0157379_10014502 | 3300014968 | Bacteria | 6916 |
| 184 | Ga0157379_10084096 | 3300014968 | Bacteria | 2852 |
| 185 | Ga0157379_10203363 | 3300014968 | Bacteria | 1791 |
| 186 | Ga0157379_10328619 | 3300014968 | Bacteria | 1397 |
| 187 | Ga0157376_10016416 | 3300014969 | Bacteria | 5621 |
| 188 | Ga0157376_10028875 | 3300014969 | Bacteria | 4413 |
| 189 | Ga0157376_10127060 | 3300014969 | Bacteria | 2269 |
| 190 | Ga0163161_10104436 | 3300017792 | Bacteria | 2112 |
| 191 | Ga0213876_10034134 | 3300021384 | Bacteria | 2683 |
| 192 | Ga0213875_10151085 | 3300021388 | Bacteria | 1088 |
| 193 | Ga0209130_1001720 | 3300025284 | Bacteria | 13127 |
| 194 | Ga0209675_1002415 | 3300025291 | Bacteria | 9634 |
| 195 | Ga0209676_1000267 | 3300025292 | Bacteria | 109237 |
| 196 | Ga0209676_1006250 | 3300025292 | Bacteria | 5935 |
| 197 | Ga0209050_1009624 | 3300025298 | Bacteria | 4912 |
| 198 | Ga0209050_1015410 | 3300025298 | Bacteria | 3213 |
| 199 | Ga0209051_1000230 | 3300025303 | Bacteria | 94027 |
| 200 | Ga0209051_1005092 | 3300025303 | Bacteria | 7811 |
| 201 | Ga0209257_1004695 | 3300025304 | Bacteria | 10259 |
| 202 | Ga0209257_1005713 | 3300025304 | Bacteria | 8541 |
| 203 | Ga0207653_10050829 | 3300025885 | Bacteria | 1379 |
| 204 | Ga0207642_10001218 | 3300025899 | Bacteria | 7965 |
| 205 | Ga0207688_10074308 | 3300025901 | Bacteria | 1933 |
| 206 | Ga0207645_10045172 | 3300025907 | Bacteria | 2816 |
| 207 | Ga0207645_10097740 | 3300025907 | Bacteria | 1892 |
| 208 | Ga0207643_10021144 | 3300025908 | Bacteria | 3572 |
| 209 | Ga0207705_10027375 | 3300025909 | Bacteria | 4065 |
| 210 | Ga0207705_10230280 | 3300025909 | Bacteria | 1409 |
| 211 | Ga0207705_10235817 | 3300025909 | Bacteria | 1393 |
| 212 | Ga0207684_10009615 | 3300025910 | Bacteria | 8528 |
| 213 | Ga0207695_10060434 | 3300025913 | Bacteria | 3923 |
| 214 | Ga0207695_10067326 | 3300025913 | Bacteria | 3674 |
| 215 | Ga0207671_10019856 | 3300025914 | Bacteria | 5128 |
| 216 | Ga0207671_10037914 | 3300025914 | Bacteria | 3573 |
| 217 | Ga0207693_10028490 | 3300025915 | Bacteria | 4412 |
| 218 | Ga0207662_10218292 | 3300025918 | Bacteria | 1241 |
| 219 | Ga0207657_10045873 | 3300025919 | Bacteria | 3831 |
| 220 | Ga0207652_10096073 | 3300025921 | Bacteria | 2611 |
| 221 | Ga0207652_10383708 | 3300025921 | Bacteria | 1268 |
| 222 | Ga0207646_10004415 | 3300025922 | Bacteria | 15298 |
| 223 | Ga0207646_10008771 | 3300025922 | Bacteria | 10091 |
| 224 | Ga0207646_10011967 | 3300025922 | Bacteria | 8364 |
| 225 | Ga0207650_10204212 | 3300025925 | Bacteria | 1584 |
| 226 | Ga0207687_10013443 | 3300025927 | Bacteria | 5344 |
| 227 | Ga0207687_10130250 | 3300025927 | Bacteria | 1895 |
| 228 | Ga0207687_10372130 | 3300025927 | Bacteria | 1168 |
| 229 | Ga0207664_10173970 | 3300025929 | Bacteria | 1844 |
| 230 | Ga0207664_10386367 | 3300025929 | Bacteria | 1243 |
| 231 | Ga0207664_10533396 | 3300025929 | Bacteria | 1052 |
| 232 | Ga0207706_10079522 | 3300025933 | Bacteria | 2883 |
| 233 | Ga0207709_10000076 | 3300025935 | Bacteria | 173292 |
| 234 | Ga0207709_10090791 | 3300025935 | Bacteria | 1996 |
| 235 | Ga0207709_10095580 | 3300025935 | Bacteria | 1953 |
| 236 | Ga0207709_10234822 | 3300025935 | Bacteria | 1330 |
| 237 | Ga0207670_10122254 | 3300025936 | Bacteria | 1894 |
| 238 | Ga0207669_10117932 | 3300025937 | Bacteria | 1795 |
| 239 | Ga0207669_10275419 | 3300025937 | Bacteria | 1266 |
| 240 | Ga0207704_10196429 | 3300025938 | Bacteria | 1472 |
| 241 | Ga0207689_10000673 | 3300025942 | Bacteria | 32601 |
| 242 | Ga0207689_10007510 | 3300025942 | Bacteria | 9558 |
| 243 | Ga0207689_10073455 | 3300025942 | Bacteria | 2810 |
| 244 | Ga0207689_10136195 | 3300025942 | Bacteria | 2022 |
| 245 | Ga0207689_10177754 | 3300025942 | Bacteria | 1755 |
| 246 | Ga0207661_10458954 | 3300025944 | Bacteria | 1161 |
| 247 | Ga0207667_10206428 | 3300025949 | Bacteria | 2014 |
| 248 | Ga0207667_10208201 | 3300025949 | Bacteria | 2005 |
| 249 | Ga0207667_10366929 | 3300025949 | Bacteria | 1468 |
| 250 | Ga0207651_10028252 | 3300025960 | Bacteria | 3536 |
| 251 | Ga0207712_10041781 | 3300025961 | Bacteria | 3153 |
| 252 | Ga0207712_10557531 | 3300025961 | Bacteria | 986 |
| 253 | Ga0207677_10100644 | 3300026023 | Bacteria | 2126 |
| 254 | Ga0207703_10004160 | 3300026035 | Bacteria | 11933 |
| 255 | Ga0207703_10031793 | 3300026035 | Bacteria | 4175 |
| 256 | Ga0207703_10194450 | 3300026035 | Bacteria | 1799 |
| 257 | Ga0207639_10156859 | 3300026041 | Bacteria | 1913 |
| 258 | Ga0207708_10000998 | 3300026075 | Bacteria | 21173 |
| 259 | Ga0207708_10003798 | 3300026075 | Bacteria | 11139 |
| 260 | Ga0207708_10031092 | 3300026075 | Bacteria | 4051 |
| 261 | Ga0207702_10070769 | 3300026078 | Bacteria | 3001 |
| 262 | Ga0207641_10120412 | 3300026088 | Bacteria | 2341 |
| 263 | Ga0207648_10001170 | 3300026089 | Bacteria | 29352 |
| 264 | Ga0207648_10017778 | 3300026089 | Bacteria | 6456 |
| 265 | Ga0207648_10018068 | 3300026089 | Bacteria | 6388 |
| 266 | Ga0207648_10075312 | 3300026089 | Bacteria | 2942 |
| 267 | Ga0207648_10329754 | 3300026089 | Bacteria | 1373 |
| 268 | Ga0207674_10006174 | 3300026116 | Bacteria | 14144 |
| 269 | Ga0207674_10065127 | 3300026116 | Bacteria | 3674 |
| 270 | Ga0207675_100000583 | 3300026118 | Bacteria | 35648 |
| 271 | Ga0207675_100041652 | 3300026118 | Bacteria | 4288 |
| 272 | Ga0207675_100135758 | 3300026118 | Bacteria | 2334 |
| 273 | Ga0209995_1023511 | 3300027471 | Bacteria | 1025 |
| 274 | Ga0209999_1000946 | 3300027543 | Bacteria | 4895 |
| 275 | Ga0209983_1013262 | 3300027665 | Bacteria | 1694 |
| 276 | Ga0268266_10132081 | 3300028379 | Bacteria | 2234 |
| 277 | Ga0268265_10005090 | 3300028380 | Bacteria | 9014 |
| 278 | Ga0268265_10166724 | 3300028380 | Bacteria | 1878 |
| 279 | Ga0268264_10053528 | 3300028381 | Bacteria | 3367 |
| 280 | Ga0268264_10188658 | 3300028381 | Bacteria | 1878 |
| 281 | Ga0268264_10357694 | 3300028381 | Bacteria | 1391 |
| 282 | Ga0307515_10000014 | 3300028794 | Bacteria | 562358 |
| 283 | Ga0307515_10072864 | 3300028794 | Bacteria | 4627 |
| 284 | Ga0265325_10063097 | 3300031241 | Bacteria | 1876 |
| 285 | Ga0265329_10043310 | 3300031242 | Bacteria | 1440 |
| 286 | Ga0265340_10056503 | 3300031247 | Bacteria | 1888 |
| 287 | Ga0307513_10001376 | 3300031456 | Bacteria | 35012 |
| 288 | Ga0307513_10013819 | 3300031456 | Bacteria | 9897 |
| 289 | Ga0307513_10026911 | 3300031456 | Bacteria | 6615 |
| 290 | Ga0307408_100480043 | 3300031548 | Bacteria | 1084 |
| 291 | Ga0307408_100667485 | 3300031548 | Bacteria | 931 |
| 292 | Ga0265313_10000007 | 3300031595 | Bacteria | 178640 |
| 293 | Ga0265314_10020787 | 3300031711 | Bacteria | 5062 |
| 294 | Ga0265314_10039722 | 3300031711 | Bacteria | 3385 |
| 295 | Ga0265342_10032558 | 3300031712 | Bacteria | 3215 |
| 296 | Ga0265342_10068057 | 3300031712 | Bacteria | 2082 |
| 297 | Ga0307516_10014503 | 3300031730 | Bacteria | 8332 |
| 298 | Ga0307405_10046349 | 3300031731 | Bacteria | 2670 |
| 299 | Ga0307414_10281076 | 3300032004 | Bacteria | 1398 |
| 300 | Ga0307411_10043524 | 3300032005 | Bacteria | 2873 |
| 301 | Ga0373957_0056246 | 3300035120 | Bacteria | 1514 |
| 302 | Ga0373943_0028923 | 3300035170 | Bacteria | 2615 |
| 303 | Ga0373955_0004531 | 3300035172 | Bacteria | 6156 |
| 304 | Ga0373924_0003359 | 3300035410 | Bacteria | 5498 |
| 305 | Ga0373931_0196023 | 3300035691 | Bacteria | 1204 |
| 306 | Ga0373933_0002353 | 3300035724 | Bacteria | 10700 |
| 307 | Ga0373937_0003134 | 3300036401 | Bacteria | 13831 |
| 308 | Ga0373937_0055911 | 3300036401 | Bacteria | 3623 |
| 309 | Ga0373937_0773515 | 3300036401 | Bacteria | 908 |
| 310 | Ga0395900_0024795 | 3300037418 | Bacteria | 6139 |
| 311 | Ga0395900_0392675 | 3300037418 | Bacteria | 1353 |
| 312 | Ga0395898_0017213 | 3300037466 | Bacteria | 7381 |
| 313 | Ga0395898_0050626 | 3300037466 | Bacteria | 4065 |
| 314 | Ga0395905_0000180 | 3300037471 | Bacteria | 100693 |
| 315 | Ga0395905_0001562 | 3300037471 | Bacteria | 27356 |
| 316 | Ga0395905_0087967 | 3300037471 | Bacteria | 2912 |
| 317 | Ga0395905_0153818 | 3300037471 | Bacteria | 2163 |
| 318 | Ga0395905_0210323 | 3300037471 | Bacteria | 1822 |
| 319 | Ga0395905_0230355 | 3300037471 | Bacteria | 1732 |
| 320 | Ga0436364_0448380 | 3300037853 | Bacteria | 2128 |
| 321 | Ga0436364_1070606 | 3300037853 | Bacteria | 1216 |
| 322 | Ga0395901_0024791 | 3300038443 | Bacteria | 6157 |
| 323 | Ga0395901_0028082 | 3300038443 | Bacteria | 5788 |
