F465636

General Info

Members Datasets Scaffolds Average Seq Length
577 407 1155 326

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_15225|Ga0400484_15225_15130_16302
Length 390
Sequence MQISVTRSYTDTCLFSPILRRYVIYKAELYELETLSGAIYQFCNRVIGLVRWNQQYGTGSMKIRNQHVLVTGADGFIGSHLTEMLVLRGARVRALSYYNSFNSWGWLDDMDCRSEIEVVSGDIRDAFFCRSLTQDIDTIFHLAALIAIPYSYQAPQSYFETNVNGTLNICQAALDNDCQRFLQTSTSEVYGTARYVPIDEKHPLQAQSPYSASKIGADAVAMSFFHSFDLPLTVARPFNTFGPRQSARAVIPTIITQISNGRERIDLGDTRPTRDFTYVLDTCHALIALAESDQAVGEIVNIGSNHEISIHDLAKKIAGMMGRPITLNTTSERLRPKNSEVFRLWCDNTKYKRLTGKTMTYSFREALEQTVTWFTKTDHLNHYKAEIYNV

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
195 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
250 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
253 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
283 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
284 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
285 2511231018 Pseudomonas sp. GM60 Isolate Nodule
286 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
287 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
288 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
289 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
290 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
291 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
292 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
293 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
294 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
295 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
296 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
297 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
298 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
299 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
300 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
301 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
302 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
303 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
304 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
305 2718217882 Rhizobium sp. N741 Isolate Nodule
306 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
307 2718218009 Rhizobium sp. N561 Isolate Nodule
308 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
309 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
310 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
311 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
312 2718218363 Rhizobium sp. N113 Isolate Nodule
313 2718218365 Rhizobium sp. N731 Isolate Nodule
314 2718218366 Rhizobium sp. N621 Isolate Nodule
315 2721755514 Rhizobium sp. N6212 Isolate Nodule
316 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
317 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
318 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
319 2721755810 Rhizobium sp. N871 Isolate Nodule
320 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
321 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
322 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
323 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
324 2728369365 Rhizobium sp. N1341 Isolate Nodule
325 2728369397 Rhizobium sp. N1314 Isolate Nodule
326 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
327 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
328 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
329 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
330 2791355263 Rhizobium chutanense C5 Isolate Nodule
331 2791355264 Rhizobium sp. S9 Isolate Nodule
332 2791355266 Rhizobium sp. L43 Isolate Nodule
333 2791355267 Rhizobium sp. L18 Isolate Nodule
334 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
335 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
336 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
337 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
338 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
339 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
340 2838048938 Rhizobium pisi 27/80 Isolate Nodule
341 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
342 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
343 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
344 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
345 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
346 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
347 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
348 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
349 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
350 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
351 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
352 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
353 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
354 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
355 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
356 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
357 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
358 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
359 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
360 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
361 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
362 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
363 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
364 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
365 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
366 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
367 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
368 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
369 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
370 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
371 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
372 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
373 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
374 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
375 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
376 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
377 2933599457 Rhizobium phaseoli M3 Isolate Nodule