| 324 | Ga0395901_0069423 | 3300038443 | Bacteria | 3670 |
| 325 | Ga0395901_0151258 | 3300038443 | Bacteria | 2439 |
| 326 | Ga0395901_0269744 | 3300038443 | Bacteria | 1770 |
| 327 | Ga0395901_0327505 | 3300038443 | Bacteria | 1584 |
| 328 | Ga0395901_0416674 | 3300038443 | Bacteria | 1378 |
| 329 | Ga0436365_1295484 | 3300039437 | Bacteria | 1027 |
| 330 | Ga0436360_0964426 | 3300039438 | Bacteria | 2063 |
| 331 | Ga0436361_0213696 | 3300039447 | Bacteria | 1478 |
| 332 | Ga0436361_0670097 | 3300039447 | Bacteria | 1076 |
| 333 | Ga0436361_1140218 | 3300039447 | Bacteria | 3155 |
| 334 | Ga0439436_0007642 | 3300041404 | Bacteria | 3326 |
| 335 | Ga0439439_0037914 | 3300041406 | Bacteria | 1243 |
| 336 | Ga0439447_017604 | 3300041407 | Bacteria | 1944 |
| 337 | Ga0439453_0003181 | 3300041408 | Bacteria | 2338 |
| 338 | Ga0439466_0026535 | 3300041411 | Bacteria | 2013 |
| 339 | Ga0439465_0003028 | 3300041413 | Bacteria | 5494 |
| 340 | Ga0439465_0045727 | 3300041413 | Bacteria | 1424 |
| 341 | Ga0439433_0001968 | 3300041999 | Bacteria | 4306 |
| 342 | Ga0439445_0000586 | 3300042004 | Bacteria | 7445 |
| 343 | Ga0439449_0008794 | 3300042007 | Bacteria | 3830 |
| 344 | Ga0439452_002437 | 3300042010 | Bacteria | 6858 |
| 345 | Ga0439457_004343 | 3300042014 | Bacteria | 3714 |
| 346 | Ga0439462_0000724 | 3300042015 | Bacteria | 6805 |
| 347 | Ga0450911_000599 | 3300042115 | Bacteria | 10973 |
| 348 | Ga0450920_015251 | 3300042122 | Bacteria | 1461 |
| 349 | Ga0450923_001005 | 3300042125 | Bacteria | 3516 |
| 350 | Ga0450898_017083 | 3300042134 | Bacteria | 1245 |
| 351 | Ga0450899_007976 | 3300042135 | Bacteria | 1157 |
| 352 | Ga0450899_010541 | 3300042135 | Bacteria | 1026 |
| 353 | Ga0450903_015703 | 3300042138 | Bacteria | 1191 |
| 354 | Ga0450906_006060 | 3300042145 | Bacteria | 2456 |
| 355 | Ga0439446_0026452 | 3300042156 | Bacteria | 1662 |
| 356 | Ga0439446_0064259 | 3300042156 | Bacteria | 1114 |
| 357 | Ga0450908_009248 | 3300042184 | Bacteria | 1832 |
| 358 | Ga0439434_0002341 | 3300042435 | Bacteria | 5514 |
| 359 | Ga0439434_0004891 | 3300042435 | Bacteria | 3919 |
| 360 | Ga0439435_0000049 | 3300042436 | Bacteria | 13342 |
| 361 | Ga0439435_0058171 | 3300042436 | Bacteria | 1121 |
| 362 | Ga0439444_0003193 | 3300042437 | Bacteria | 2302 |
| 363 | Ga0450893_0005996 | 3300042532 | Bacteria | 1959 |
| 364 | Ga0451577_0003923 | 3300042876 | Bacteria | 16072 |
| 365 | Ga0451577_0099058 | 3300042876 | Bacteria | 2603 |
| 366 | Ga0451577_0139425 | 3300042876 | Bacteria | 2178 |
| 367 | Ga0451577_0679033 | 3300042876 | Bacteria | 933 |
| 368 | Ga0466969_0015338 | 3300044656 | Bacteria | 4016 |
| 369 | Ga0466966_0003903 | 3300044684 | Bacteria | 9843 |
| 370 | Ga0466964_0202035 | 3300044706 | Bacteria | 955 |
| 371 | Ga0453684_0098821 | 3300044712 | Bacteria | 3577 |
| 372 | Ga0453684_0114391 | 3300044712 | Bacteria | 3271 |
| 373 | Ga0453684_0140881 | 3300044712 | Bacteria | 2880 |
| 374 | Ga0466970_0185710 | 3300044765 | Bacteria | 1154 |
| 375 | Ga0466960_0036523 | 3300044901 | Bacteria | 2301 |
| 376 | Ga0466959_0008562 | 3300045049 | Bacteria | 7240 |
| 377 | Ga0451576_0058153 | 3300045051 | Bacteria | 4041 |
| 378 | Ga0451576_0118671 | 3300045051 | Bacteria | 2754 |
| 379 | Ga0495653_0169056 | 3300046463 | Bacteria | 1511 |
| 380 | Ga0495653_0337828 | 3300046463 | Bacteria | 972 |
| 381 | Ga0495650_0039724 | 3300046471 | Bacteria | 2028 |
| 382 | Ga0495580_0261645 | 3300046472 | Bacteria | 1183 |
| 383 | Ga0495630_0088712 | 3300046517 | Bacteria | 2336 |
| 384 | Ga0495642_0023443 | 3300046528 | Bacteria | 2436 |
| 385 | Ga0495621_0010736 | 3300046539 | Bacteria | 2813 |
| 386 | Ga0495621_0015071 | 3300046539 | Bacteria | 2459 |
| 387 | Ga0495597_0011926 | 3300046542 | Bacteria | 4204 |
| 388 | Ga0495667_0087137 | 3300046559 | Bacteria | 2025 |
| 389 | Ga0495667_0326430 | 3300046559 | Bacteria | 971 |
| 390 | Ga0495656_0000163 | 3300046615 | Bacteria | 24459 |
| 391 | Ga0495656_0003746 | 3300046615 | Bacteria | 5163 |
| 392 | Ga0495625_0056474 | 3300046660 | Bacteria | 2794 |
| 393 | Ga0495635_0193792 | 3300046663 | Bacteria | 1379 |
| 394 | Ga0495661_0265790 | 3300046665 | Bacteria | 870 |
| 395 | Ga0495588_0031332 | 3300046674 | Bacteria | 2676 |
| 396 | Ga0495669_0082404 | 3300046684 | Bacteria | 1478 |
| 397 | Ga0495670_0154673 | 3300046691 | Bacteria | 1203 |
| 398 | Ga0495649_0000541 | 3300046694 | Bacteria | 32077 |
| 399 | Ga0495600_0287915 | 3300046809 | Bacteria | 1038 |
| 400 | Ga0495604_0132267 | 3300047317 | Bacteria | 1792 |
| 401 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 402 | Ga0495675_0284099 | 3300047444 | Bacteria | 986 |
| 403 | Ga0495684_0277771 | 3300047471 | Bacteria | 1210 |
| 404 | Ga0495615_0002109 | 3300048090 | Bacteria | 3120 |
| 405 | Ga0495626_0083205 | 3300048091 | Bacteria | 1418 |
| 406 | Ga0495626_0093038 | 3300048091 | Bacteria | 1324 |
| 407 | Ga0495626_0136050 | 3300048091 | Bacteria | 1045 |
| 408 | Ga0496101_0061948 | 3300048904 | Bacteria | 2719 |
| 409 | Ga0496102_0007327 | 3300048905 | Bacteria | 9419 |
| 410 | Ga0496102_0027593 | 3300048905 | Bacteria | 5070 |
| 411 | Ga0496102_0101591 | 3300048905 | Bacteria | 2672 |
| 412 | Ga0496104_0498048 | 3300048907 | Bacteria | 1129 |
| 413 | Ga0496104_0533919 | 3300048907 | Bacteria | 1084 |
| 414 | Ga0496105_0040504 | 3300048908 | Bacteria | 3842 |
| 415 | Ga0496105_0155266 | 3300048908 | Bacteria | 1880 |
| 416 | Ga0496105_0293714 | 3300048908 | Bacteria | 1308 |
| 417 | Ga0496106_0157216 | 3300048909 | Bacteria | 1796 |
| 418 | Ga0496109_0080718 | 3300048912 | Bacteria | 2997 |
| 419 | Ga0496109_0185560 | 3300048912 | Bacteria | 1954 |
| 420 | Ga0496109_0214020 | 3300048912 | Bacteria | 1812 |
| 421 | Ga0496110_0124275 | 3300048913 | Bacteria | 2327 |
| 422 | Ga0496111_0148736 | 3300048914 | Bacteria | 1737 |
| 423 | Ga0496112_0540589 | 3300048915 | Bacteria | 1099 |
| 424 | Ga0496121_0002968 | 3300048924 | Bacteria | 24705 |
| 425 | Ga0496125_0004911 | 3300048928 | Bacteria | 15140 |
| 426 | Ga0496125_0026075 | 3300048928 | Bacteria | 5337 |
| 427 | Ga0496125_0047579 | 3300048928 | Bacteria | 3584 |
| 428 | Ga0496126_0061462 | 3300048929 | Bacteria | 3374 |
| 429 | Ga0496126_0277110 | 3300048929 | Bacteria | 1390 |
| 430 | Ga0501033_0054334 | 3300049570 | Bacteria | 2963 |
| 431 | Ga0501033_0316274 | 3300049570 | Bacteria | 1097 |
| 432 | Ga0501034_0101591 | 3300049571 | Bacteria | 2869 |
| 433 | Ga0501034_0118040 | 3300049571 | Bacteria | 2640 |
| 434 | Ga0501036_0004009 | 3300049572 | Bacteria | 11843 |
| 435 | Ga0501036_0025927 | 3300049572 | Bacteria | 4946 |
| 436 | Ga0501036_0097383 | 3300049572 | Bacteria | 2486 |
| 437 | Ga0501038_0010789 | 3300049574 | Bacteria | 8350 |
| 438 | Ga0501038_0020071 | 3300049574 | Bacteria | 6013 |
| 439 | Ga0501038_0083616 | 3300049574 | Bacteria | 2686 |
| 440 | Ga0501038_0103088 | 3300049574 | Bacteria | 2373 |
| 441 | Ga0501039_0025900 | 3300049575 | Bacteria | 4510 |
| 442 | Ga0501039_0033134 | 3300049575 | Bacteria | 3985 |
| 443 | Ga0501039_0085997 | 3300049575 | Bacteria | 2449 |
| 444 | Ga0501040_0030527 | 3300049576 | Bacteria | 3641 |
| 445 | Ga0501041_0022444 | 3300049577 | Bacteria | 3779 |
| 446 | Ga0501042_0254032 | 3300049578 | Bacteria | 1268 |
| 447 | Ga0501043_0001183 | 3300049579 | Bacteria | 22974 |
| 448 | Ga0501043_0005068 | 3300049579 | Bacteria | 10654 |
| 449 | Ga0501043_0005128 | 3300049579 | Bacteria | 10602 |
| 450 | Ga0501043_0049809 | 3300049579 | Bacteria | 3293 |
| 451 | Ga0501043_0082393 | 3300049579 | Bacteria | 2528 |
| 452 | Ga0501043_0250656 | 3300049579 | Bacteria | 1364 |
| 453 | Ga0501046_0072755 | 3300049580 | Bacteria | 2668 |
| 454 | Ga0501046_0079051 | 3300049580 | Bacteria | 2543 |
| 455 | Ga0501046_0110210 | 3300049580 | Bacteria | 2104 |
| 456 | Ga0501046_0154325 | 3300049580 | Bacteria | 1731 |
| 457 | Ga0501047_0000363 | 3300049581 | Bacteria | 51477 |
| 458 | Ga0501047_0006481 | 3300049581 | Bacteria | 11015 |
| 459 | Ga0501047_0065184 | 3300049581 | Bacteria | 3511 |
| 460 | Ga0501047_0093289 | 3300049581 | Bacteria | 2889 |
| 461 | Ga0501047_0114524 | 3300049581 | Bacteria | 2579 |
| 462 | Ga0501047_0207716 | 3300049581 | Bacteria | 1817 |
| 463 | Ga0501048_0015399 | 3300049582 | Bacteria | 5647 |
| 464 | Ga0501067_0095181 | 3300049583 | Bacteria | 1653 |
| 465 | Ga0501068_0027028 | 3300049584 | Bacteria | 3385 |