378 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
379 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
380 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
381 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
382 2936381700 Rhizobium chutanense C16 Isolate Unclassified
383 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
384 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
385 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
386 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
387 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
388 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
389 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
390 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
391 8005382845 Rhizobium sp. R634 Isolate Nodule
392 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
393 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
394 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
395 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
396 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
397 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
398 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
399 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
400 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
401 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
402 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
403 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
404 8024501048 Rhizobium sp. H4 Isolate Nodule
405 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
406 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
407 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.78
Metatranscriptomes 1.39
Isolates 21.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.53
Nodule 15.94
Rhizoplane 2.6
Rhizosphere 58.41
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_15225 3300038725 Bacteria 16987
2 SwRhRL2b_contig_1408983 2162886007 Bacteria 12900
3 SwRhRL2b_contig_1550039 2162886007 Bacteria 4271
4 JGI24736J21556_1001139 3300001904 Bacteria 4864
5 JGI24737J22298_10044463 3300001990 Bacteria 1358
6 JGI25154J39366_1000003 3300002738 Bacteria 397627
7 JGI25153J46596_10001948 3300003215 Bacteria 12241
8 rootH2_10019643 3300003320 Bacteria 21373
9 rootH2_10023205 3300003320 Bacteria 24803
10 rootH2_10063417 3300003320 Unclassified 1968
11 rootH2_10093703 3300003320 Unclassified 1561
12 rootH2_10116275 3300003320 Bacteria 5782
13 rootL2_10003685 3300003322 Bacteria 8388
14 rootL2_10025009 3300003322 Bacteria 11820
15 rootL2_10050278 3300003322 Bacteria 7807
16 rootL2_10181287 3300003322 Bacteria 1210
17 rootH1_10000940 3300003323 Bacteria 88997
18 rootH1_10003366 3300003316 Bacteria 5707
19 rootH1_10003366 3300003323 Bacteria 132108
20 rootH1_10004759 3300003323 Bacteria 40082
21 rootH1_10011718 3300003323 Bacteria 12705
22 rootH1_10142684 3300003323 Bacteria 3576
23 rootH1_10258632 3300003323 Bacteria 4900
24 rootH1_10302263 3300003323 Bacteria 2446
25 Ga0007417J51691_1042512 3300003544 Unclassified 3120
26 Ga0007410J51695_1039273 3300003574 Bacteria 2000
27 Ga0007409J51694_1026885 3300003575 Bacteria 9295
28 Ga0007416J51690_1025485 3300003577 Unclassified 4976
29 Ga0032354_1036793 3300003693 Bacteria 6633
30 Ga0055526_1005874 3300003771 Bacteria 6880
31 Ga0055528_1002535 3300003790 Bacteria 9708
32 Ga0055530_10000142 3300003791 Bacteria 64055
33 Ga0055540_1000111 3300003792 Bacteria 88263
34 Ga0055540_1003348 3300003792 Bacteria 7787
35 Ga0055531_10000013 3300003794 Bacteria 187583
36 Ga0055531_10002952 3300003794 Bacteria 11059
37 Ga0065165_1000016 3300005262 Bacteria 286248
38 Ga0065165_1002007 3300005262 Bacteria 19058
39 Ga0065714_10065553 3300005288 Bacteria 9443
40 Ga0065704_10070458 3300005289 Bacteria 23980
41 Ga0065704_10117396 3300005289 Bacteria 1834
42 Ga0065704_10119986 3300005289 Bacteria 1790
43 Ga0065707_10000594 3300005295 Bacteria 18091
44 Ga0065707_10082767 3300005295 Bacteria 12251
45 Ga0070690_100011372 3300005330 Bacteria 5203
46 Ga0070670_100010202 3300005331 Bacteria 8016
47 Ga0070670_100411379 3300005331 Bacteria 1195
48 Ga0068869_100210463 3300005334 Unclassified 1537
49 Ga0068868_100099292 3300005338 Bacteria 2355
50 Ga0070660_100254268 3300005339 Unclassified 1433
51 Ga0070668_100112717 3300005347 Bacteria 2166
52 Ga0070669_100069967 3300005353 Bacteria 2593
53 Ga0070688_100049673 3300005365 Bacteria 2611
54 Ga0070659_100297882 3300005366 Bacteria 1344
55 Ga0070709_10024123 3300005434 Bacteria 3578
56 Ga0070714_100000665 3300005435 Bacteria 24338
57 Ga0070711_100019444 3300005439 Bacteria 4357
58 Ga0070694_100001597 3300005444 Bacteria 13308
59 Ga0070708_100060325 3300005445 Bacteria 3385
60 Ga0070663_100344193 3300005455 Bacteria 1205
61 Ga0070662_100085977 3300005457 Bacteria 2351
62 Ga0070662_100097751 3300005457 Bacteria 2216
63 Ga0070681_10084075 3300005458 Bacteria 3135
64 Ga0068867_100112441 3300005459 Bacteria 2094
65 Ga0068867_100129979 3300005459 Bacteria 1956
66 Ga0070706_100007168 3300005467 Bacteria 10482
67 Ga0070706_100067854 3300005467 Bacteria 3298
68 Ga0070706_100241633 3300005467 Bacteria 1686
69 Ga0070707_100018733 3300005468 Bacteria 6517
70 Ga0070698_100008387 3300005471 Bacteria 11170
71 Ga0070698_100142868 3300005471 Bacteria 2344
72 Ga0070679_100056355 3300005530 Bacteria 3916
73 Ga0070684_100251227 3300005535 Unclassified 1616
74 Ga0070697_100039587 3300005536 Bacteria 3812
75 Ga0068853_100005105 3300005539 Bacteria 10253
76 Ga0070665_100223345 3300005548 Bacteria 1884
77 Ga0070704_100341280 3300005549 Bacteria 1261
78 Ga0068855_100004293 3300005563 Bacteria 17420
79 Ga0068855_100016263 3300005563 Bacteria 8948
80 Ga0068855_100243567 3300005563 Bacteria 2008
81 Ga0070664_100158575 3300005564 Unclassified 2001
82 Ga0068857_100040198 3300005577 Bacteria 4147
83 Ga0068857_100195057 3300005577 Bacteria 1845
84 Ga0068857_100207456 3300005577 Bacteria 1787
85 Ga0068856_100012328 3300005614 Bacteria 8278
86 Ga0070702_100053799 3300005615 Bacteria 2314
87 Ga0068852_100055331 3300005616 Bacteria 3424
88 Ga0068852_100374665 3300005616 Bacteria 1395
89 Ga0068859_100243541 3300005617 Bacteria 1888
90 Ga0068859_100310251 3300005617 Bacteria 1671
91 Ga0068859_100358051 3300005617 Bacteria 1554
92 Ga0068864_100045858 3300005618 Bacteria 3750
93 Ga0068861_100010685 3300005719 Bacteria 6377
94 Ga0068870_10104669 3300005840 Bacteria 1606
95 Ga0068860_100012399 3300005843 Bacteria 8398
96 Ga0068860_100401031 3300005843 Bacteria 1357
97 Ga0068862_100080863 3300005844 Bacteria 2818
98 Ga0070717_10166293 3300006028 Bacteria 1916
99 Ga0075363_100048783 3300006048 Bacteria 2253
100 Ga0075363_100057558 3300006048 Bacteria 2086
101 Ga0075362_10003869 3300006177 Bacteria 5317
102 Ga0075367_10045034 3300006178 Bacteria 2588
103 Ga0075369_10014358 3300006186 Bacteria 3163
104 Ga0075366_10000739 3300006195 Bacteria 15529
105 Ga0097621_100207943 3300006237 Bacteria 1701
106 Ga0075370_10002050 3300006353 Bacteria 9157
107 Ga0075430_100056701 3300006846 Bacteria 3295
108 Ga0075431_100000068 3300006847 Bacteria 60176
109 Ga0075433_10178831 3300006852 Bacteria 1887
110 Ga0075434_100025579 3300006871 Bacteria 5775
111 Ga0075429_100000282 3300006880 Bacteria 35849
112 Ga0075436_100004923 3300006914 Bacteria 9176
113 Ga0097620_100243546 3300006931 Bacteria 1888
114 Ga0097620_100310249 3300006931 Bacteria 1671
115 Ga0097620_100358035 3300006931 Bacteria 1554
116 Ga0075435_100057833 3300007076 Bacteria 3138
117 Ga0105251_10000751 3300009011 Bacteria 29613
118 Ga0105250_10000064 3300009092 Bacteria 100417
119 Ga0105240_10000198 3300009093 Bacteria 122388
120 Ga0105240_10001853 3300009093 Bacteria 35378
121 Ga0105240_10013476 3300009093 Archaea 11230
122 Ga0105240_10019201 3300009093 Bacteria 9137
123 Ga0111539_10001205 3300009094 Bacteria 34437
124 Ga0105245_10454641 3300009098 Bacteria 1290
125 Ga0114129_10174060 3300009147 Unclassified 2932
126 Ga0114129_10188127 3300009147 Unclassified 2805
127 Ga0105243_10148926 3300009148 Bacteria 2005
128 Ga0105241_10000137 3300009174 Bacteria 52153
129 Ga0105241_10005687 3300009174 Bacteria 9202
130 Ga0105248_10131991 3300009177 Bacteria 2818
131 Ga0105237_10000554 3300009545 Bacteria 52328
132 Ga0105237_10000781 3300009545 Bacteria 43601
133 Ga0105237_10003050 3300009545 Bacteria 20205
134 Ga0105237_10006169 3300009545 Bacteria 13388
135 Ga0105237_10029703 3300009545 Bacteria 5554
136 Ga0105238_10008871 3300009551 Bacteria 10061
137 Ga0105238_10017259 3300009551 Bacteria 7332
138 Ga0105238_10125683 3300009551 Unclassified 2543
139 Ga0123342_1003337 3300009766 Bacteria 25833
140 Ga0105239_10000298 3300010375 Bacteria 73328
141 Ga0105239_10001227 3300010375 Bacteria 34941
142 Ga0105239_10005875 3300010375 Bacteria 14303
143 Ga0105239_10008489 3300010375 Bacteria 11680
144 Ga0105239_10010597 3300010375 Bacteria 10308
145 Ga0105239_10022204 3300010375 Bacteria 6994
146 Ga0105239_10257443 3300010375 Unclassified 1961
147 Ga0105239_10763700 3300010375 Bacteria 1107
148 Ga0157371_10051531 3300013102 Bacteria 2924
149 Ga0157369_10000493 3300013105 Bacteria 52265
150 Ga0157378_10019196 3300013297 Bacteria 6008
151 Ga0157378_10032839 3300013297 Bacteria 4588
152 Ga0163162_10001192 3300013306 Bacteria 24279
153 Ga0163162_10122910 3300013306 Bacteria 2701
154 Ga0163162_10140552 3300013306 Bacteria 2528
155 Ga0163162_10228026 3300013306 Unclassified 1993
156 Ga0157372_10002326 3300013307 Bacteria 20596
157 Ga0157372_10029040 3300013307 Bacteria 6034
158 Ga0157372_10180082 3300013307 Bacteria 2446
159 Ga0157372_10181845 3300013307 Bacteria 2434
160 Ga0157372_10199309 3300013307 Bacteria 2319
161 Ga0157375_10098294 3300013308 Bacteria 3003
162 Ga0157375_10446015 3300013308 Unclassified 1460
163 Ga0163163_10000009 3300014325 Bacteria 268331
164 Ga0163163_10000095 3300014325 Bacteria 93905
165 Ga0163163_10362228 3300014325 Bacteria 1506
166 Ga0157380_10000932 3300014326 Bacteria 18464
167 Ga0157380_10410141 3300014326 Bacteria 1288
168 Ga0182008_10028908 3300014497 Unclassified 2802
169 Ga0157379_10243660 3300014968 Bacteria 1631
170 Ga0182007_10006173 3300015262 Bacteria 5171
171 Ga0163161_10000515 3300017792 Bacteria 31522
172 Ga0163161_10000642 3300017792 Bacteria 27902
173 Ga0206353_10285791 3300020082 Bacteria 1744
174 Ga0224572_1000121 3300024225 Bacteria 6320
175 Ga0209646_1000004 3300025246 Bacteria 786587
176 Ga0209026_1000192 3300025250 Bacteria 88221
177 Ga0209129_1004827 3300025258 Bacteria 5074
178 Ga0209673_1001115 3300025273 Bacteria 29920
179 Ga0209673_1015094 3300025273 Bacteria 2953
180 Ga0209673_1036211 3300025273 Bacteria 1468
181 Ga0209676_1008360 3300025292 Bacteria 4627
182 Ga0209564_1000008 3300025295 Bacteria 953227
183 Ga0209564_1003789 3300025295 Bacteria 9830
184 Ga0209758_1000912 3300025297 Bacteria 40017
185 Ga0209050_1000014 3300025298 Bacteria 774327
186 Ga0207426_1000930 3300025302 Bacteria 29211
187 Ga0207426_1044180 3300025302 Bacteria 1363
188 Ga0209051_1000084 3300025303 Bacteria 190324
189 Ga0209257_1000019 3300025304 Bacteria 774261
190 Ga0209257_1003695 3300025304 Bacteria 12730
191 Ga0209257_1009326 3300025304 Bacteria 5292
192 Ga0209257_1012045 3300025304 Bacteria 4062
193 Ga0207696_1000128 3300025711 Bacteria 134490
194 Ga0207713_1000769 3300025735 Bacteria 29621
195 Ga0207647_10000065 3300025904 Bacteria 82293
196 Ga0207654_10002083 3300025911 Bacteria 10241
197 Ga0207707_10136949 3300025912 Bacteria 2141
198 Ga0207695_10000346 3300025913 Bacteria 107028
199 Ga0207695_10002348 3300025913 Bacteria 28111
200 Ga0207695_10023054 3300025913 Bacteria 7047
201 Ga0207695_10071145 3300025913 Bacteria 3553
202 Ga0207695_10151886 3300025913 Bacteria 2254
203 Ga0207671_10002368 3300025914 Bacteria 20262
204 Ga0207671_10003677 3300025914 Bacteria 15118
205 Ga0207671_10009301 3300025914 Bacteria 8227
206 Ga0207671_10010854 3300025914 Bacteria 7473
207 Ga0207693_10047486 3300025915 Bacteria 3373
208 Ga0207663_10036021 3300025916 Bacteria 2974
209 Ga0207657_10189099 3300025919 Bacteria 1662
210 Ga0207657_10241527 3300025919 Unclassified 1442
211 Ga0207646_10386958 3300025922 Bacteria 1263
212 Ga0207694_10207634 3300025924 Bacteria 1595
213 Ga0207694_10210649 3300025924 Bacteria 1583
214 Ga0207650_10138238 3300025925 Bacteria 1913
215 Ga0207650_10282286 3300025925 Bacteria 1352
216 Ga0207687_10066427 3300025927 Bacteria 2563