| 466 | Ga0501069_0082267 | 3300049585 | Bacteria | 1814 |
| 467 | Ga0501069_0119348 | 3300049585 | Bacteria | 1506 |
| 468 | Ga0501070_0015722 | 3300049586 | Bacteria | 6364 |
| 469 | Ga0501070_0050177 | 3300049586 | Bacteria | 3464 |
| 470 | Ga0501070_0065748 | 3300049586 | Bacteria | 3003 |
| 471 | Ga0501070_0088225 | 3300049586 | Bacteria | 2567 |
| 472 | Ga0501070_0159434 | 3300049586 | Bacteria | 1860 |
| 473 | Ga0501070_0173877 | 3300049586 | Bacteria | 1773 |
| 474 | Ga0501071_0139162 | 3300049587 | Bacteria | 1807 |
| 475 | Ga0501072_0090486 | 3300049588 | Bacteria | 2429 |
| 476 | Ga0501072_0122300 | 3300049588 | Bacteria | 2074 |
| 477 | Ga0501072_0124630 | 3300049588 | Bacteria | 2052 |
| 478 | Ga0501072_0198083 | 3300049588 | Bacteria | 1601 |
| 479 | Ga0501072_0287700 | 3300049588 | Bacteria | 1307 |
| 480 | Ga0501073_0026703 | 3300049589 | Bacteria | 4134 |
| 481 | Ga0501073_0078745 | 3300049589 | Bacteria | 2294 |
| 482 | Ga0501073_0331116 | 3300049589 | Bacteria | 1051 |
| 483 | Ga0501074_0006091 | 3300049590 | Bacteria | 8709 |
| 484 | Ga0501074_0008422 | 3300049590 | Bacteria | 7478 |
| 485 | Ga0501075_0000078 | 3300049591 | Bacteria | 43796 |
| 486 | Ga0501076_0000002 | 3300049592 | Bacteria | 165396 |
| 487 | Ga0501076_0187614 | 3300049592 | Bacteria | 1687 |
| 488 | Ga0501077_0283605 | 3300049593 | Bacteria | 1054 |
| 489 | Ga0501079_0019020 | 3300049741 | Bacteria | 5246 |
| 490 | Ga0501079_0020967 | 3300049741 | Bacteria | 4995 |
| 491 | Ga0501080_0000279 | 3300049742 | Bacteria | 38549 |
| 492 | Ga0501080_0027798 | 3300049742 | Bacteria | 5259 |
| 493 | Ga0501080_0448674 | 3300049742 | Bacteria | 1156 |
| 494 | Ga0501081_0101605 | 3300049743 | Bacteria | 2033 |
| 495 | Ga0501081_0147609 | 3300049743 | Bacteria | 1688 |
| 496 | Ga0501081_0308044 | 3300049743 | Bacteria | 1162 |
| 497 | Ga0501081_0398076 | 3300049743 | Bacteria | 1019 |
| 498 | Ga0501083_0000567 | 3300049744 | Bacteria | 23671 |
| 499 | Ga0501083_0050253 | 3300049744 | Bacteria | 2807 |
| 500 | Ga0501083_0054146 | 3300049744 | Bacteria | 2693 |
| 501 | Ga0501083_0103885 | 3300049744 | Bacteria | 1872 |
| 502 | Ga0501035_0017995 | 3300049822 | Bacteria | 6515 |
| 503 | Ga0501035_0025466 | 3300049822 | Bacteria | 5424 |
| 504 | Ga0501035_0080034 | 3300049822 | Bacteria | 2885 |
| 505 | Ga0501035_0105640 | 3300049822 | Bacteria | 2469 |
| 506 | Ga0501044_0001849 | 3300049823 | Bacteria | 24605 |
| 507 | Ga0501044_0104177 | 3300049823 | Bacteria | 2851 |
| 508 | Ga0501044_0108878 | 3300049823 | Bacteria | 2780 |
| 509 | Ga0501044_0183746 | 3300049823 | Bacteria | 2056 |
| 510 | Ga0501045_0098720 | 3300049824 | Bacteria | 2160 |
| 511 | Ga0501045_0314498 | 3300049824 | Bacteria | 1165 |
| 512 | nmdc:mga03683_14888_c1 | 3300050489 | Bacteria | 2889 |
| 513 | nmdc:mga03683_1540_c1 | 3300050489 | Bacteria | 6871 |
| 514 | nmdc:mga03683_5161_c1 | 3300050489 | Bacteria | 4391 |
| 515 | nmdc:mga03683_56278_c1 | 3300050489 | Bacteria | 1653 |
| 516 | nmdc:mga03683_59256_c1 | 3300050489 | Bacteria | 1615 |
| 517 | nmdc:mga03683_88628_c1 | 3300050489 | Bacteria | 1346 |
| 518 | nmdc:mga03n38_193261_c1 | 3300050490 | Bacteria | 1049 |
| 519 | nmdc:mga03n38_6527_c1 | 3300050490 | Bacteria | 4061 |
| 520 | nmdc:mga03n38_70248_c1 | 3300050490 | Bacteria | 1619 |
| 521 | nmdc:mga00v17_349361_c1 | 3300050491 | Bacteria | 961 |
| 522 | nmdc:mga00v17_9302_c1 | 3300050491 | Bacteria | 5314 |
| 523 | nmdc:mga00v17_97174_c1 | 3300050491 | Bacteria | 1856 |
| 524 | nmdc:mga0yw44_1966_c1 | 3300050492 | Bacteria | 8521 |
| 525 | nmdc:mga0yw44_56202_c1 | 3300050492 | Bacteria | 2397 |
| 526 | nmdc:mga0yw44_70861_c1 | 3300050492 | Bacteria | 2163 |
| 527 | nmdc:mga0k408_11155_c1 | 3300050493 | Bacteria | 4885 |
| 528 | nmdc:mga0k408_148282_c1 | 3300050493 | Bacteria | 1397 |
| 529 | nmdc:mga0k408_178433_c1 | 3300050493 | Bacteria | 1267 |
| 530 | nmdc:mga0k408_2967_c1 | 3300050493 | Bacteria | 9000 |
| 531 | nmdc:mga0k408_5135_c1 | 3300050493 | Bacteria | 3674 |
| 532 | nmdc:mga0k408_63245_c1 | 3300050493 | Bacteria | 2153 |
| 533 | nmdc:mga0k408_84667_c1 | 3300050493 | Bacteria | 1439 |
| 534 | nmdc:mga0k408_9816_c1 | 3300050493 | Bacteria | 5170 |
| 535 | nmdc:mga06z11_67391_c1 | 3300050494 | Bacteria | 1884 |
| 536 | nmdc:mga06z11_85826_c1 | 3300050494 | Bacteria | 1699 |
| 537 | nmdc:mga07m45_132261_c1 | 3300050496 | Bacteria | 1444 |
| 538 | nmdc:mga07m45_298073_c1 | 3300050496 | Bacteria | 938 |
| 539 | nmdc:mga07m45_33632_c1 | 3300050496 | Bacteria | 2848 |
| 540 | nmdc:mga07m45_5562_c1 | 3300050496 | Bacteria | 6287 |
| 541 | nmdc:mga07m45_756_c1 | 3300050496 | Bacteria | 13842 |
| 542 | nmdc:mga07m45_8395_c1 | 3300050496 | Bacteria | 5307 |
| 543 | nmdc:mga05p37_21838_c1 | 3300050507 | Bacteria | 7754 |
| 544 | nmdc:mga05p37_980_c1 | 3300050507 | Bacteria | 32442 |
| 545 | nmdc:mga09592_136871_c1 | 3300050508 | Bacteria | 2110 |
| 546 | nmdc:mga09592_947_c1 | 3300050508 | Bacteria | 22820 |
| 547 | nmdc:mga0qj67_705_c1 | 3300050509 | Bacteria | 22775 |
| 548 | nmdc:mga06r32_2106_c1 | 3300050510 | Bacteria | 17820 |
| 549 | nmdc:mga06r32_210852_c1 | 3300050510 | Bacteria | 1930 |
| 550 | nmdc:mga06r32_393827_c1 | 3300050510 | Bacteria | 1367 |
| 551 | nmdc:mga06r32_85802_c1 | 3300050510 | Bacteria | 3070 |
| 552 | nmdc:mga0n895_393151_c1 | 3300050512 | Bacteria | 1403 |
| 553 | nmdc:mga0n895_698018_c1 | 3300050512 | Bacteria | 1011 |
| 554 | nmdc:mga0rr50_26750_c1 | 3300050513 | Bacteria | 4031 |
| 555 | nmdc:mga0rr50_475609_c1 | 3300050513 | Bacteria | 1061 |
| 556 | nmdc:mga0rr50_65593_c1 | 3300050513 | Bacteria | 2751 |
| 557 | nmdc:mga08x19_115910_c1 | 3300050514 | Bacteria | 1791 |
| 558 | nmdc:mga08x19_15018_c1 | 3300050514 | Bacteria | 4703 |
| 559 | nmdc:mga0sz30_6027_c1 | 3300050516 | Bacteria | 4479 |
| 560 | Ga0495601_0026917 | 3300053077 | Bacteria | 3554 |
| 561 | Ga0495601_0224374 | 3300053077 | Bacteria | 1227 |
| 562 | Ga0495595_0026874 | 3300053084 | Bacteria | 2560 |
| 563 | Ga0495595_0056279 | 3300053084 | Bacteria | 1832 |
| 564 | Ga0495619_0022146 | 3300053085 | Bacteria | 4063 |
| 565 | Ga0500618_012879 | 3300053125 | Bacteria | 2178 |
| 566 | Ga0500568_0017764 | 3300053139 | Bacteria | 3131 |
| 567 | Ga0501084_0125361 | 3300054114 | Bacteria | 2161 |
| 568 | Ga0501084_0179077 | 3300054114 | Bacteria | 1789 |
| 569 | Ga0501084_0468826 | 3300054114 | Bacteria | 1064 |
| 570 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 571 | Ga0501082_0012631 | 3300060353 | Bacteria | 7260 |
| 572 | Ga0530510_0000024 | 3300061734 | Bacteria | 68684 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0118671 | Ga0451576_0118671_1248_2135 | 233 |
| 2 | 3300042876 | Ga0451577_0099058 | Ga0451577_0099058_484_1338 | 238 |
| 3 | 3300044712 | Ga0453684_0098821 | Ga0453684_0098821_2418_3272 | 238 |
| 4 | 3300045051 | Ga0451576_0058153 | Ga0451576_0058153_2394_3248 | 238 |
| 5 | 3300006177 | Ga0075362_10063066 | Ga0075362_100630662 | 244 |
| 6 | 3300006178 | Ga0075367_10002066 | Ga0075367_100020668 | 244 |
| 7 | 3300006186 | Ga0075369_10001746 | Ga0075369_100017463 | 244 |
| 8 | 3300006195 | Ga0075366_10010021 | Ga0075366_100100213 | 244 |
| 9 | 3300006195 | Ga0075366_10041774 | Ga0075366_100417742 | 244 |
| 10 | 3300006353 | Ga0075370_10001147 | Ga0075370_1000114710 | 244 |
| 11 | 3300005343 | Ga0070687_100195970 | Ga0070687_1001959701 | 246 |
| 12 | 3300006353 | Ga0075370_10000323 | Ga0075370_1000032318 | 246 |
| 13 | 3300025918 | Ga0207662_10218292 | Ga0207662_102182922 | 246 |
| 14 | 3300042135 | Ga0450899_007976 | Ga0450899_007976_123_911 | 246 |
| 15 | 3300042135 | Ga0450899_010541 | Ga0450899_010541_51_815 | 246 |
| 16 | 3300046694 | Ga0495649_0000541 | Ga0495649_0000541_6756_7541 | 246 |
| 17 | 3300048091 | Ga0495626_0093038 | Ga0495626_0093038_283_1068 | 246 |
| 18 | 3300050489 | nmdc:mga03683_5161_c1 | nmdc:mga03683_5161_c1_1544_2317 | 246 |
| 19 | 3300050493 | nmdc:mga0k408_5135_c1 | nmdc:mga0k408_5135_c1_1065_1838 | 246 |
| 20 | 3300050493 | nmdc:mga0k408_9816_c1 | nmdc:mga0k408_9816_c1_2319_3092 | 246 |
| 21 | 3300050496 | nmdc:mga07m45_756_c1 | nmdc:mga07m45_756_c1_12914_13687 | 246 |
| 22 | 3300050516 | nmdc:mga0sz30_6027_c1 | nmdc:mga0sz30_6027_c1_762_1535 | 246 |
| 23 | 3300053139 | Ga0500568_0017764 | Ga0500568_0017764_2189_2974 | 246 |
| 24 | 3300006048 | Ga0075363_100061483 | Ga0075363_1000614833 | 248 |
| 25 | 3300006177 | Ga0075362_10004353 | Ga0075362_100043533 | 248 |