217 Ga0207690_10239231 3300025932 Bacteria 1398
218 Ga0207706_10112139 3300025933 Bacteria 2399
219 Ga0207709_10084108 3300025935 Bacteria 2059
220 Ga0207670_10183404 3300025936 Unclassified 1578
221 Ga0207711_10021829 3300025941 Bacteria 5347
222 Ga0207689_10222602 3300025942 Unclassified 1559
223 Ga0207679_10254936 3300025945 Unclassified 1493
224 Ga0207667_10006247 3300025949 Bacteria 14458
225 Ga0207667_10008112 3300025949 Bacteria 12514
226 Ga0207667_10030722 3300025949 Bacteria 5806
227 Ga0207667_10535409 3300025949 Bacteria 1186
228 Ga0207651_10082783 3300025960 Bacteria 2318
229 Ga0207668_10166857 3300025972 Bacteria 1722
230 Ga0207677_10152781 3300026023 Bacteria 1783
231 Ga0207703_10118649 3300026035 Bacteria 2268
232 Ga0207678_10059159 3300026067 Bacteria 3297
233 Ga0207678_10181405 3300026067 Bacteria 1798
234 Ga0207708_10088217 3300026075 Bacteria 2389
235 Ga0207702_10240263 3300026078 Bacteria 1697
236 Ga0207702_10342472 3300026078 Bacteria 1428
237 Ga0207676_10362434 3300026095 Bacteria 1344
238 Ga0207674_10236565 3300026116 Unclassified 1774
239 Ga0207674_10256848 3300026116 Bacteria 1694
240 Ga0207675_100065045 3300026118 Bacteria 3408
241 Ga0207698_10040977 3300026142 Bacteria 3447
242 Ga0207698_10151254 3300026142 Bacteria 2015
243 Ga0209981_1013369 3300027378 Bacteria 1141
244 Ga0209971_1000773 3300027682 Bacteria 8249
245 Ga0209974_10000675 3300027876 Bacteria 11584
246 Ga0268265_10033098 3300028380 Bacteria 3755
247 Ga0268264_10015234 3300028381 Bacteria 6308
248 Ga0265334_10043455 3300028573 Bacteria 1748
249 Ga0265318_10029778 3300028577 Bacteria 2127
250 Ga0265323_10001069 3300028653 Bacteria 14189
251 Ga0307511_10000063 3300030521 Bacteria 91169
252 Ga0265330_10007211 3300031235 Bacteria 5441
253 Ga0265332_10018367 3300031238 Unclassified 3085
254 Ga0265332_10058574 3300031238 Bacteria 1648
255 Ga0265320_10016854 3300031240 Bacteria 4077
256 Ga0265329_10033235 3300031242 Bacteria 1668
257 Ga0265340_10002393 3300031247 Bacteria 10667
258 Ga0265339_10007250 3300031249 Bacteria 7184
259 Ga0265339_10122166 3300031249 Bacteria 1337
260 Ga0265331_10055712 3300031250 Bacteria 1879
261 Ga0265327_10001563 3300031251 Bacteria 28087
262 Ga0265327_10013020 3300031251 Bacteria 5558
263 Ga0265327_10025480 3300031251 Bacteria 3447
264 Ga0265327_10065614 3300031251 Unclassified 1835
265 Ga0265316_10011830 3300031344 Bacteria 7849
266 Ga0265316_10023131 3300031344 Bacteria 5225
267 Ga0265316_10105500 3300031344 Bacteria 2138
268 Ga0307408_100000040 3300031548 Bacteria 175456
269 Ga0307408_100000330 3300031548 Bacteria 45434
270 Ga0307408_100002008 3300031548 Bacteria 14692
271 Ga0307408_100006042 3300031548 Bacteria 8055
272 Ga0307408_100029022 3300031548 Bacteria 3829
273 Ga0307408_100136926 3300031548 Bacteria 1917
274 Ga0265313_10109343 3300031595 Bacteria 1217
275 Ga0265314_10002337 3300031711 Bacteria 19598
276 Ga0265314_10149096 3300031711 Bacteria 1436
277 Ga0265342_10000052 3300031712 Bacteria 123865
278 Ga0265342_10000541 3300031712 Bacteria 40244
279 Ga0265342_10079624 3300031712 Bacteria 1894
280 Ga0307516_10011905 3300031730 Bacteria 9413
281 Ga0307516_10072136 3300031730 Bacteria 3313
282 Ga0307405_10039298 3300031731 Bacteria 2859
283 Ga0307413_10002470 3300031824 Bacteria 7525
284 Ga0307410_10020191 3300031852 Bacteria 4070
285 Ga0307406_10009729 3300031901 Bacteria 5404
286 Ga0307407_10080821 3300031903 Bacteria 1965
287 Ga0307412_10015839 3300031911 Bacteria 4478
288 Ga0307412_10044372 3300031911 Bacteria 2900
289 Ga0307409_100002685 3300031995 Bacteria 9374
290 Ga0307414_10003386 3300032004 Bacteria 8516
291 Ga0307414_10053032 3300032004 Bacteria 2826
292 Ga0307415_100028512 3300032126 Bacteria 3554
293 Ga0307510_10017380 3300033180 Bacteria 8484
294 Ga0373961_0026900 3300035241 Bacteria 1575
295 Ga0395899_0000246 3300037312 Bacteria 72297
296 Ga0395899_0000613 3300037312 Bacteria 37148
297 Ga0395899_0000963 3300037312 Bacteria 26721
298 Ga0395900_0000435 3300037418 Bacteria 60001
299 Ga0395900_0000540 3300037418 Bacteria 52884
300 Ga0395900_0006688 3300037418 Bacteria 11978
301 Ga0395900_0014043 3300037418 Bacteria 8178
302 Ga0395898_0008561 3300037466 Bacteria 10799
303 Ga0395905_0001728 3300037471 Bacteria 25571
304 Ga0395905_0006231 3300037471 Bacteria 12043
305 Ga0395905_0007452 3300037471 Bacteria 10883
306 Ga0395905_0017913 3300037471 Bacteria 6728
307 Ga0395905_0284941 3300037471 Bacteria 1539
308 Ga0436364_0741378 3300037853 Bacteria 8356
309 Ga0395901_0000082 3300038443 Bacteria 130230
310 Ga0395901_0000599 3300038443 Bacteria 42012
311 Ga0395901_0003312 3300038443 Bacteria 16230
312 Ga0395901_0019273 3300038443 Bacteria 6974
313 Ga0400484_21715 3300038725 Bacteria 3434
314 Ga0400490_10479 3300038726 Bacteria 5319
315 Ga0400483_031157 3300039062 Bacteria 17255
316 Ga0400483_038110 3300039062 Bacteria 5683
317 Ga0400483_039039 3300039062 Bacteria 6435
318 Ga0400483_116214 3300039062 Bacteria 2569
319 Ga0400483_219096 3300039062 Bacteria 11561
320 Ga0400483_238768 3300039062 Bacteria 23085
321 Ga0400483_288870 3300039062 Unclassified 3376
322 Ga0436361_0540516 3300039447 Bacteria 8725
323 Ga0436362_1299585 3300039453 Bacteria 1057
324 Ga0451845_0408387 3300041501 Bacteria 3995
325 Ga0451847_0830035 3300041503 Bacteria 1761
326 Ga0451851_0572074 3300041507 Bacteria 5073
327 Ga0439451_000029 3300042009 Bacteria 31111
328 Ga0439463_006258 3300042016 Bacteria 2951
329 Ga0439463_008131 3300042016 Bacteria 2587
330 Ga0450906_000038 3300042145 Bacteria 21445
331 Ga0451577_0000852 3300042876 Bacteria 45450
332 Ga0451577_0010409 3300042876 Bacteria 8895
333 Ga0466972_0014473 3300044658 Bacteria 3951
334 Ga0453683_0028779 3300044673 Bacteria 3516
335 Ga0453683_0034084 3300044673 Unclassified 3210
336 Ga0453683_0074614 3300044673 Bacteria 2124
337 Ga0466965_0048475 3300044683 Bacteria 2105
338 Ga0466966_0001048 3300044684 Bacteria 17655
339 Ga0453684_0000264 3300044712 Bacteria 225672
340 Ga0453684_0002092 3300044712 Bacteria 50519
341 Ga0453684_0017978 3300044712 Bacteria 10891
342 Ga0453684_0058351 3300044712 Bacteria 4986
343 Ga0453684_0076625 3300044712 Bacteria 4197
344 Ga0453684_0105591 3300044712 Bacteria 3435
345 Ga0453684_0208240 3300044712 Bacteria 2275
346 Ga0453684_0250958 3300044712 Bacteria 2032
347 Ga0453684_0297881 3300044712 Bacteria 1834
348 Ga0466970_0015010 3300044765 Bacteria 3983
349 Ga0451576_0000229 3300045051 Bacteria 136407
350 Ga0451576_0000691 3300045051 Bacteria 68432
351 Ga0451576_0002540 3300045051 Bacteria 27010
352 Ga0451576_0014619 3300045051 Bacteria 8724
353 Ga0451576_0275292 3300045051 Unclassified 1760
354 Ga0466967_0485504 3300045976 Bacteria 1211
355 Ga0495590_0000338 3300046457 Bacteria 24377
356 Ga0495651_0084099 3300046462 Bacteria 2398
357 Ga0495584_0002958 3300046491 Bacteria 9450
358 Ga0495585_0015743 3300046492 Bacteria 4391
359 Ga0495585_0052827 3300046492 Bacteria 2249
360 Ga0495583_0000460 3300046506 Bacteria 60178
361 Ga0495606_0002199 3300046507 Bacteria 23384
362 Ga0495637_0000574 3300046520 Bacteria 26147
363 Ga0495644_0007634 3300046523 Bacteria 4170
364 Ga0495642_0000058 3300046528 Bacteria 66850
365 Ga0495654_0000711 3300046530 Bacteria 26011
366 Ga0495597_0000822 3300046542 Bacteria 24434
367 Ga0495625_0001324 3300046660 Bacteria 30795
368 Ga0495625_0003740 3300046660 Bacteria 14805
369 Ga0495661_0012810 3300046665 Bacteria 5656
370 Ga0495669_0002968 3300046684 Bacteria 6969
371 Ga0495649_0000913 3300046694 Bacteria 23330
372 Ga0495672_0105785 3300047320 Bacteria 1518
373 Ga0495686_0106462 3300047472 Bacteria 1686
374 Ga0495686_0118833 3300047472 Bacteria 1578
375 Ga0495626_0001439 3300048091 Bacteria 18932
376 Ga0496108_0184105 3300048911 Bacteria 1809
377 Ga0496110_0000755 3300048913 Bacteria 22400
378 Ga0496111_0043005 3300048914 Bacteria 3246
379 Ga0496114_0175790 3300048917 Bacteria 1868
380 Ga0496114_0356348 3300048917 Bacteria 1294
381 Ga0496115_0242130 3300048918 Bacteria 1486
382 Ga0496116_0019311 3300048919 Bacteria 5220
383 Ga0496116_0025121 3300048919 Bacteria 4387
384 Ga0496117_0001860 3300048920 Bacteria 28482
385 Ga0496118_0001427 3300048921 Bacteria 35987
386 Ga0496119_0021895 3300048922 Bacteria 4598
387 Ga0496120_0010214 3300048923 Bacteria 6573
388 Ga0496121_0002976 3300048924 Bacteria 24661
389 Ga0496121_0143333 3300048924 Unclassified 1769
390 Ga0496122_0000014 3300048925 Bacteria 491410
391 Ga0496122_0000021 3300048925 Bacteria 391363
392 Ga0496122_0002040 3300048925 Bacteria 29985
393 Ga0496122_0012631 3300048925 Bacteria 8376
394 Ga0496123_0000382 3300048926 Bacteria 83286
395 Ga0496123_0001660 3300048926 Bacteria 29864
396 Ga0496123_0003828 3300048926 Bacteria 16415
397 Ga0496123_0005958 3300048926 Bacteria 12004
398 Ga0496124_0007489 3300048927 Bacteria 11590
399 Ga0496124_0024142 3300048927 Bacteria 5534
400 Ga0496125_0004710 3300048928 Bacteria 15547
401 Ga0496126_0000019 3300048929 Bacteria 564723
402 Ga0496126_0002235 3300048929 Bacteria 26772
403 Ga0495678_006899 3300049459 Bacteria 5961
404 Ga0501034_0003487 3300049571 Bacteria 17879
405 Ga0501067_0057845 3300049583 Unclassified 2147
406 Ga0501073_0029754 3300049589 Bacteria 3903
407 Ga0501074_0021176 3300049590 Bacteria 4723
408 Ga0501074_0249001 3300049590 Bacteria 1264
409 Ga0501077_0011677 3300049593 Bacteria 5490
410 Ga0501236_002184 3300049670 Bacteria 2238
411 Ga0501247_001609 3300049677 Bacteria 2227
412 Ga0501079_0029981 3300049741 Bacteria 4179
413 Ga0501241_000132 3300049758 Bacteria 16459
414 Ga0501241_000308 3300049758 Bacteria 10678
415 Ga0501264_001786 3300049761 Bacteria 2158
416 Ga0501035_0003553 3300049822 Bacteria 14891
417 Ga0501044_0278789 3300049823 Bacteria 1606
418 nmdc:mga03683_21069_c1 3300050489 Bacteria 2508
419 nmdc:mga03n38_37782_c1 3300050490 Bacteria 2085
420 nmdc:mga0yw44_90771_c1 3300050492 Bacteria 1930
421 nmdc:mga0k408_1459_c1 3300050493 Bacteria 12755
422 nmdc:mga0k408_6251_c1 3300050493 Bacteria 6354
423 nmdc:mga0k408_68735_c1 3300050493 Bacteria 2067
424 nmdc:mga0k408_800_c1 3300050493 Bacteria 17312
425 nmdc:mga06z11_1646_c1 3300050494 Bacteria 8370
426 nmdc:mga06z11_68033_c1 3300050494 Bacteria 1876
427 nmdc:mga07m45_159105_c1 3300050496 Bacteria 1311
428 nmdc:mga07m45_36467_c1 3300050496 Bacteria 2739
429 nmdc:mga05p37_415639_c1 3300050507 Bacteria 1566
430 nmdc:mga05p37_475694_c1 3300050507 Bacteria 1440
431 nmdc:mga05p37_51760_c1 3300050507 Bacteria 5049
432 nmdc:mga09592_2771_c1 3300050508 Bacteria 14185
433 nmdc:mga0qj67_227704_c1 3300050509 Bacteria 1513
434 nmdc:mga06r32_2535_c1 3300050510 Bacteria 16339
435 nmdc:mga0rr50_477806_c1 3300050513 Bacteria 1058
436 nmdc:mga08x19_10432_c1 3300050514 Bacteria 5578
437 nmdc:mga0a205_93796_c1 3300050515 Bacteria 2900
438 nmdc:mga0sz30_97977_c1 3300050516 Bacteria 1279
439 Ga0500644_0000069 3300053088 Bacteria 61316
440 Ga0500646_0005200 3300053090 Bacteria 3295
441 Ga0500646_0005387 3300053090 Bacteria 3237
442 Ga0500646_0017932 3300053090 Bacteria 1861
443 Ga0500583_0058025 3300053092 Bacteria 1819
444 Ga0500658_0032181 3300053134 Bacteria 2056
445 Ga0500568_0010204 3300053139 Bacteria 4411
446 Ga0500604_0000448 3300053151 Bacteria 11347
447 Ga0500616_0030999 3300053153 Bacteria 2933
448 Ga0500622_0000199 3300053156 Bacteria 63518
449 Ga0501084_0021201 3300054114 Bacteria 5419
450 Ga0587082_000790 3300059504 Bacteria 2932
451 Ga0587088_010191 3300059508 Bacteria 1371
452 Ga0501082_0013318 3300060353 Bacteria 7071
453 2509388385 2509276021 Bacteria 7634384
454 2510131446 2510065019 Bacteria 6903379
455 2510897799 2510461076 Bacteria 8618824
456 2511339359 2511231018 Bacteria 6436256
457 2513570666 2513237084 Bacteria 7231967
458 2513632180 2513237093 Bacteria 7545552
459 2513713337 2513237103 Bacteria 7647401
460 2514021027 2513237162 Bacteria 7468464
461 2515110407 2515075009 Bacteria 7288508
462 2515642864 2515154114 Bacteria 7848616
463 2515659614 2515154116 Bacteria 7552979
464 2517039096 2516653077 Bacteria 7555578
465 2585992882 2585427633 Bacteria 6413184
466 2599887576 2599185289 Bacteria 6778765
467 2599899945 2599185291 Bacteria 6775623
468 2599941845 2599185302 Bacteria 5954930
469 2599952635 2599185304 Bacteria 5951361
470 2599960522 2599185305 Bacteria 6748700
471 2600017438 2599185315 Bacteria 6771107
472 2600052261 2599185321 Bacteria 6764560
473 2601640433 2600255286 Bacteria 5390125
474 2671090237 2667528170 Bacteria 6786960