| 26 | 3300050489 | nmdc:mga03683_1540_c1 | nmdc:mga03683_1540_c1_1720_2538 | 248 |
| 27 | 3300050490 | nmdc:mga03n38_70248_c1 | nmdc:mga03n38_70248_c1_461_1279 | 248 |
| 28 | 3300009545 | Ga0105237_10063038 | Ga0105237_100630382 | 251 |
| 29 | 3300010375 | Ga0105239_10023366 | Ga0105239_100233662 | 251 |
| 30 | 3300031456 | Ga0307513_10013819 | Ga0307513_1001381910 | 251 |
| 31 | 3300038443 | Ga0395901_0028082 | Ga0395901_0028082_3576_4337 | 251 |
| 32 | 3300041408 | Ga0439453_0003181 | Ga0439453_0003181_17_772 | 251 |
| 33 | 3300042156 | Ga0439446_0064259 | Ga0439446_0064259_85_840 | 251 |
| 34 | 3300042437 | Ga0439444_0003193 | Ga0439444_0003193_1382_2137 | 251 |
| 35 | 3300046559 | Ga0495667_0087137 | Ga0495667_0087137_506_1261 | 251 |
| 36 | 3300048905 | Ga0496102_0007327 | Ga0496102_0007327_5477_6232 | 251 |
| 37 | 3300049572 | Ga0501036_0004009 | Ga0501036_0004009_527_1285 | 251 |
| 38 | 3300049574 | Ga0501038_0010789 | Ga0501038_0010789_5391_6149 | 251 |
| 39 | 3300049575 | Ga0501039_0025900 | Ga0501039_0025900_1001_1759 | 251 |
| 40 | 3300049576 | Ga0501040_0030527 | Ga0501040_0030527_2636_3394 | 251 |
| 41 | 3300049577 | Ga0501041_0022444 | Ga0501041_0022444_229_987 | 251 |
| 42 | 3300049578 | Ga0501042_0254032 | Ga0501042_0254032_476_1234 | 251 |
| 43 | 3300049579 | Ga0501043_0250656 | Ga0501043_0250656_579_1337 | 251 |
| 44 | 3300049580 | Ga0501046_0110210 | Ga0501046_0110210_97_855 | 251 |
| 45 | 3300049582 | Ga0501048_0015399 | Ga0501048_0015399_1434_2192 | 251 |
| 46 | 3300049587 | Ga0501071_0139162 | Ga0501071_0139162_939_1697 | 251 |
| 47 | 3300049588 | Ga0501072_0124630 | Ga0501072_0124630_367_1125 | 251 |
| 48 | 3300049591 | Ga0501075_0000078 | Ga0501075_0000078_207_965 | 251 |
| 49 | 3300049592 | Ga0501076_0000002 | Ga0501076_0000002_123398_124156 | 251 |
| 50 | 3300049593 | Ga0501077_0283605 | Ga0501077_0283605_53_811 | 251 |
| 51 | 3300049741 | Ga0501079_0020967 | Ga0501079_0020967_1959_2717 | 251 |
| 52 | 3300049743 | Ga0501081_0101605 | Ga0501081_0101605_117_875 | 251 |
| 53 | 3300049824 | Ga0501045_0098720 | Ga0501045_0098720_330_1088 | 251 |
| 54 | 3300050510 | nmdc:mga06r32_85802_c1 | nmdc:mga06r32_85802_c1_1972_2727 | 251 |
| 55 | 3300054114 | Ga0501084_0179077 | Ga0501084_0179077_680_1438 | 251 |
| 56 | 3300060353 | Ga0501082_0012631 | Ga0501082_0012631_3797_4555 | 251 |
| 57 | 3300061734 | Ga0530510_0000024 | Ga0530510_0000024_52434_53192 | 251 |
| 58 | 3300009147 | Ga0114129_10007443 | Ga0114129_1000744310 | 252 |
| 59 | 3300035691 | Ga0373931_0196023 | Ga0373931_0196023_289_1065 | 252 |
| 60 | 3300046542 | Ga0495597_0011926 | Ga0495597_0011926_256_1047 | 252 |
| 61 | 3300047443 | Ga0495687_000174 | Ga0495687_000174_85913_86704 | 252 |
| 62 | 3300048091 | Ga0495626_0136050 | Ga0495626_0136050_128_919 | 252 |
| 63 | 3300048907 | Ga0496104_0498048 | Ga0496104_0498048_271_1029 | 252 |
| 64 | 3300048908 | Ga0496105_0040504 | Ga0496105_0040504_505_1275 | 252 |
| 65 | 3300048909 | Ga0496106_0157216 | Ga0496106_0157216_91_849 | 252 |
| 66 | 3300048912 | Ga0496109_0185560 | Ga0496109_0185560_585_1355 | 252 |
| 67 | 3300049570 | Ga0501033_0316274 | Ga0501033_0316274_174_935 | 252 |
| 68 | 3300049581 | Ga0501047_0006481 | Ga0501047_0006481_6579_7340 | 252 |
| 69 | 3300049586 | Ga0501070_0065748 | Ga0501070_0065748_1225_1986 | 252 |
| 70 | 3300049586 | Ga0501070_0159434 | Ga0501070_0159434_70_831 | 252 |
| 71 | 3300049589 | Ga0501073_0331116 | Ga0501073_0331116_280_1041 | 252 |
| 72 | 3300049822 | Ga0501035_0105640 | Ga0501035_0105640_19_780 | 252 |
| 73 | 3300050493 | nmdc:mga0k408_148282_c1 | nmdc:mga0k408_148282_c1_535_1326 | 252 |
| 74 | 3300050507 | nmdc:mga05p37_980_c1 | nmdc:mga05p37_980_c1_23610_24368 | 252 |
| 75 | 3300050508 | nmdc:mga09592_947_c1 | nmdc:mga09592_947_c1_8272_9030 | 252 |
| 76 | 3300050510 | nmdc:mga06r32_2106_c1 | nmdc:mga06r32_2106_c1_8444_9202 | 252 |
| 77 | 3300050510 | nmdc:mga06r32_393827_c1 | nmdc:mga06r32_393827_c1_290_1048 | 252 |
| 78 | iso_pu_bacteria | 2917699015 | 2917701097 | 252 |
| 79 | 3300005406 | Ga0070703_10029468 | Ga0070703_100294682 | 253 |
| 80 | 3300005445 | Ga0070708_100188668 | Ga0070708_1001886682 | 253 |
| 81 | 3300005468 | Ga0070707_100009268 | Ga0070707_1000092683 | 253 |
| 82 | 3300005468 | Ga0070707_100051793 | Ga0070707_1000517935 | 253 |
| 83 | 3300005471 | Ga0070698_100104018 | Ga0070698_1001040184 | 253 |
| 84 | 3300005518 | Ga0070699_100150425 | Ga0070699_1001504253 | 253 |
| 85 | 3300005536 | Ga0070697_100155213 | Ga0070697_1001552132 | 253 |
| 86 | 3300005536 | Ga0070697_100189476 | Ga0070697_1001894762 | 253 |
| 87 | 3300005549 | Ga0070704_100564399 | Ga0070704_1005643991 | 253 |
| 88 | 3300006028 | Ga0070717_10002978 | Ga0070717_100029789 | 253 |
| 89 | 3300025885 | Ga0207653_10050829 | Ga0207653_100508291 | 253 |
| 90 | 3300025910 | Ga0207684_10009615 | Ga0207684_100096153 | 253 |
| 91 | 3300025921 | Ga0207652_10383708 | Ga0207652_103837082 | 253 |
| 92 | 3300025922 | Ga0207646_10004415 | Ga0207646_100044158 | 253 |
| 93 | 3300025922 | Ga0207646_10008771 | Ga0207646_100087717 | 253 |
| 94 | 3300025922 | Ga0207646_10011967 | Ga0207646_100119678 | 253 |
| 95 | 3300042134 | Ga0450898_017083 | Ga0450898_017083_170_1009 | 253 |
| 96 | 3300014497 | Ga0182008_10000057 | Ga0182008_1000005755 | 254 |
| 97 | 3300025929 | Ga0207664_10173970 | Ga0207664_101739702 | 254 |
| 98 | 3300050514 | nmdc:mga08x19_115910_c1 | nmdc:mga08x19_115910_c1_484_1248 | 254 |
| 99 | 3300006175 | Ga0070712_100041731 | Ga0070712_1000417313 | 255 |
| 100 | 3300014325 | Ga0163163_10402264 | Ga0163163_104022642 | 255 |
| 101 | 3300021384 | Ga0213876_10034134 | Ga0213876_100341343 | 255 |
| 102 | 3300021388 | Ga0213875_10151085 | Ga0213875_101510852 | 255 |
| 103 | 3300025915 | Ga0207693_10028490 | Ga0207693_100284904 | 255 |
| 104 | 3300026116 | Ga0207674_10065127 | Ga0207674_100651273 | 255 |
| 105 | 3300035170 | Ga0373943_0028923 | Ga0373943_0028923_695_1465 | 255 |
| 106 | 3300036401 | Ga0373937_0773515 | Ga0373937_0773515_70_843 | 255 |
| 107 | 3300037853 | Ga0436364_0448380 | Ga0436364_0448380_1282_2055 | 255 |
| 108 | 3300037853 | Ga0436364_1070606 | Ga0436364_1070606_64_834 | 255 |
| 109 | 3300038443 | Ga0395901_0069423 | Ga0395901_0069423_2346_3113 | 255 |
| 110 | 3300039437 | Ga0436365_1295484 | Ga0436365_1295484_192_965 | 255 |
| 111 | 3300039438 | Ga0436360_0964426 | Ga0436360_0964426_331_1104 | 255 |
| 112 | 3300039447 | Ga0436361_0670097 | Ga0436361_0670097_206_976 | 255 |
| 113 | 3300046472 | Ga0495580_0261645 | Ga0495580_0261645_216_986 | 255 |
| 114 | 3300046517 | Ga0495630_0088712 | Ga0495630_0088712_114_884 | 255 |
| 115 | 3300046559 | Ga0495667_0326430 | Ga0495667_0326430_138_911 | 255 |
| 116 | 3300046809 | Ga0495600_0287915 | Ga0495600_0287915_231_1004 | 255 |
| 117 | 3300047444 | Ga0495675_0284099 | Ga0495675_0284099_39_812 | 255 |
| 118 | 3300047471 | Ga0495684_0277771 | Ga0495684_0277771_59_832 | 255 |
| 119 | 3300048904 | Ga0496101_0061948 | Ga0496101_0061948_1116_1886 | 255 |
| 120 | 3300048905 | Ga0496102_0027593 | Ga0496102_0027593_2690_3460 | 255 |
| 121 | 3300048907 | Ga0496104_0533919 | Ga0496104_0533919_132_902 | 255 |
| 122 | 3300048908 | Ga0496105_0155266 | Ga0496105_0155266_1068_1838 | 255 |
| 123 | 3300048912 | Ga0496109_0214020 | Ga0496109_0214020_809_1579 | 255 |
| 124 | 3300048915 | Ga0496112_0540589 | Ga0496112_0540589_318_1088 | 255 |
| 125 | 3300050493 | nmdc:mga0k408_63245_c1 | nmdc:mga0k408_63245_c1_56_868 | 255 |
| 126 | 3300053077 | Ga0495601_0224374 | Ga0495601_0224374_59_829 | 255 |
| 127 | 3300053084 | Ga0495595_0056279 | Ga0495595_0056279_841_1614 | 255 |
| 128 | 3300005327 | Ga0070658_10307384 | Ga0070658_103073842 | 256 |
| 129 | 3300005334 | Ga0068869_100017322 | Ga0068869_1000173224 | 256 |
| 130 | 3300005338 | Ga0068868_100110044 | Ga0068868_1001100442 | 256 |
| 131 | 3300005341 | Ga0070691_10096430 | Ga0070691_100964302 | 256 |
| 132 | 3300005356 | Ga0070674_100244026 | Ga0070674_1002440262 | 256 |
| 133 | 3300005364 | Ga0070673_100074784 | Ga0070673_1000747842 | 256 |
| 134 | 3300005459 | Ga0068867_100104542 | Ga0068867_1001045422 | 256 |
| 135 | 3300005548 | Ga0070665_100028109 | Ga0070665_1000281093 | 256 |
| 136 | 3300005549 | Ga0070704_100060877 | Ga0070704_1000608772 | 256 |
| 137 | 3300005563 | Ga0068855_100736919 | Ga0068855_1007369192 | 256 |
| 138 | 3300005614 | Ga0068856_100121853 | Ga0068856_1001218533 | 256 |
| 139 | 3300005617 | Ga0068859_100081859 | Ga0068859_1000818593 | 256 |