475 2678262556 2675903515 Bacteria 6580491
476 2719179601 2718217882 Bacteria 6556348
477 2719663953 2718217997 Bacteria 6740740
478 2719730271 2718218009 Bacteria 6478651
479 2720490372 2718218199 Bacteria 6740745
480 2720611741 2718218232 Bacteria 6720332
481 2720629998 2718218235 Bacteria 6630699
482 2720773693 2718218269 Bacteria 6906114
483 2721145694 2718218363 Bacteria 6524337
484 2721157210 2718218365 Bacteria 6274507
485 2721162573 2718218366 Bacteria 6425255
486 2722838743 2721755514 Bacteria 6424414
487 2723025371 2721755556 Bacteria 6745503
488 2723558954 2721755684 Bacteria 6859907
489 2723565519 2721755685 Bacteria 6704835
490 2724043027 2721755810 Bacteria 6479005
491 2724088300 2721755819 Bacteria 6906405
492 2724102784 2721755822 Bacteria 6726041
493 2724108684 2721755823 Bacteria 6752556
494 2730106307 2728369352 Bacteria 6745171
495 2730162838 2728369365 Bacteria 6555560
496 2730296842 2728369397 Bacteria 6274511
497 2738809663 2738541294 Bacteria 6925949
498 2738897023 2738541309 Bacteria 6926455
499 2745008898 2744054620 Bacteria 6551379
500 2793315399 2791355259 Bacteria 7254731
501 2793341773 2791355263 Bacteria 6872478
502 2793350774 2791355264 Bacteria 6429314
503 2793362743 2791355266 Bacteria 7116587
504 2793364704 2791355267 Bacteria 7222458
505 2805931540 2802429605 Bacteria 6875453
506 2805932339 2802429606 Bacteria 6346811
507 2808923653 2808606376 Bacteria 6248667
508 2808945583 2808606380 Bacteria 6248705
509 2838020321 2838016132 Bacteria 6577831
510 2838044388 2838042994 Bacteria 6046894
511 2838051469 2838048938 Bacteria 6044578
512 2838073663 2838068647 Bacteria 6208656
513 2838680613 2838680041 Bacteria 6545511
514 2838695354 2838694306 Bacteria 6853137
515 2838708730 2838707686 Bacteria 6619912
516 2841866782 2841864319 Bacteria 6742987
517 2842080035 2842077413 Bacteria 6508645
518 2842112235 2842110456 Bacteria 7656360
519 2842120654 2842118031 Bacteria 7033875
520 2842206920 2842205361 Bacteria 6340321
521 2842218763 2842217011 Bacteria 7497767
522 2842238142 2842237096 Bacteria 6620661
523 2842267412 2842264693 Bacteria 6472963
524 2842280387 2842278818 Bacteria 6340002
525 2842293695 2842291075 Bacteria 7076806
526 2842343046 2842341865 Bacteria 7003929
527 2842367231 2842363717 Bacteria 6844742
528 2842371076 2842370503 Bacteria 7038661
529 2842380092 2842377471 Bacteria 7140707
530 2842387163 2842384541 Bacteria 7057858
531 2842427111 2842422224 Bacteria 6239196
532 2842431336 2842428310 Bacteria 6767288
533 2842437671 2842434925 Bacteria 6502746
534 2842444486 2842441272 Bacteria 6769273
535 2842465686 2842462802 Bacteria 6588055
536 2842472496 2842469257 Bacteria 6752936
537 2842492429 2842489311 Bacteria 6620893
538 2846038047 2846037992 Bacteria 4526407
539 2884813800 2884811622 Bacteria 5552861
540 2884839757 2884836552 Bacteria 5219991
541 2884856432 2884852848 Bacteria 5221161
542 2894510803 2894510363 Bacteria 5121143
543 2896158798 2896154374 Bacteria 5221518
544 2913038536 2913036834 Bacteria 6704877
545 2929178078 2929177148 Bacteria 7883697
546 2929244006 2929239360 Bacteria 7745570
547 2933587564 2933586486 Bacteria 7667493
548 2933604091 2933599457 Bacteria 5858799
549 2935895877 2935894831 Bacteria 6620579
550 2936365832 2936361878 Bacteria 5632809
551 2936368897 2936367885 Bacteria 7324495
552 2936377023 2936375103 Bacteria 6652732
553 2936383780 2936381700 Bacteria 7006523
554 2945980439 2945977869 Bacteria 7777518
555 2946013700 2946013367 Bacteria 7766675
556 2977978354 2977971508 Bacteria 7472917
557 2989393123 2989392574 Bacteria 4554005
558 3005451814 3005445848 Bacteria 6906074
559 8005283611 8005282627 Bacteria 6675747
560 8005291054 8005289223 Bacteria 6634003
561 8005377405 8005376324 Bacteria 6590079
562 8005387263 8005382845 Bacteria 6732062
563 8005432962 8005430974 Bacteria 6689030
564 8005461046 8005460587 Bacteria 7157962
565 8005498695 8005497431 Bacteria 6477605
566 8005560668 8005556819 Bacteria 6908598
567 8005619890 8005619151 Bacteria 7030230
568 8005628455 8005626139 Bacteria 6534237
569 8005670106 8005668836 Bacteria 6953162
570 8005690299 8005688590 Bacteria 6610080
571 8007372807 8007371054 Bacteria 4849201
572 8007378590 8007375930 Bacteria 4080554
573 8018133153 8018127388 Bacteria 7351159
574 8018167862 8018163183 Bacteria 7277977
575 8024501567 8024501048 Bacteria 6427847
576 8054505728 8054503363 Bacteria 6101651
577 8056375661 8056375014 Bacteria 7006639
578 8056385977 8056382006 Bacteria 6408074
579 Ga0400484_15225
580 SwRhRL2b_contig_1408983
581 SwRhRL2b_contig_1550039
582 JGI24736J21556_1001139
583 JGI24737J22298_10044463
584 JGI25154J39366_1000003
585 JGI25153J46596_10001948
586 rootH2_10019643
587 rootH2_10023205
588 rootH2_10063417
589 rootH2_10093703
590 rootH2_10116275
591 rootL2_10003685
592 rootL2_10025009
593 rootL2_10050278
594 rootL2_10181287
595 rootH1_10000940
596 rootH1_10003366
597 rootH1_10004759
598 rootH1_10011718
599 rootH1_10142684
600 rootH1_10258632
601 rootH1_10302263
602 Ga0007417J51691_1042512
603 Ga0007410J51695_1039273
604 Ga0007409J51694_1026885
605 Ga0007416J51690_1025485
606 Ga0032354_1036793
607 Ga0055526_1005874
608 Ga0055528_1002535
609 Ga0055530_10000142
610 Ga0055540_1000111
611 Ga0055540_1003348
612 Ga0055531_10000013
613 Ga0055531_10002952
614 Ga0065165_1000016
615 Ga0065165_1002007
616 Ga0065714_10065553
617 Ga0065704_10070458
618 Ga0065704_10117396
619 Ga0065704_10119986
620 Ga0065707_10000594
621 Ga0065707_10082767
622 Ga0070690_100011372
623 Ga0070670_100010202
624 Ga0070670_100411379
625 Ga0068869_100210463
626 Ga0068868_100099292
627 Ga0070660_100254268
628 Ga0070668_100112717
629 Ga0070669_100069967
630 Ga0070688_100049673
631 Ga0070659_100297882
632 Ga0070709_10024123
633 Ga0070714_100000665
634 Ga0070711_100019444
635 Ga0070694_100001597
636 Ga0070708_100060325
637 Ga0070663_100344193
638 Ga0070662_100085977
639 Ga0070662_100097751
640 Ga0070681_10084075
641 Ga0068867_100112441
642 Ga0068867_100129979
643 Ga0070706_100007168
644 Ga0070706_100067854
645 Ga0070706_100241633
646 Ga0070707_100018733
647 Ga0070698_100008387
648 Ga0070698_100142868
649 Ga0070679_100056355
650 Ga0070684_100251227
651 Ga0070697_100039587
652 Ga0068853_100005105