| 140 | 3300005618 | Ga0068864_100019005 | Ga0068864_1000190052 | 256 |
| 141 | 3300005719 | Ga0068861_100203621 | Ga0068861_1002036212 | 256 |
| 142 | 3300005840 | Ga0068870_10280646 | Ga0068870_102806461 | 256 |
| 143 | 3300005841 | Ga0068863_100036422 | Ga0068863_1000364223 | 256 |
| 144 | 3300005842 | Ga0068858_100026741 | Ga0068858_1000267412 | 256 |
| 145 | 3300005843 | Ga0068860_100029749 | Ga0068860_1000297495 | 256 |
| 146 | 3300005844 | Ga0068862_100203566 | Ga0068862_1002035661 | 256 |
| 147 | 3300006237 | Ga0097621_100048033 | Ga0097621_1000480333 | 256 |
| 148 | 3300006881 | Ga0068865_100334617 | Ga0068865_1003346171 | 256 |
| 149 | 3300006931 | Ga0097620_100081857 | Ga0097620_1000818573 | 256 |
| 150 | 3300009098 | Ga0105245_10420648 | Ga0105245_104206482 | 256 |
| 151 | 3300009101 | Ga0105247_10070929 | Ga0105247_100709293 | 256 |
| 152 | 3300009176 | Ga0105242_10117572 | Ga0105242_101175722 | 256 |
| 153 | 3300013296 | Ga0157374_10050050 | Ga0157374_100500502 | 256 |
| 154 | 3300013297 | Ga0157378_10201519 | Ga0157378_102015192 | 256 |
| 155 | 3300013308 | Ga0157375_10135257 | Ga0157375_101352572 | 256 |
| 156 | 3300014968 | Ga0157379_10084096 | Ga0157379_100840963 | 256 |
| 157 | 3300014969 | Ga0157376_10016416 | Ga0157376_100164164 | 256 |
| 158 | 3300014969 | Ga0157376_10028875 | Ga0157376_100288752 | 256 |
| 159 | 3300025927 | Ga0207687_10372130 | Ga0207687_103721301 | 256 |
| 160 | 3300025937 | Ga0207669_10117932 | Ga0207669_101179321 | 256 |
| 161 | 3300025938 | Ga0207704_10196429 | Ga0207704_101964292 | 256 |
| 162 | 3300025942 | Ga0207689_10007510 | Ga0207689_100075102 | 256 |
| 163 | 3300025949 | Ga0207667_10206428 | Ga0207667_102064282 | 256 |
| 164 | 3300025960 | Ga0207651_10028252 | Ga0207651_100282522 | 256 |
| 165 | 3300026023 | Ga0207677_10100644 | Ga0207677_101006442 | 256 |
| 166 | 3300026035 | Ga0207703_10031793 | Ga0207703_100317932 | 256 |
| 167 | 3300026078 | Ga0207702_10070769 | Ga0207702_100707693 | 256 |
| 168 | 3300026088 | Ga0207641_10120412 | Ga0207641_101204121 | 256 |
| 169 | 3300026089 | Ga0207648_10075312 | Ga0207648_100753122 | 256 |
| 170 | 3300026089 | Ga0207648_10329754 | Ga0207648_103297542 | 256 |
| 171 | 3300026118 | Ga0207675_100041652 | Ga0207675_1000416522 | 256 |
| 172 | 3300028381 | Ga0268264_10053528 | Ga0268264_100535281 | 256 |
| 173 | 3300031548 | Ga0307408_100480043 | Ga0307408_1004800432 | 256 |
| 174 | 3300037418 | Ga0395900_0024795 | Ga0395900_0024795_70_840 | 256 |
| 175 | 3300037418 | Ga0395900_0392675 | Ga0395900_0392675_293_1063 | 256 |
| 176 | 3300037466 | Ga0395898_0017213 | Ga0395898_0017213_3665_4435 | 256 |
| 177 | 3300037471 | Ga0395905_0001562 | Ga0395905_0001562_19136_19906 | 256 |
| 178 | 3300037471 | Ga0395905_0087967 | Ga0395905_0087967_302_1072 | 256 |
| 179 | 3300037471 | Ga0395905_0230355 | Ga0395905_0230355_195_965 | 256 |
| 180 | 3300038443 | Ga0395901_0024791 | Ga0395901_0024791_1811_2581 | 256 |
| 181 | 3300038443 | Ga0395901_0269744 | Ga0395901_0269744_657_1427 | 256 |
| 182 | 3300046528 | Ga0495642_0023443 | Ga0495642_0023443_1384_2166 | 256 |
| 183 | 3300046665 | Ga0495661_0265790 | Ga0495661_0265790_34_816 | 256 |
| 184 | 3300046674 | Ga0495588_0031332 | Ga0495588_0031332_641_1423 | 256 |
| 185 | 3300049571 | Ga0501034_0118040 | Ga0501034_0118040_1748_2518 | 256 |
| 186 | 3300049580 | Ga0501046_0079051 | Ga0501046_0079051_555_1325 | 256 |
| 187 | 3300049589 | Ga0501073_0078745 | Ga0501073_0078745_687_1457 | 256 |
| 188 | 3300049742 | Ga0501080_0027798 | Ga0501080_0027798_4316_5086 | 256 |
| 189 | 3300049822 | Ga0501035_0025466 | Ga0501035_0025466_703_1473 | 256 |
| 190 | 3300049823 | Ga0501044_0104177 | Ga0501044_0104177_782_1552 | 256 |
| 191 | 3300005327 | Ga0070658_10034455 | Ga0070658_100344554 | 257 |
| 192 | 3300005327 | Ga0070658_10282909 | Ga0070658_102829091 | 257 |
| 193 | 3300005327 | Ga0070658_10407966 | Ga0070658_104079662 | 257 |
| 194 | 3300005339 | Ga0070660_100036521 | Ga0070660_1000365213 | 257 |
| 195 | 3300005367 | Ga0070667_100007601 | Ga0070667_1000076012 | 257 |
| 196 | 3300005435 | Ga0070714_100283884 | Ga0070714_1002838842 | 257 |
| 197 | 3300005441 | Ga0070700_100224607 | Ga0070700_1002246071 | 257 |
| 198 | 3300005458 | Ga0070681_10016104 | Ga0070681_100161043 | 257 |
| 199 | 3300005530 | Ga0070679_100008970 | Ga0070679_1000089705 | 257 |
| 200 | 3300005530 | Ga0070679_100146363 | Ga0070679_1001463632 | 257 |
| 201 | 3300005563 | Ga0068855_100004439 | Ga0068855_10000443917 | 257 |
| 202 | 3300005563 | Ga0068855_100145252 | Ga0068855_1001452522 | 257 |
| 203 | 3300005577 | Ga0068857_100037153 | Ga0068857_1000371533 | 257 |
| 204 | 3300005615 | Ga0070702_100084168 | Ga0070702_1000841683 | 257 |
| 205 | 3300005718 | Ga0068866_10025670 | Ga0068866_100256703 | 257 |
| 206 | 3300005842 | Ga0068858_100061196 | Ga0068858_1000611963 | 257 |
| 207 | 3300005843 | Ga0068860_100159542 | Ga0068860_1001595422 | 257 |
| 208 | 3300006195 | Ga0075366_10000633 | Ga0075366_100006338 | 257 |
| 209 | 3300006195 | Ga0075366_10030651 | Ga0075366_100306512 | 257 |
| 210 | 3300006195 | Ga0075366_10064742 | Ga0075366_100647422 | 257 |
| 211 | 3300007076 | Ga0075435_100001341 | Ga0075435_1000013413 | 257 |
| 212 | 3300009093 | Ga0105240_10031668 | Ga0105240_100316685 | 257 |
| 213 | 3300009098 | Ga0105245_10047244 | Ga0105245_100472444 | 257 |
| 214 | 3300009148 | Ga0105243_10030887 | Ga0105243_100308873 | 257 |
| 215 | 3300009148 | Ga0105243_10130133 | Ga0105243_101301332 | 257 |
| 216 | 3300009174 | Ga0105241_10613204 | Ga0105241_106132041 | 257 |
| 217 | 3300009551 | Ga0105238_10030346 | Ga0105238_100303466 | 257 |
| 218 | 3300013296 | Ga0157374_10303774 | Ga0157374_103037742 | 257 |
| 219 | 3300013308 | Ga0157375_10461385 | Ga0157375_104613851 | 257 |
| 220 | 3300014968 | Ga0157379_10203363 | Ga0157379_102033632 | 257 |
| 221 | 3300014968 | Ga0157379_10328619 | Ga0157379_103286192 | 257 |
| 222 | 3300025901 | Ga0207688_10074308 | Ga0207688_100743082 | 257 |
| 223 | 3300025907 | Ga0207645_10097740 | Ga0207645_100977402 | 257 |
| 224 | 3300025909 | Ga0207705_10027375 | Ga0207705_100273755 | 257 |
| 225 | 3300025909 | Ga0207705_10230280 | Ga0207705_102302802 | 257 |
| 226 | 3300025909 | Ga0207705_10235817 | Ga0207705_102358171 | 257 |
| 227 | 3300025913 | Ga0207695_10060434 | Ga0207695_100604344 | 257 |
| 228 | 3300025914 | Ga0207671_10019856 | Ga0207671_100198562 | 257 |
| 229 | 3300025919 | Ga0207657_10045873 | Ga0207657_100458734 | 257 |
| 230 | 3300025921 | Ga0207652_10096073 | Ga0207652_100960733 | 257 |
| 231 | 3300025927 | Ga0207687_10130250 | Ga0207687_101302502 | 257 |
| 232 | 3300025929 | Ga0207664_10386367 | Ga0207664_103863671 | 257 |
| 233 | 3300025935 | Ga0207709_10234822 | Ga0207709_102348221 | 257 |
| 234 | 3300025937 | Ga0207669_10275419 | Ga0207669_102754192 | 257 |
| 235 | 3300025942 | Ga0207689_10073455 | Ga0207689_100734552 | 257 |
| 236 | 3300025949 | Ga0207667_10208201 | Ga0207667_102082011 | 257 |
| 237 | 3300025949 | Ga0207667_10366929 | Ga0207667_103669292 | 257 |
| 238 | 3300026035 | Ga0207703_10194450 | Ga0207703_101944502 | 257 |
| 239 | 3300026041 | Ga0207639_10156859 | Ga0207639_101568592 | 257 |
| 240 | 3300026075 | Ga0207708_10031092 | Ga0207708_100310923 | 257 |
| 241 | 3300026089 | Ga0207648_10017778 | Ga0207648_100177785 | 257 |
| 242 | 3300026116 | Ga0207674_10006174 | Ga0207674_100061748 | 257 |
| 243 | 3300028380 | Ga0268265_10166724 | Ga0268265_101667241 | 257 |
| 244 | 3300028381 | Ga0268264_10357694 | Ga0268264_103576941 | 257 |
| 245 | 3300031711 | Ga0265314_10020787 | Ga0265314_100207873 | 257 |
| 246 | 3300031711 | Ga0265314_10039722 | Ga0265314_100397222 | 257 |
| 247 | 3300031712 | Ga0265342_10032558 | Ga0265342_100325584 | 257 |
| 248 | 3300031712 | Ga0265342_10068057 | Ga0265342_100680573 | 257 |
| 249 | 3300031730 | Ga0307516_10014503 | Ga0307516_100145036 | 257 |
| 250 | 3300035120 | Ga0373957_0056246 | Ga0373957_0056246_617_1396 | 257 |
| 251 | 3300035410 | Ga0373924_0003359 | Ga0373924_0003359_1894_2673 | 257 |
| 252 | 3300035724 | Ga0373933_0002353 | Ga0373933_0002353_4504_5283 | 257 |
| 253 | 3300036401 | Ga0373937_0003134 | Ga0373937_0003134_3031_3810 | 257 |
| 254 | 3300037466 | Ga0395898_0050626 | Ga0395898_0050626_227_1012 | 257 |
| 255 | 3300037471 | Ga0395905_0000180 | Ga0395905_0000180_97130_97903 | 257 |
| 256 | 3300037471 | Ga0395905_0153818 | Ga0395905_0153818_401_1174 | 257 |