653 Ga0070665_100223345
654 Ga0070704_100341280
655 Ga0068855_100004293
656 Ga0068855_100016263
657 Ga0068855_100243567
658 Ga0070664_100158575
659 Ga0068857_100040198
660 Ga0068857_100195057
661 Ga0068857_100207456
662 Ga0068856_100012328
663 Ga0070702_100053799
664 Ga0068852_100055331
665 Ga0068852_100374665
666 Ga0068859_100243541
667 Ga0068859_100310251
668 Ga0068859_100358051
669 Ga0068864_100045858
670 Ga0068861_100010685
671 Ga0068870_10104669
672 Ga0068860_100012399
673 Ga0068860_100401031
674 Ga0068862_100080863
675 Ga0070717_10166293
676 Ga0075363_100048783
677 Ga0075363_100057558
678 Ga0075362_10003869
679 Ga0075367_10045034
680 Ga0075369_10014358
681 Ga0075366_10000739
682 Ga0097621_100207943
683 Ga0075370_10002050
684 Ga0075430_100056701
685 Ga0075431_100000068
686 Ga0075433_10178831
687 Ga0075434_100025579
688 Ga0075429_100000282
689 Ga0075436_100004923
690 Ga0097620_100243546
691 Ga0097620_100310249
692 Ga0097620_100358035
693 Ga0075435_100057833
694 Ga0105251_10000751
695 Ga0105250_10000064
696 Ga0105240_10000198
697 Ga0105240_10001853
698 Ga0105240_10013476
699 Ga0105240_10019201
700 Ga0111539_10001205
701 Ga0105245_10454641
702 Ga0114129_10174060
703 Ga0114129_10188127
704 Ga0105243_10148926
705 Ga0105241_10000137
706 Ga0105241_10005687
707 Ga0105248_10131991
708 Ga0105237_10000554
709 Ga0105237_10000781
710 Ga0105237_10003050
711 Ga0105237_10006169
712 Ga0105237_10029703
713 Ga0105238_10008871
714 Ga0105238_10017259
715 Ga0105238_10125683
716 Ga0123342_1003337
717 Ga0105239_10000298
718 Ga0105239_10001227
719 Ga0105239_10005875
720 Ga0105239_10008489
721 Ga0105239_10010597
722 Ga0105239_10022204
723 Ga0105239_10257443
724 Ga0105239_10763700
725 Ga0157371_10051531
726 Ga0157369_10000493
727 Ga0157378_10019196
728 Ga0157378_10032839
729 Ga0163162_10001192
730 Ga0163162_10122910
731 Ga0163162_10140552
732 Ga0163162_10228026
733 Ga0157372_10002326
734 Ga0157372_10029040
735 Ga0157372_10180082
736 Ga0157372_10181845
737 Ga0157372_10199309
738 Ga0157375_10098294
739 Ga0157375_10446015
740 Ga0163163_10000009
741 Ga0163163_10000095
742 Ga0163163_10362228
743 Ga0157380_10000932
744 Ga0157380_10410141
745 Ga0182008_10028908
746 Ga0157379_10243660
747 Ga0182007_10006173
748 Ga0163161_10000515
749 Ga0163161_10000642
750 Ga0206353_10285791
751 Ga0224572_1000121
752 Ga0209646_1000004
753 Ga0209026_1000192
754 Ga0209129_1004827
755 Ga0209673_1001115
756 Ga0209673_1015094
757 Ga0209673_1036211
758 Ga0209676_1008360
759 Ga0209564_1000008
760 Ga0209564_1003789
761 Ga0209758_1000912
762 Ga0209050_1000014
763 Ga0207426_1000930
764 Ga0207426_1044180
765 Ga0209051_1000084
766 Ga0209257_1000019
767 Ga0209257_1003695
768 Ga0209257_1009326
769 Ga0209257_1012045
770 Ga0207696_1000128
771 Ga0207713_1000769
772 Ga0207647_10000065
773 Ga0207654_10002083
774 Ga0207707_10136949
775 Ga0207695_10000346
776 Ga0207695_10002348
777 Ga0207695_10023054
778 Ga0207695_10071145
779 Ga0207695_10151886
780 Ga0207671_10002368
781 Ga0207671_10003677
782 Ga0207671_10009301
783 Ga0207671_10010854
784 Ga0207693_10047486
785 Ga0207663_10036021
786 Ga0207657_10189099
787 Ga0207657_10241527
788 Ga0207646_10386958
789 Ga0207694_10207634
790 Ga0207694_10210649
791 Ga0207650_10138238
792 Ga0207650_10282286
793 Ga0207687_10066427
794 Ga0207690_10239231
795 Ga0207706_10112139
796 Ga0207709_10084108
797 Ga0207670_10183404
798 Ga0207711_10021829
799 Ga0207689_10222602
800 Ga0207679_10254936
801 Ga0207667_10006247
802 Ga0207667_10008112
803 Ga0207667_10030722
804 Ga0207667_10535409
805 Ga0207651_10082783
806 Ga0207668_10166857
807 Ga0207677_10152781
808 Ga0207703_10118649
809 Ga0207678_10059159
810 Ga0207678_10181405
811 Ga0207708_10088217
812 Ga0207702_10240263
813 Ga0207702_10342472
814 Ga0207676_10362434
815 Ga0207674_10236565
816 Ga0207674_10256848
817 Ga0207675_100065045
818 Ga0207698_10040977
819 Ga0207698_10151254
820 Ga0209981_1013369
821 Ga0209971_1000773
822 Ga0209974_10000675
823 Ga0268265_10033098
824 Ga0268264_10015234
825 Ga0265334_10043455
826 Ga0265318_10029778
827 Ga0265323_10001069
828 Ga0307511_10000063
829 Ga0265330_10007211
830 Ga0265332_10018367
831 Ga0265332_10058574
832 Ga0265320_10016854
833 Ga0265329_10033235
834 Ga0265340_10002393
835 Ga0265339_10007250
836 Ga0265339_10122166
837 Ga0265331_10055712
838 Ga0265327_10001563
839 Ga0265327_10013020
840 Ga0265327_10025480
841 Ga0265327_10065614
842 Ga0265316_10011830
843 Ga0265316_10023131
844 Ga0265316_10105500
845 Ga0307408_100000040
846 Ga0307408_100000330
847 Ga0307408_100002008
848 Ga0307408_100006042
849 Ga0307408_100029022
850 Ga0307408_100136926
851 Ga0265313_10109343
852 Ga0265314_10002337
853 Ga0265314_10149096
854 Ga0265342_10000052
855 Ga0265342_10000541
856 Ga0265342_10079624
857 Ga0307516_10011905
858 Ga0307516_10072136
859 Ga0307405_10039298
860 Ga0307413_10002470
861 Ga0307410_10020191
862 Ga0307406_10009729
863 Ga0307407_10080821
864 Ga0307412_10015839
865 Ga0307412_10044372
866 Ga0307409_100002685
867 Ga0307414_10003386
868 Ga0307414_10053032
869 Ga0307415_100028512
870 Ga0307510_10017380
871 Ga0373961_0026900
872 Ga0395899_0000246
873 Ga0395899_0000613
874 Ga0395899_0000963
875 Ga0395900_0000435
876 Ga0395900_0000540
877 Ga0395900_0006688
878 Ga0395900_0014043
879 Ga0395898_0008561
880 Ga0395905_0001728
881 Ga0395905_0006231
882 Ga0395905_0007452
883 Ga0395905_0017913
884 Ga0395905_0284941
885 Ga0436364_0741378
886 Ga0395901_0000082
887 Ga0395901_0000599
888 Ga0395901_0003312
889 Ga0395901_0019273
890 Ga0400484_21715
891 Ga0400490_10479
892 Ga0400483_031157
893 Ga0400483_038110
894 Ga0400483_039039
895 Ga0400483_116214
896 Ga0400483_219096
897 Ga0400483_238768
898 Ga0400483_288870
899 Ga0436361_0540516
900 Ga0436362_1299585
901 Ga0451845_0408387
902 Ga0451847_0830035
903 Ga0451851_0572074
904 Ga0439451_000029
905 Ga0439463_006258
906 Ga0439463_008131
907 Ga0450906_000038
908 Ga0451577_0000852
909 Ga0451577_0010409
910 Ga0466972_0014473
911 Ga0453683_0028779
912 Ga0453683_0034084
913 Ga0453683_0074614
914 Ga0466965_0048475
915 Ga0466966_0001048
916 Ga0453684_0000264
917 Ga0453684_0002092
918 Ga0453684_0017978
919 Ga0453684_0058351
920 Ga0453684_0076625
921 Ga0453684_0105591
922 Ga0453684_0208240
923 Ga0453684_0250958