| 257 | 3300037471 | Ga0395905_0210323 | Ga0395905_0210323_910_1695 | 257 |
| 258 | 3300038443 | Ga0395901_0151258 | Ga0395901_0151258_1236_2021 | 257 |
| 259 | 3300038443 | Ga0395901_0327505 | Ga0395901_0327505_527_1309 | 257 |
| 260 | 3300038443 | Ga0395901_0416674 | Ga0395901_0416674_223_1002 | 257 |
| 261 | 3300039447 | Ga0436361_0213696 | Ga0436361_0213696_386_1243 | 257 |
| 262 | 3300042435 | Ga0439434_0004891 | Ga0439434_0004891_2205_2990 | 257 |
| 263 | 3300042436 | Ga0439435_0000049 | Ga0439435_0000049_764_1549 | 257 |
| 264 | 3300042876 | Ga0451577_0679033 | Ga0451577_0679033_24_806 | 257 |
| 265 | 3300044656 | Ga0466969_0015338 | Ga0466969_0015338_3011_3784 | 257 |
| 266 | 3300044684 | Ga0466966_0003903 | Ga0466966_0003903_4920_5693 | 257 |
| 267 | 3300044706 | Ga0466964_0202035 | Ga0466964_0202035_41_814 | 257 |
| 268 | 3300044765 | Ga0466970_0185710 | Ga0466970_0185710_263_1036 | 257 |
| 269 | 3300045049 | Ga0466959_0008562 | Ga0466959_0008562_5295_6068 | 257 |
| 270 | 3300046463 | Ga0495653_0169056 | Ga0495653_0169056_443_1222 | 257 |
| 271 | 3300046463 | Ga0495653_0337828 | Ga0495653_0337828_22_795 | 257 |
| 272 | 3300046539 | Ga0495621_0015071 | Ga0495621_0015071_589_1512 | 257 |
| 273 | 3300046615 | Ga0495656_0000163 | Ga0495656_0000163_6522_7445 | 257 |
| 274 | 3300046660 | Ga0495625_0056474 | Ga0495625_0056474_46_987 | 257 |
| 275 | 3300046663 | Ga0495635_0193792 | Ga0495635_0193792_529_1308 | 257 |
| 276 | 3300046691 | Ga0495670_0154673 | Ga0495670_0154673_33_956 | 257 |
| 277 | 3300048090 | Ga0495615_0002109 | Ga0495615_0002109_142_1065 | 257 |
| 278 | 3300050489 | nmdc:mga03683_14888_c1 | nmdc:mga03683_14888_c1_81_989 | 257 |
| 279 | 3300050489 | nmdc:mga03683_88628_c1 | nmdc:mga03683_88628_c1_416_1219 | 257 |
| 280 | 3300050493 | nmdc:mga0k408_11155_c1 | nmdc:mga0k408_11155_c1_4029_4844 | 257 |
| 281 | 3300050493 | nmdc:mga0k408_178433_c1 | nmdc:mga0k408_178433_c1_173_1081 | 257 |
| 282 | 3300050493 | nmdc:mga0k408_2967_c1 | nmdc:mga0k408_2967_c1_3947_4750 | 257 |
| 283 | 3300050496 | nmdc:mga07m45_132261_c1 | nmdc:mga07m45_132261_c1_269_1177 | 257 |
| 284 | 3300050513 | nmdc:mga0rr50_26750_c1 | nmdc:mga0rr50_26750_c1_1472_2248 | 257 |
| 285 | 3300005334 | Ga0068869_100282207 | Ga0068869_1002822072 | 258 |
| 286 | 3300005435 | Ga0070714_100083363 | Ga0070714_1000833631 | 258 |
| 287 | 3300005444 | Ga0070694_100005593 | Ga0070694_1000055933 | 258 |
| 288 | 3300005545 | Ga0070695_100070207 | Ga0070695_1000702072 | 258 |
| 289 | 3300005546 | Ga0070696_100028084 | Ga0070696_1000280844 | 258 |
| 290 | 3300005549 | Ga0070704_100106303 | Ga0070704_1001063032 | 258 |
| 291 | 3300006173 | Ga0070716_100136160 | Ga0070716_1001361602 | 258 |
| 292 | 3300006353 | Ga0075370_10002412 | Ga0075370_100024122 | 258 |
| 293 | 3300006844 | Ga0075428_100061243 | Ga0075428_1000612432 | 258 |
| 294 | 3300006847 | Ga0075431_100309852 | Ga0075431_1003098522 | 258 |
| 295 | 3300010375 | Ga0105239_11158724 | Ga0105239_111587241 | 258 |
| 296 | 3300025929 | Ga0207664_10533396 | Ga0207664_105333962 | 258 |
| 297 | 3300025961 | Ga0207712_10557531 | Ga0207712_105575311 | 258 |
| 298 | 3300027665 | Ga0209983_1013262 | Ga0209983_10132622 | 258 |
| 299 | 3300028794 | Ga0307515_10072864 | Ga0307515_100728643 | 258 |
| 300 | 3300031456 | Ga0307513_10001376 | Ga0307513_1000137637 | 258 |
| 301 | 3300031456 | Ga0307513_10026911 | Ga0307513_100269113 | 258 |
| 302 | 3300042876 | Ga0451577_0003923 | Ga0451577_0003923_5322_6107 | 258 |
| 303 | 3300044712 | Ga0453684_0114391 | Ga0453684_0114391_306_1091 | 258 |
| 304 | 3300044901 | Ga0466960_0036523 | Ga0466960_0036523_714_1505 | 258 |
| 305 | 3300048905 | Ga0496102_0101591 | Ga0496102_0101591_1657_2463 | 258 |
| 306 | 3300049588 | Ga0501072_0122300 | Ga0501072_0122300_184_960 | 258 |
| 307 | 3300049588 | Ga0501072_0287700 | Ga0501072_0287700_221_1087 | 258 |
| 308 | 3300049743 | Ga0501081_0147609 | Ga0501081_0147609_314_1096 | 258 |
| 309 | 3300050490 | nmdc:mga03n38_193261_c1 | nmdc:mga03n38_193261_c1_29_814 | 258 |
| 310 | 3300050496 | nmdc:mga07m45_5562_c1 | nmdc:mga07m45_5562_c1_217_1002 | 258 |
| 311 | 3300050509 | nmdc:mga0qj67_705_c1 | nmdc:mga0qj67_705_c1_21524_22306 | 258 |
| 312 | 3300050510 | nmdc:mga06r32_210852_c1 | nmdc:mga06r32_210852_c1_367_1149 | 258 |
| 313 | 3300005329 | Ga0070683_100340063 | Ga0070683_1003400631 | 259 |
| 314 | 3300005457 | Ga0070662_100076893 | Ga0070662_1000768932 | 259 |
| 315 | 3300005471 | Ga0070698_100014017 | Ga0070698_1000140172 | 259 |
| 316 | 3300005518 | Ga0070699_100056960 | Ga0070699_1000569603 | 259 |
| 317 | 3300005536 | Ga0070697_100005701 | Ga0070697_1000057019 | 259 |
| 318 | 3300005544 | Ga0070686_100538282 | Ga0070686_1005382821 | 259 |
| 319 | 3300005546 | Ga0070696_100009913 | Ga0070696_1000099135 | 259 |
| 320 | 3300005549 | Ga0070704_100002583 | Ga0070704_1000025838 | 259 |
| 321 | 3300005549 | Ga0070704_100109550 | Ga0070704_1001095503 | 259 |
| 322 | 3300005549 | Ga0070704_100468507 | Ga0070704_1004685072 | 259 |
| 323 | 3300005719 | Ga0068861_100134711 | Ga0068861_1001347112 | 259 |
| 324 | 3300005844 | Ga0068862_100213431 | Ga0068862_1002134312 | 259 |
| 325 | 3300006038 | Ga0075365_10086770 | Ga0075365_100867703 | 259 |
| 326 | 3300006042 | Ga0075368_10013459 | Ga0075368_100134593 | 259 |
| 327 | 3300006048 | Ga0075363_100019885 | Ga0075363_1000198852 | 259 |
| 328 | 3300006178 | Ga0075367_10080579 | Ga0075367_100805792 | 259 |
| 329 | 3300006844 | Ga0075428_100128960 | Ga0075428_1001289602 | 259 |
| 330 | 3300006871 | Ga0075434_100000132 | Ga0075434_1000001326 | 259 |
| 331 | 3300006880 | Ga0075429_100000638 | Ga0075429_10000063818 | 259 |
| 332 | 3300006880 | Ga0075429_100135451 | Ga0075429_1001354512 | 259 |
| 333 | 3300007076 | Ga0075435_100006450 | Ga0075435_1000064507 | 259 |
| 334 | 3300007076 | Ga0075435_100383464 | Ga0075435_1003834641 | 259 |
| 335 | 3300007265 | Ga0099794_10004485 | Ga0099794_100044855 | 259 |
| 336 | 3300009098 | Ga0105245_10082487 | Ga0105245_100824873 | 259 |
| 337 | 3300009147 | Ga0114129_10015516 | Ga0114129_100155163 | 259 |
| 338 | 3300009147 | Ga0114129_10707650 | Ga0114129_107076501 | 259 |
| 339 | 3300009553 | Ga0105249_10074689 | Ga0105249_100746891 | 259 |
| 340 | 3300013307 | Ga0157372_10079010 | Ga0157372_100790102 | 259 |
| 341 | 3300014325 | Ga0163163_10638938 | Ga0163163_106389381 | 259 |
| 342 | 3300014326 | Ga0157380_10135584 | Ga0157380_101355842 | 259 |
| 343 | 3300025933 | Ga0207706_10079522 | Ga0207706_100795222 | 259 |
| 344 | 3300025942 | Ga0207689_10136195 | Ga0207689_101361952 | 259 |
| 345 | 3300025944 | Ga0207661_10458954 | Ga0207661_104589542 | 259 |
| 346 | 3300025961 | Ga0207712_10041781 | Ga0207712_100417814 | 259 |
| 347 | 3300026118 | Ga0207675_100135758 | Ga0207675_1001357581 | 259 |
| 348 | 3300027471 | Ga0209995_1023511 | Ga0209995_10235112 | 259 |
| 349 | 3300027543 | Ga0209999_1000946 | Ga0209999_10009462 | 259 |
| 350 | 3300028379 | Ga0268266_10132081 | Ga0268266_101320813 | 259 |
| 351 | 3300031242 | Ga0265329_10043310 | Ga0265329_100433102 | 259 |
| 352 | 3300042876 | Ga0451577_0139425 | Ga0451577_0139425_745_1557 | 259 |
| 353 | 3300044712 | Ga0453684_0140881 | Ga0453684_0140881_1169_1981 | 259 |
| 354 | 3300046684 | Ga0495669_0082404 | Ga0495669_0082404_509_1357 | 259 |
| 355 | 3300047317 | Ga0495604_0132267 | Ga0495604_0132267_764_1612 | 259 |
| 356 | 3300048908 | Ga0496105_0293714 | Ga0496105_0293714_410_1258 | 259 |
| 357 | 3300048913 | Ga0496110_0124275 | Ga0496110_0124275_354_1202 | 259 |
| 358 | 3300048914 | Ga0496111_0148736 | Ga0496111_0148736_144_992 | 259 |
| 359 | 3300049585 | Ga0501069_0119348 | Ga0501069_0119348_246_1028 | 259 |
| 360 | 3300050492 | nmdc:mga0yw44_70861_c1 | nmdc:mga0yw44_70861_c1_1101_1949 | 259 |
| 361 | 3300050494 | nmdc:mga06z11_85826_c1 | nmdc:mga06z11_85826_c1_213_1061 | 259 |
| 362 | 3300050496 | nmdc:mga07m45_298073_c1 | nmdc:mga07m45_298073_c1_69_917 | 259 |
| 363 | 3300050507 | nmdc:mga05p37_21838_c1 | nmdc:mga05p37_21838_c1_4610_5392 | 259 |
| 364 | 3300050508 | nmdc:mga09592_136871_c1 | nmdc:mga09592_136871_c1_503_1285 | 259 |
| 365 | 3300050512 | nmdc:mga0n895_393151_c1 | nmdc:mga0n895_393151_c1_584_1363 | 259 |
| 366 | 3300050512 | nmdc:mga0n895_698018_c1 | nmdc:mga0n895_698018_c1_154_936 | 259 |
| 367 | 3300050513 | nmdc:mga0rr50_475609_c1 | nmdc:mga0rr50_475609_c1_237_1019 | 259 |
| 368 | 3300050513 | nmdc:mga0rr50_65593_c1 | nmdc:mga0rr50_65593_c1_136_915 | 259 |
| 369 | 3300050514 | nmdc:mga08x19_15018_c1 | nmdc:mga08x19_15018_c1_3044_3826 | 259 |
| 370 | 3300053077 | Ga0495601_0026917 | Ga0495601_0026917_866_1714 | 259 |
| 371 | iso_pu_bacteria | 2512047030 | 2512352318 | 259 |
| 372 | iso_pu_bacteria | 2513020051 | 2513229603 | 259 |
| 373 | 3300006038 | Ga0075365_10017503 | Ga0075365_100175032 | 260 |
| 374 | 3300031595 | Ga0265313_10000007 | Ga0265313_1000000715 | 260 |
| 375 | 3300039447 | Ga0436361_1140218 | Ga0436361_1140218_1501_2304 | 260 |
| 376 | 3300049575 | Ga0501039_0085997 | Ga0501039_0085997_226_1047 | 260 |
| 377 | 3300049581 | Ga0501047_0114524 | Ga0501047_0114524_417_1235 | 260 |
| 378 | 3300049743 | Ga0501081_0398076 | Ga0501081_0398076_157_978 | 260 |
| 379 | 3300049744 | Ga0501083_0054146 | Ga0501083_0054146_1410_2234 | 260 |
| 380 | 3300050492 | nmdc:mga0yw44_56202_c1 | nmdc:mga0yw44_56202_c1_711_1520 | 260 |
| 381 | 3300060353 | Ga0501082_0000013 | Ga0501082_0000013_100486_101310 | 260 |
| 382 | 3300006847 | Ga0075431_100701064 | Ga0075431_1007010641 | 261 |
| 383 | 3300035172 | Ga0373955_0004531 | Ga0373955_0004531_2924_3751 | 261 |
| 384 | 3300036401 | Ga0373937_0055911 | Ga0373937_0055911_1356_2183 | 261 |
| 385 | 3300048929 | Ga0496126_0061462 | Ga0496126_0061462_2129_2965 | 261 |
| 386 | 3300049570 | Ga0501033_0054334 | Ga0501033_0054334_1376_2215 | 261 |
| 387 | 3300049571 | Ga0501034_0101591 | Ga0501034_0101591_990_1817 | 261 |
| 388 | 3300049572 | Ga0501036_0025927 | Ga0501036_0025927_2230_3069 | 261 |
| 389 | 3300049572 | Ga0501036_0097383 | Ga0501036_0097383_1544_2383 | 261 |
| 390 | 3300049574 | Ga0501038_0020071 | Ga0501038_0020071_2421_3248 | 261 |
| 391 | 3300049574 | Ga0501038_0083616 | Ga0501038_0083616_234_1061 | 261 |
| 392 | 3300049574 | Ga0501038_0103088 | Ga0501038_0103088_590_1429 | 261 |
| 393 | 3300049575 | Ga0501039_0033134 | Ga0501039_0033134_1889_2716 | 261 |
| 394 | 3300049579 | Ga0501043_0001183 | Ga0501043_0001183_14772_15611 | 261 |
| 395 | 3300049579 | Ga0501043_0005068 | Ga0501043_0005068_6664_7491 | 261 |
| 396 | 3300049579 | Ga0501043_0005128 | Ga0501043_0005128_3974_4813 | 261 |
| 397 | 3300049579 | Ga0501043_0049809 | Ga0501043_0049809_1816_2643 | 261 |
| 398 | 3300049579 | Ga0501043_0082393 | Ga0501043_0082393_456_1283 | 261 |
| 399 | 3300049580 | Ga0501046_0072755 | Ga0501046_0072755_1611_2438 | 261 |
| 400 | 3300049580 | Ga0501046_0154325 | Ga0501046_0154325_195_1034 | 261 |
| 401 | 3300049581 | Ga0501047_0000363 | Ga0501047_0000363_25585_26424 | 261 |
| 402 | 3300049581 | Ga0501047_0065184 | Ga0501047_0065184_2645_3472 | 261 |
| 403 | 3300049581 | Ga0501047_0093289 | Ga0501047_0093289_1393_2220 | 261 |
| 404 | 3300049581 | Ga0501047_0207716 | Ga0501047_0207716_920_1759 | 261 |
| 405 | 3300049583 | Ga0501067_0095181 | Ga0501067_0095181_736_1563 | 261 |
| 406 | 3300049584 | Ga0501068_0027028 | Ga0501068_0027028_877_1716 | 261 |
| 407 | 3300049585 | Ga0501069_0082267 | Ga0501069_0082267_317_1156 | 261 |
| 408 | 3300049586 | Ga0501070_0015722 | Ga0501070_0015722_935_1774 | 261 |
| 409 | 3300049586 | Ga0501070_0050177 | Ga0501070_0050177_1119_1946 | 261 |
| 410 | 3300049586 | Ga0501070_0088225 | Ga0501070_0088225_1320_2159 | 261 |
| 411 | 3300049586 | Ga0501070_0173877 | Ga0501070_0173877_308_1135 | 261 |
| 412 | 3300049588 | Ga0501072_0090486 | Ga0501072_0090486_209_1036 | 261 |
| 413 | 3300049588 | Ga0501072_0198083 | Ga0501072_0198083_738_1577 | 261 |
| 414 | 3300049589 | Ga0501073_0026703 | Ga0501073_0026703_2424_3263 | 261 |
| 415 | 3300049590 | Ga0501074_0006091 | Ga0501074_0006091_4298_5137 | 261 |
| 416 | 3300049590 | Ga0501074_0008422 | Ga0501074_0008422_988_1827 | 261 |
| 417 | 3300049592 | Ga0501076_0187614 | Ga0501076_0187614_539_1366 | 261 |
| 418 | 3300049741 | Ga0501079_0019020 | Ga0501079_0019020_738_1577 | 261 |
| 419 | 3300049742 | Ga0501080_0000279 | Ga0501080_0000279_27424_28263 | 261 |
| 420 | 3300049742 | Ga0501080_0448674 | Ga0501080_0448674_283_1110 | 261 |
| 421 | 3300049743 | Ga0501081_0308044 | Ga0501081_0308044_243_1070 | 261 |
| 422 | 3300049744 | Ga0501083_0000567 | Ga0501083_0000567_11067_11906 | 261 |
| 423 | 3300049744 | Ga0501083_0050253 | Ga0501083_0050253_1079_1906 | 261 |
| 424 | 3300049744 | Ga0501083_0103885 | Ga0501083_0103885_360_1187 | 261 |
| 425 | 3300049822 | Ga0501035_0017995 | Ga0501035_0017995_5442_6281 | 261 |
| 426 | 3300049822 | Ga0501035_0080034 | Ga0501035_0080034_869_1696 | 261 |
| 427 | 3300049823 | Ga0501044_0001849 | Ga0501044_0001849_15320_16159 | 261 |
| 428 | 3300049823 | Ga0501044_0108878 | Ga0501044_0108878_395_1222 | 261 |
| 429 | 3300049823 | Ga0501044_0183746 | Ga0501044_0183746_47_874 | 261 |
| 430 | 3300049824 | Ga0501045_0314498 | Ga0501045_0314498_221_1060 | 261 |
| 431 | 3300050491 | nmdc:mga00v17_349361_c1 | nmdc:mga00v17_349361_c1_68_895 | 261 |
| 432 | 3300053084 | Ga0495595_0026874 | Ga0495595_0026874_730_1557 | 261 |
| 433 | 3300053085 | Ga0495619_0022146 | Ga0495619_0022146_2984_3811 | 261 |
| 434 | 3300053125 | Ga0500618_012879 | Ga0500618_012879_910_1707 | 261 |
| 435 | 3300054114 | Ga0501084_0125361 | Ga0501084_0125361_633_1472 | 261 |
| 436 | 3300054114 | Ga0501084_0468826 | Ga0501084_0468826_49_876 | 261 |
| 437 | iso_pu_bacteria | 2643221683 | 2644466703 | 261 |
| 438 | 3300031247 | Ga0265340_10056503 | Ga0265340_100565032 | 262 |
| 439 | 3300042115 | Ga0450911_000599 | Ga0450911_000599_9264_10070 | 262 |
| 440 | 3300048924 | Ga0496121_0002968 | Ga0496121_0002968_20483_21289 | 262 |
| 441 | 3300048928 | Ga0496125_0026075 | Ga0496125_0026075_458_1264 | 262 |
| 442 | 3300048928 | Ga0496125_0047579 | Ga0496125_0047579_446_1252 | 262 |
| 443 | 3300048929 | Ga0496126_0277110 | Ga0496126_0277110_201_1007 | 262 |
| 444 | 3300050489 | nmdc:mga03683_59256_c1 | nmdc:mga03683_59256_c1_84_938 | 262 |
| 445 | 3300005330 | Ga0070690_100022845 | Ga0070690_1000228452 | 263 |
| 446 | 3300005334 | Ga0068869_100009111 | Ga0068869_1000091114 | 263 |
| 447 | 3300005337 | Ga0070682_100153645 | Ga0070682_1001536452 | 263 |
| 448 | 3300005338 | Ga0068868_100225946 | Ga0068868_1002259462 | 263 |
| 449 | 3300005340 | Ga0070689_100004177 | Ga0070689_1000041777 | 263 |
| 450 | 3300005341 | Ga0070691_10028383 | Ga0070691_100283832 | 263 |
| 451 | 3300005356 | Ga0070674_100100286 | Ga0070674_1001002862 | 263 |
| 452 | 3300005438 | Ga0070701_10000991 | Ga0070701_1000099110 | 263 |
| 453 | 3300005441 | Ga0070700_100015782 | Ga0070700_1000157822 | 263 |
| 454 | 3300005459 | Ga0068867_100008427 | Ga0068867_1000084272 | 263 |
| 455 | 3300005544 | Ga0070686_100000247 | Ga0070686_10000024726 | 263 |
| 456 | 3300005546 | Ga0070696_100037206 | Ga0070696_1000372062 | 263 |
| 457 | 3300005547 | Ga0070693_100004863 | Ga0070693_1000048634 | 263 |
| 458 | 3300005549 | Ga0070704_100042182 | Ga0070704_1000421823 | 263 |
| 459 | 3300005549 | Ga0070704_100145376 | Ga0070704_1001453762 | 263 |
| 460 | 3300005615 | Ga0070702_100006616 | Ga0070702_1000066163 | 263 |
| 461 | 3300005617 | Ga0068859_100069457 | Ga0068859_1000694572 | 263 |
| 462 | 3300005718 | Ga0068866_10001059 | Ga0068866_100010599 | 263 |
| 463 | 3300005719 | Ga0068861_100069416 | Ga0068861_1000694163 | 263 |
| 464 | 3300005840 | Ga0068870_10013493 | Ga0068870_100134934 | 263 |
| 465 | 3300005843 | Ga0068860_100046184 | Ga0068860_1000461842 | 263 |
| 466 | 3300005844 | Ga0068862_100008109 | Ga0068862_1000081097 | 263 |
| 467 | 3300006237 | Ga0097621_100014666 | Ga0097621_1000146664 | 263 |
| 468 | 3300006358 | Ga0068871_100008295 | Ga0068871_1000082954 | 263 |
| 469 | 3300006881 | Ga0068865_100001393 | Ga0068865_10000139311 | 263 |
| 470 | 3300006931 | Ga0097620_100069458 | Ga0097620_1000694582 | 263 |
| 471 | 3300009098 | Ga0105245_10019196 | Ga0105245_100191964 | 263 |
| 472 | 3300009148 | Ga0105243_10001129 | Ga0105243_100011299 | 263 |
| 473 | 3300009148 | Ga0105243_10055682 | Ga0105243_100556822 | 263 |
| 474 | 3300009174 | Ga0105241_10148319 | Ga0105241_101483192 | 263 |
| 475 | 3300009176 | Ga0105242_10003998 | Ga0105242_100039983 | 263 |
| 476 | 3300009177 | Ga0105248_10050176 | Ga0105248_100501763 | 263 |
| 477 | 3300009553 | Ga0105249_10019624 | Ga0105249_100196244 | 263 |
| 478 | 3300011119 | Ga0105246_10647558 | Ga0105246_106475581 | 263 |
| 479 | 3300013297 | Ga0157378_10001828 | Ga0157378_1000182810 | 263 |
| 480 | 3300013308 | Ga0157375_10396034 | Ga0157375_103960342 | 263 |
| 481 | 3300014968 | Ga0157379_10014502 | Ga0157379_100145024 | 263 |