924 Ga0453684_0297881
925 Ga0466970_0015010
926 Ga0451576_0000229
927 Ga0451576_0000691
928 Ga0451576_0002540
929 Ga0451576_0014619
930 Ga0451576_0275292
931 Ga0466967_0485504
932 Ga0495590_0000338
933 Ga0495651_0084099
934 Ga0495584_0002958
935 Ga0495585_0015743
936 Ga0495585_0052827
937 Ga0495583_0000460
938 Ga0495606_0002199
939 Ga0495637_0000574
940 Ga0495644_0007634
941 Ga0495642_0000058
942 Ga0495654_0000711
943 Ga0495597_0000822
944 Ga0495625_0001324
945 Ga0495625_0003740
946 Ga0495661_0012810
947 Ga0495669_0002968
948 Ga0495649_0000913
949 Ga0495672_0105785
950 Ga0495686_0106462
951 Ga0495686_0118833
952 Ga0495626_0001439
953 Ga0496108_0184105
954 Ga0496110_0000755
955 Ga0496111_0043005
956 Ga0496114_0175790
957 Ga0496114_0356348
958 Ga0496115_0242130
959 Ga0496116_0019311
960 Ga0496116_0025121
961 Ga0496117_0001860
962 Ga0496118_0001427
963 Ga0496119_0021895
964 Ga0496120_0010214
965 Ga0496121_0002976
966 Ga0496121_0143333
967 Ga0496122_0000014
968 Ga0496122_0000021
969 Ga0496122_0002040
970 Ga0496122_0012631
971 Ga0496123_0000382
972 Ga0496123_0001660
973 Ga0496123_0003828
974 Ga0496123_0005958
975 Ga0496124_0007489
976 Ga0496124_0024142
977 Ga0496125_0004710
978 Ga0496126_0000019
979 Ga0496126_0002235
980 Ga0495678_006899
981 Ga0501034_0003487
982 Ga0501067_0057845
983 Ga0501073_0029754
984 Ga0501074_0021176
985 Ga0501074_0249001
986 Ga0501077_0011677
987 Ga0501236_002184
988 Ga0501247_001609
989 Ga0501079_0029981
990 Ga0501241_000132
991 Ga0501241_000308
992 Ga0501264_001786
993 Ga0501035_0003553
994 Ga0501044_0278789
995 nmdc:mga03683_21069_c1
996 nmdc:mga03n38_37782_c1
997 nmdc:mga0yw44_90771_c1
998 nmdc:mga0k408_1459_c1
999 nmdc:mga0k408_6251_c1
1000 nmdc:mga0k408_68735_c1
1001 nmdc:mga0k408_800_c1
1002 nmdc:mga06z11_1646_c1
1003 nmdc:mga06z11_68033_c1
1004 nmdc:mga07m45_159105_c1
1005 nmdc:mga07m45_36467_c1
1006 nmdc:mga05p37_415639_c1
1007 nmdc:mga05p37_475694_c1
1008 nmdc:mga05p37_51760_c1
1009 nmdc:mga09592_2771_c1
1010 nmdc:mga0qj67_227704_c1
1011 nmdc:mga06r32_2535_c1
1012 nmdc:mga0rr50_477806_c1
1013 nmdc:mga08x19_10432_c1
1014 nmdc:mga0a205_93796_c1
1015 nmdc:mga0sz30_97977_c1
1016 Ga0500644_0000069
1017 Ga0500646_0005200
1018 Ga0500646_0005387
1019 Ga0500646_0017932
1020 Ga0500583_0058025
1021 Ga0500658_0032181
1022 Ga0500568_0010204
1023 Ga0500604_0000448
1024 Ga0500616_0030999
1025 Ga0500622_0000199
1026 Ga0501084_0021201
1027 Ga0587082_000790
1028 Ga0587088_010191
1029 Ga0501082_0013318
1030 2509388385
1031 2510131446
1032 2510897799
1033 2511339359
1034 2513570666
1035 2513632180
1036 2513713337
1037 2514021027
1038 2515110407
1039 2515642864
1040 2515659614
1041 2517039096
1042 2585992882
1043 2599887576
1044 2599899945
1045 2599941845
1046 2599952635
1047 2599960522
1048 2600017438
1049 2600052261
1050 2601640433
1051 2671090237
1052 2678262556
1053 2719179601
1054 2719663953
1055 2719730271
1056 2720490372
1057 2720611741
1058 2720629998
1059 2720773693
1060 2721145694
1061 2721157210
1062 2721162573
1063 2722838743
1064 2723025371
1065 2723558954
1066 2723565519
1067 2724043027
1068 2724088300
1069 2724102784
1070 2724108684
1071 2730106307
1072 2730162838
1073 2730296842
1074 2738809663
1075 2738897023
1076 2745008898
1077 2793315399
1078 2793341773
1079 2793350774
1080 2793362743
1081 2793364704
1082 2805931540
1083 2805932339
1084 2808923653
1085 2808945583
1086 2838020321
1087 2838044388
1088 2838051469
1089 2838073663
1090 2838680613
1091 2838695354
1092 2838708730
1093 2841866782
1094 2842080035
1095 2842112235
1096 2842120654
1097 2842206920
1098 2842218763
1099 2842238142
1100 2842267412
1101 2842280387
1102 2842293695
1103 2842343046
1104 2842367231
1105 2842371076
1106 2842380092
1107 2842387163
1108 2842427111
1109 2842431336
1110 2842437671
1111 2842444486
1112 2842465686
1113 2842472496
1114 2842492429
1115 2846038047
1116 2884813800
1117 2884839757
1118 2884856432
1119 2894510803
1120 2896158798
1121 2913038536
1122 2929178078
1123 2929244006
1124 2933587564
1125 2933604091
1126 2935895877
1127 2936365832
1128 2936368897
1129 2936377023
1130 2936383780
1131 2945980439
1132 2946013700
1133 2977978354
1134 2989393123
1135 3005451814
1136 8005283611
1137 8005291054
1138 8005377405
1139 8005387263
1140 8005432962
1141 8005461046
1142 8005498695
1143 8005560668
1144 8005619890
1145 8005628455
1146 8005670106
1147 8005690299
1148 8007372807
1149 8007378590
1150 8018133153
1151 8018167862
1152 8024501567
1153 8054505728
1154 8056375661
1155 8056385977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

68

303

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

69

370

0.92

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

69

299

0.86

PF07993

NAD_binding_4

Male sterility protein

70

260

0.85

PF00106

adh_short

short chain dehydrogenase

66

229

0.81

PF04321

RmlD_sub_bind

RmlD substrate binding domain

66

376

0.77

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

68

340

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpk-assembly1.cif.gz_D crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9323 1 312
2pk3-assembly1.cif.gz_B crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase 0.9308 2 312
6q94-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9278 1 312
4lw8-assembly1.cif.gz_B crystal structure of a putative epimerase from burkholderia cenocepacia j2315 0.9275 2 311
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9259 2 310
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 2 238 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9262 2 296 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 2 296 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9189 2 238 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9144 2 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A849GSL6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.991 66 326
AF-A0A5D0UHD6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9882 2 326 GO:0016831
AF-A0A849GSL6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9834 66 326
AF-A0A5D0UHD6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9822 2 326 GO:0016831
AF-A0A496U4I3-F1-model_v4 NAD-dependent dehydratase 0.9807 2 316

Map