| 482 | 3300014969 | Ga0157376_10127060 | Ga0157376_101270602 | 263 |
| 483 | 3300017792 | Ga0163161_10104436 | Ga0163161_101044362 | 263 |
| 484 | 3300025899 | Ga0207642_10001218 | Ga0207642_100012183 | 263 |
| 485 | 3300025908 | Ga0207643_10021144 | Ga0207643_100211443 | 263 |
| 486 | 3300025925 | Ga0207650_10204212 | Ga0207650_102042122 | 263 |
| 487 | 3300025927 | Ga0207687_10013443 | Ga0207687_100134433 | 263 |
| 488 | 3300025935 | Ga0207709_10090791 | Ga0207709_100907911 | 263 |
| 489 | 3300025935 | Ga0207709_10095580 | Ga0207709_100955802 | 263 |
| 490 | 3300025936 | Ga0207670_10122254 | Ga0207670_101222541 | 263 |
| 491 | 3300025942 | Ga0207689_10000673 | Ga0207689_100006739 | 263 |
| 492 | 3300026035 | Ga0207703_10004160 | Ga0207703_100041609 | 263 |
| 493 | 3300026075 | Ga0207708_10000998 | Ga0207708_1000099810 | 263 |
| 494 | 3300026075 | Ga0207708_10003798 | Ga0207708_100037989 | 263 |
| 495 | 3300026089 | Ga0207648_10001170 | Ga0207648_1000117017 | 263 |
| 496 | 3300026118 | Ga0207675_100000583 | Ga0207675_10000058319 | 263 |
| 497 | 3300028380 | Ga0268265_10005090 | Ga0268265_100050905 | 263 |
| 498 | 3300028381 | Ga0268264_10188658 | Ga0268264_101886582 | 263 |
| 499 | 3300031548 | Ga0307408_100667485 | Ga0307408_1006674851 | 263 |
| 500 | 3300046471 | Ga0495650_0039724 | Ga0495650_0039724_874_1677 | 263 |
| 501 | 3300046539 | Ga0495621_0010736 | Ga0495621_0010736_1866_2672 | 263 |
| 502 | 3300048912 | Ga0496109_0080718 | Ga0496109_0080718_191_997 | 263 |
| 503 | 3300048928 | Ga0496125_0004911 | Ga0496125_0004911_10953_11756 | 263 |
| 504 | iso_pu_bacteria | 2643221628 | 2644159760 | 263 |
| 505 | 3300005459 | Ga0068867_100034633 | Ga0068867_1000346331 | 264 |
| 506 | 3300006038 | Ga0075365_10130700 | Ga0075365_101307002 | 264 |
| 507 | 3300006177 | Ga0075362_10046452 | Ga0075362_100464522 | 264 |
| 508 | 3300006177 | Ga0075362_10102155 | Ga0075362_101021552 | 264 |
| 509 | 3300006178 | Ga0075367_10009549 | Ga0075367_100095492 | 264 |
| 510 | 3300006195 | Ga0075366_10032938 | Ga0075366_100329383 | 264 |
| 511 | 3300025907 | Ga0207645_10045172 | Ga0207645_100451722 | 264 |
| 512 | 3300025942 | Ga0207689_10177754 | Ga0207689_101777542 | 264 |
| 513 | 3300026089 | Ga0207648_10018068 | Ga0207648_100180685 | 264 |
| 514 | 3300028794 | Ga0307515_10000014 | Ga0307515_10000014311 | 264 |
| 515 | 3300031241 | Ga0265325_10063097 | Ga0265325_100630972 | 264 |
| 516 | 3300041404 | Ga0439436_0007642 | Ga0439436_0007642_975_1775 | 264 |
| 517 | 3300041406 | Ga0439439_0037914 | Ga0439439_0037914_59_859 | 264 |
| 518 | 3300041407 | Ga0439447_017604 | Ga0439447_017604_1007_1807 | 264 |
| 519 | 3300041411 | Ga0439466_0026535 | Ga0439466_0026535_962_1762 | 264 |
| 520 | 3300041413 | Ga0439465_0003028 | Ga0439465_0003028_3127_3927 | 264 |
| 521 | 3300041999 | Ga0439433_0001968 | Ga0439433_0001968_139_939 | 264 |
| 522 | 3300042004 | Ga0439445_0000586 | Ga0439445_0000586_1555_2355 | 264 |
| 523 | 3300042007 | Ga0439449_0008794 | Ga0439449_0008794_2504_3304 | 264 |
| 524 | 3300042010 | Ga0439452_002437 | Ga0439452_002437_3161_3961 | 264 |
| 525 | 3300042014 | Ga0439457_004343 | Ga0439457_004343_329_1129 | 264 |
| 526 | 3300042015 | Ga0439462_0000724 | Ga0439462_0000724_3499_4299 | 264 |
| 527 | 3300042156 | Ga0439446_0026452 | Ga0439446_0026452_603_1403 | 264 |
| 528 | 3300050494 | nmdc:mga06z11_67391_c1 | nmdc:mga06z11_67391_c1_857_1657 | 264 |
| 529 | 3300050496 | nmdc:mga07m45_8395_c1 | nmdc:mga07m45_8395_c1_238_1038 | 264 |
| 530 | 3300003781 | Ga0055536_1000313 | Ga0055536_10003133 | 265 |
| 531 | 3300003784 | Ga0055534_1003181 | Ga0055534_10031814 | 265 |
| 532 | 3300003792 | Ga0055540_1001615 | Ga0055540_10016154 | 265 |
| 533 | 3300009148 | Ga0105243_10000293 | Ga0105243_1000029310 | 265 |
| 534 | 3300009545 | Ga0105237_10060650 | Ga0105237_100606504 | 265 |
| 535 | 3300025284 | Ga0209130_1001720 | Ga0209130_100172013 | 265 |
| 536 | 3300025291 | Ga0209675_1002415 | Ga0209675_10024155 | 265 |
| 537 | 3300025292 | Ga0209676_1000267 | Ga0209676_100026733 | 265 |
| 538 | 3300025292 | Ga0209676_1006250 | Ga0209676_10062503 | 265 |
| 539 | 3300025298 | Ga0209050_1009624 | Ga0209050_10096244 | 265 |
| 540 | 3300025298 | Ga0209050_1015410 | Ga0209050_10154103 | 265 |
| 541 | 3300025303 | Ga0209051_1000230 | Ga0209051_100023060 | 265 |
| 542 | 3300025303 | Ga0209051_1005092 | Ga0209051_10050924 | 265 |
| 543 | 3300025304 | Ga0209257_1004695 | Ga0209257_10046954 | 265 |
| 544 | 3300025304 | Ga0209257_1005713 | Ga0209257_10057134 | 265 |
| 545 | 3300025913 | Ga0207695_10067326 | Ga0207695_100673263 | 265 |
| 546 | 3300025914 | Ga0207671_10037914 | Ga0207671_100379144 | 265 |
| 547 | 3300025935 | Ga0207709_10000076 | Ga0207709_1000007671 | 265 |
| 548 | 3300031731 | Ga0307405_10046349 | Ga0307405_100463492 | 265 |
| 549 | 3300032005 | Ga0307411_10043524 | Ga0307411_100435242 | 265 |
| 550 | 3300046615 | Ga0495656_0003746 | Ga0495656_0003746_2601_3497 | 265 |
| 551 | 3300003322 | rootL2_10006671 | rootL2_100066713 | 266 |
| 552 | 3300005288 | Ga0065714_10003608 | Ga0065714_100036086 | 266 |
| 553 | 3300005334 | Ga0068869_100081702 | Ga0068869_1000817023 | 266 |
| 554 | 3300006038 | Ga0075365_10003967 | Ga0075365_100039678 | 266 |
| 555 | 3300006048 | Ga0075363_100108332 | Ga0075363_1001083322 | 266 |
| 556 | 3300006051 | Ga0075364_10030028 | Ga0075364_100300283 | 266 |
| 557 | 3300006051 | Ga0075364_10134509 | Ga0075364_101345092 | 266 |
| 558 | 3300006195 | Ga0075366_10045907 | Ga0075366_100459072 | 266 |
| 559 | 3300006195 | Ga0075366_10165569 | Ga0075366_101655692 | 266 |
| 560 | 3300032004 | Ga0307414_10281076 | Ga0307414_102810762 | 266 |
| 561 | 3300041413 | Ga0439465_0045727 | Ga0439465_0045727_49_876 | 266 |
| 562 | 3300042122 | Ga0450920_015251 | Ga0450920_015251_62_907 | 266 |
| 563 | 3300042125 | Ga0450923_001005 | Ga0450923_001005_2487_3314 | 266 |
| 564 | 3300042138 | Ga0450903_015703 | Ga0450903_015703_251_1069 | 266 |
| 565 | 3300042145 | Ga0450906_006060 | Ga0450906_006060_1500_2327 | 266 |
| 566 | 3300042184 | Ga0450908_009248 | Ga0450908_009248_300_1127 | 266 |
| 567 | 3300042435 | Ga0439434_0002341 | Ga0439434_0002341_3342_4169 | 266 |
| 568 | 3300042436 | Ga0439435_0058171 | Ga0439435_0058171_231_1058 | 266 |
| 569 | 3300042532 | Ga0450893_0005996 | Ga0450893_0005996_947_1774 | 266 |
| 570 | 3300048091 | Ga0495626_0083205 | Ga0495626_0083205_368_1219 | 266 |
| 571 | 3300050489 | nmdc:mga03683_56278_c1 | nmdc:mga03683_56278_c1_734_1561 | 266 |
| 572 | 3300050490 | nmdc:mga03n38_6527_c1 | nmdc:mga03n38_6527_c1_806_1633 | 266 |
| 573 | 3300050491 | nmdc:mga00v17_9302_c1 | nmdc:mga00v17_9302_c1_2034_2861 | 266 |
| 574 | 3300050491 | nmdc:mga00v17_97174_c1 | nmdc:mga00v17_97174_c1_523_1368 | 266 |
| 575 | 3300050492 | nmdc:mga0yw44_1966_c1 | nmdc:mga0yw44_1966_c1_2043_2870 | 266 |
| 576 | 3300050493 | nmdc:mga0k408_84667_c1 | nmdc:mga0k408_84667_c1_167_994 | 266 |
| 577 | 3300050496 | nmdc:mga07m45_33632_c1 | nmdc:mga07m45_33632_c1_252_1070 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9375 | 16 | 262 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9312 | 16 | 250 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9295 | 16 | 263 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9273 | 14 | 250 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.926 | 16 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9605 | 15 | 264 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9531 | 15 | 264 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9393 | 16 | 252 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9303 | 13 | 252 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9294 | 16 | 246 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3G1KQ69-F1-model_v4 | ABC transporter domain-containing protein | 0.9754 | 14 | 263 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A522SVT7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9708 | 14 | 263 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A1I6ERF8-F1-model_v4 | Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family | 0.965 | 13 | 265 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A435TXS8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9644 | 14 | 263 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A7W3T3T6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9587 | 17 | 263 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar