F465680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 577 | 325 | 541 | 273 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221699|2644547764 |
| Length | 312 |
| Sequence | EGWNMPTGELMKGKKGLIMGVANANSIAWGIASQLAAQGAELAFTYLGEGLERRVRPLAESVGAKLLIQADVTDDASMDAAFAELEKAFGTIDFVIHSVAFANKDELKGSFVDNTSRDSFLLAMNISAFSFVDVAKRASKLMPNGGSLVTMTYLGSERAIPNYNTMGVAKAALEAATRYIARDLGPKGIRCNAISAGAMRTLSLAGISGGRGMISQGRAMSAMKEDTSMEGVAGAALWLCSDLGFSALSGGRGMISQGRAMSAMKEDTSMEGVAGAALWLCSDLGFSTTGEVIHVDAGFHMMGMAADEEAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 9 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 10 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 11 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 12 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 13 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 14 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 15 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 16 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 17 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 18 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 19 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 20 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 21 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 22 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 23 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 24 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 25 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 26 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 27 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 28 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 29 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 30 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 31 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 32 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 33 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 34 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 35 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 36 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 195 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 285 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 293 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 296 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 297 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 299 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 301 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 302 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 306 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 309 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 313 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 314 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 316 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 319 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 320 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 321 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.41 |
| Metatranscriptomes | 0.35 |
| Isolates | 6.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.45 |
| Nodule | 0 |
| Rhizoplane | 3.99 |
| Rhizosphere | 65.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10016413 | 3300003215 | Bacteria | 2966 |
| 2 | JGI25153J46596_10032502 | 3300003215 | Bacteria | 1739 |
| 3 | rootL2_10075538 | 3300003322 | Bacteria | 2431 |
| 4 | rootL2_10076302 | 3300003322 | Bacteria | 3930 |
| 5 | Ga0006562J51391_1043118 | 3300003578 | Bacteria | 6110 |
| 6 | Ga0006562J51391_1043120 | 3300003578 | Bacteria | 6930 |
| 7 | Ga0055537_1003051 | 3300003773 | Bacteria | 5285 |
| 8 | Ga0055524_1004063 | 3300003775 | Bacteria | 6876 |
| 9 | Ga0055536_1001509 | 3300003781 | Bacteria | 13975 |
| 10 | Ga0055536_1004147 | 3300003781 | Bacteria | 7510 |
| 11 | Ga0055528_1003297 | 3300003790 | Bacteria | 8203 |
| 12 | Ga0055530_10004450 | 3300003791 | Bacteria | 7197 |
| 13 | Ga0055530_10006764 | 3300003791 | Bacteria | 5004 |
| 14 | Ga0055530_10009547 | 3300003791 | Bacteria | 3711 |
| 15 | Ga0055531_10000473 | 3300003794 | Bacteria | 37228 |
| 16 | Ga0055531_10007442 | 3300003794 | Bacteria | 5976 |
| 17 | Ga0055531_10012236 | 3300003794 | Bacteria | 4054 |
| 18 | Ga0055531_10043766 | 3300003794 | Bacteria | 1264 |
| 19 | Ga0065165_1001792 | 3300005262 | Bacteria | 21168 |
| 20 | Ga0070658_10003653 | 3300005327 | Bacteria | 12599 |
| 21 | Ga0070658_10009406 | 3300005327 | Bacteria | 7851 |
| 22 | Ga0070658_10060026 | 3300005327 | Bacteria | 3096 |
| 23 | Ga0070658_10115988 | 3300005327 | Bacteria | 2222 |
| 24 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 25 | Ga0070670_100035149 | 3300005331 | Bacteria | 4314 |
| 26 | Ga0070670_100091271 | 3300005331 | Bacteria | 2618 |
| 27 | Ga0070682_100446740 | 3300005337 | Bacteria | 989 |
| 28 | Ga0070691_10017725 | 3300005341 | Bacteria | 3277 |
| 29 | Ga0070661_100216675 | 3300005344 | Bacteria | 1467 |
| 30 | Ga0070668_100001026 | 3300005347 | Bacteria | 19578 |
| 31 | Ga0070668_100002884 | 3300005347 | Bacteria | 12687 |
| 32 | Ga0070668_100002963 | 3300005347 | Bacteria | 12551 |
| 33 | Ga0070668_100004810 | 3300005347 | Bacteria | 10014 |
| 34 | Ga0070668_100005098 | 3300005347 | Bacteria | 9728 |
| 35 | Ga0070668_100050299 | 3300005347 | Bacteria | 3209 |
| 36 | Ga0070668_100061068 | 3300005347 | Bacteria | 2920 |
| 37 | Ga0070669_100016959 | 3300005353 | Bacteria | 5201 |
| 38 | Ga0070671_100006295 | 3300005355 | Bacteria | 9463 |
| 39 | Ga0070671_100014773 | 3300005355 | Bacteria | 6310 |
| 40 | Ga0070671_100172682 | 3300005355 | Bacteria | 1828 |
| 41 | Ga0070673_100257574 | 3300005364 | Bacteria | 1523 |
| 42 | Ga0070659_100001009 | 3300005366 | Bacteria | 20680 |
| 43 | Ga0070659_100024167 | 3300005366 | Bacteria | 4656 |
| 44 | Ga0070659_100117271 | 3300005366 | Bacteria | 2153 |
| 45 | Ga0070667_100000105 | 3300005367 | Bacteria | 106633 |
| 46 | Ga0070667_100007531 | 3300005367 | Bacteria | 9031 |
| 47 | Ga0070662_100213139 | 3300005457 | Bacteria | 1538 |
| 48 | Ga0070681_10008308 | 3300005458 | Bacteria | 10166 |
| 49 | Ga0070681_10023353 | 3300005458 | Bacteria | 6218 |
| 50 | Ga0070679_100007148 | 3300005530 | Bacteria | 10420 |
| 51 | Ga0070679_100085543 | 3300005530 | Bacteria | 3140 |
| 52 | Ga0068853_100037873 | 3300005539 | Bacteria | 4106 |
| 53 | Ga0068853_100061011 | 3300005539 | Bacteria | 3261 |
| 54 | Ga0068853_100077132 | 3300005539 | Bacteria | 2911 |
| 55 | Ga0070686_100044060 | 3300005544 | Bacteria | 2802 |
| 56 | Ga0070665_100000667 | 3300005548 | Bacteria | 46192 |
| 57 | Ga0070665_100000721 | 3300005548 | Bacteria | 44003 |
| 58 | Ga0070665_100000784 | 3300005548 | Bacteria | 41804 |
| 59 | Ga0070665_100009966 | 3300005548 | Bacteria | 9611 |
| 60 | Ga0070665_100144988 | 3300005548 | Bacteria | 2378 |
| 61 | Ga0070665_100330983 | 3300005548 | Bacteria | 1528 |
| 62 | Ga0068855_100017453 | 3300005563 | Bacteria | 8633 |
| 63 | Ga0068855_100088878 | 3300005563 | Bacteria | 3568 |
| 64 | Ga0068855_100170646 | 3300005563 | Bacteria | 2464 |
| 65 | Ga0068854_100591000 | 3300005578 | Bacteria | 946 |
| 66 | Ga0068856_100355057 | 3300005614 | Bacteria | 1485 |
| 67 | Ga0068852_100008074 | 3300005616 | Bacteria | 7723 |
| 68 | Ga0068852_100187617 | 3300005616 | Bacteria | 1948 |
| 69 | Ga0068859_100001326 | 3300005617 | Bacteria | 25257 |
| 70 | Ga0068864_100000058 | 3300005618 | Bacteria | 125688 |
| 71 | Ga0068864_100000164 | 3300005618 | Bacteria | 61477 |
| 72 | Ga0068864_100011174 | 3300005618 | Bacteria | 7419 |
| 73 | Ga0068864_100068506 | 3300005618 | Bacteria | 3083 |
| 74 | Ga0068864_100346908 | 3300005618 | Bacteria | 1400 |
| 75 | Ga0068861_100077518 | 3300005719 | Bacteria | 2593 |
| 76 | Ga0068863_100000290 | 3300005841 | Bacteria | 52019 |
| 77 | Ga0068863_100017625 | 3300005841 | Bacteria | 6841 |
| 78 | Ga0068863_100032357 | 3300005841 | Bacteria | 4985 |
| 79 | Ga0068863_100187747 | 3300005841 | Bacteria | 1986 |
| 80 | Ga0068863_100202095 | 3300005841 | Bacteria | 1912 |
| 81 | Ga0068863_100246591 | 3300005841 | Bacteria | 1725 |
| 82 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 83 | Ga0068858_100001954 | 3300005842 | Bacteria | 21024 |
| 84 | Ga0068860_100000066 | 3300005843 | Bacteria | 182836 |
| 85 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 86 | Ga0068860_100003889 | 3300005843 | Bacteria | 15347 |
| 87 | Ga0068860_100272912 | 3300005843 | Bacteria | 1651 |
| 88 | Ga0068860_100332577 | 3300005843 | Bacteria | 1492 |
| 89 | Ga0068862_100007824 | 3300005844 | Bacteria | 8842 |
| 90 | Ga0068862_100009828 | 3300005844 | Bacteria | 7903 |
| 91 | Ga0068862_100013342 | 3300005844 | Bacteria | 6799 |
| 92 | Ga0068862_100017696 | 3300005844 | Bacteria | 5933 |
| 93 | Ga0068862_100025245 | 3300005844 | Bacteria | 4989 |
| 94 | Ga0068862_100255620 | 3300005844 | Bacteria | 1598 |
| 95 | Ga0075368_10018193 | 3300006042 | Bacteria | 2638 |
| 96 | Ga0075363_100121989 | 3300006048 | Bacteria | 1456 |
| 97 | Ga0075364_10000415 | 3300006051 | Bacteria | 21345 |
| 98 | Ga0075364_10147652 | 3300006051 | Bacteria | 1584 |
| 99 | Ga0075367_10014430 | 3300006178 | Bacteria | 4277 |
| 100 | Ga0075369_10002774 | 3300006186 | Bacteria | 6291 |
| 101 | Ga0075369_10051639 | 3300006186 | Bacteria | 1780 |
| 102 | Ga0075370_10025765 | 3300006353 | Bacteria | 3254 |
| 103 | Ga0075370_10105253 | 3300006353 | Bacteria | 1635 |
| 104 | Ga0068865_100002365 | 3300006881 | Bacteria | 11133 |
| 105 | Ga0097620_100001326 | 3300006931 | Bacteria | 25257 |
| 106 | Ga0105250_10017473 | 3300009092 | Bacteria | 2917 |
| 107 | Ga0105240_10009648 | 3300009093 | Bacteria | 13651 |
| 108 | Ga0105240_10088456 | 3300009093 | Bacteria | 3790 |
| 109 | Ga0105240_10137996 | 3300009093 | Bacteria | 2918 |
| 110 | Ga0105240_10219399 | 3300009093 | Bacteria | 2217 |
| 111 | Ga0105240_10373553 | 3300009093 | Bacteria | 1611 |
| 112 | Ga0105240_10500583 | 3300009093 | Bacteria | 1351 |
| 113 | Ga0105245_10885705 | 3300009098 | Bacteria | 934 |
| 114 | Ga0105241_10338028 | 3300009174 | Bacteria | 1304 |
| 115 | Ga0105242_10306750 | 3300009176 | Bacteria | 1451 |
| 116 | Ga0105248_10000650 | 3300009177 | Bacteria | 39474 |
| 117 | Ga0105248_10000746 | 3300009177 | Bacteria | 36566 |
| 118 | Ga0105248_10223313 | 3300009177 | Bacteria | 2121 |
| 119 | Ga0105237_10097435 | 3300009545 | Bacteria | 2931 |
| 120 | Ga0105237_10329812 | 3300009545 | Bacteria | 1530 |
| 121 | Ga0105238_10076749 | 3300009551 | Bacteria | 3333 |
| 122 | Ga0105238_10365036 | 3300009551 | Bacteria | 1434 |
| 123 | Ga0105238_10448837 | 3300009551 | Bacteria | 1286 |
| 124 | Ga0105238_10603548 | 3300009551 | Bacteria | 1106 |
| 125 | Ga0105249_10003268 | 3300009553 | Bacteria | 14047 |
| 126 | Ga0105249_10074695 | 3300009553 | Bacteria | 3138 |
| 127 | Ga0105249_10284378 | 3300009553 | Bacteria | 1653 |
| 128 | Ga0105249_10299553 | 3300009553 | Bacteria | 1612 |
| 129 | Ga0157373_10003332 | 3300013100 | Bacteria | 12134 |
| 130 | Ga0157373_10004339 | 3300013100 | Bacteria | 10675 |
| 131 | Ga0157373_10262799 | 3300013100 | Bacteria | 1221 |
| 132 | Ga0157371_10007717 | 3300013102 | Bacteria | 8651 |
| 133 | Ga0157370_10032819 | 3300013104 | Bacteria | 5068 |
| 134 | Ga0157369_10135407 | 3300013105 | Bacteria | 2608 |
| 135 | Ga0157374_10199420 | 3300013296 | Bacteria | 1959 |
| 136 | Ga0157378_10510412 | 3300013297 | Bacteria | 1202 |
| 137 | Ga0163162_10088212 | 3300013306 | Bacteria | 3181 |
| 138 | Ga0157372_10278378 | 3300013307 | Bacteria | 1945 |
| 139 | Ga0157375_10047309 | 3300013308 | Bacteria | 4200 |
| 140 | Ga0163163_10004890 | 3300014325 | Bacteria | 11523 |
| 141 | Ga0163163_10331971 | 3300014325 | Bacteria | 1575 |
| 142 | Ga0157379_10018637 | 3300014968 | Bacteria | 6119 |
| 143 | Ga0157379_10483777 | 3300014968 | Bacteria | 1146 |
| 144 | Ga0183365_10005 | 3300015684 | Bacteria | 249619 |
| 145 | Ga0213872_10039000 | 3300021361 | Bacteria | 2168 |
| 146 | Ga0213875_10147955 | 3300021388 | Bacteria | 1100 |
| 147 | Ga0209026_1000608 | 3300025250 | Bacteria | 23009 |
| 148 | Ga0209148_1011417 | 3300025254 | Bacteria | 1651 |
| 149 | Ga0209565_1000172 | 3300025263 | Bacteria | 84264 |
| 150 | Ga0209673_1000451 | 3300025273 | Bacteria | 69853 |
| 151 | Ga0209675_1006240 | 3300025291 | Bacteria | 4822 |
| 152 | Ga0209676_1000217 | 3300025292 | Bacteria | 125740 |
| 153 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 154 | Ga0209676_1000316 | 3300025292 | Bacteria | 94380 |
| 155 | Ga0209676_1003478 | 3300025292 | Bacteria | 9660 |
| 156 | Ga0209564_1004152 | 3300025295 | Bacteria | 9075 |
| 157 | Ga0209758_1001854 | 3300025297 | Bacteria | 23201 |
| 158 | Ga0209758_1003752 | 3300025297 | Bacteria | 13449 |
| 159 | Ga0209758_1006062 | 3300025297 | Bacteria | 8909 |
| 160 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 161 | Ga0209050_1000604 | 3300025298 | Bacteria | 57101 |
| 162 | Ga0209050_1001151 | 3300025298 | Bacteria | 31696 |
| 163 | Ga0209050_1006384 | 3300025298 | Bacteria | 6995 |
| 164 | Ga0209256_1002978 | 3300025299 | Bacteria | 12650 |
| 165 | Ga0209256_1005380 | 3300025299 | Bacteria | 7412 |
| 166 | Ga0209051_1003216 | 3300025303 | Bacteria | 10907 |
| 167 | Ga0209257_1000192 | 3300025304 | Bacteria | 151851 |
| 168 | Ga0209257_1000230 | 3300025304 | Bacteria | 132032 |
| 169 | Ga0209257_1000419 | 3300025304 | Bacteria | 81956 |
| 170 | Ga0209257_1000541 | 3300025304 | Bacteria | 64943 |
| 171 | Ga0209257_1001795 | 3300025304 | Bacteria | 23594 |
| 172 | Ga0209257_1012647 | 3300025304 | Bacteria | 3869 |
| 173 | Ga0207705_10003462 | 3300025909 | Bacteria | 12004 |
| 174 | Ga0207705_10051010 | 3300025909 | Bacteria | 2979 |
| 175 | Ga0207705_10078915 | 3300025909 | Bacteria | 2397 |
| 176 | Ga0207705_10325847 | 3300025909 | Bacteria | 1181 |
| 177 | Ga0207707_10133679 | 3300025912 | Bacteria | 2169 |
| 178 | Ga0207707_10138738 | 3300025912 | Bacteria | 2126 |
| 179 | Ga0207695_10000269 | 3300025913 | Bacteria | 130183 |
| 180 | Ga0207695_10001168 | 3300025913 | Bacteria | 45314 |
| 181 | Ga0207695_10010089 | 3300025913 | Bacteria | 11599 |
| 182 | Ga0207660_10012589 | 3300025917 | Bacteria | 5540 |
| 183 | Ga0207657_10000235 | 3300025919 | Bacteria | 58394 |
| 184 | Ga0207657_10528860 | 3300025919 | Bacteria | 923 |
| 185 | Ga0207652_10005742 | 3300025921 | Bacteria | 10071 |
| 186 | Ga0207681_10078083 | 3300025923 | Bacteria | 2329 |
| 187 | Ga0207681_10126769 | 3300025923 | Bacteria | 1881 |
| 188 | Ga0207694_10022549 | 3300025924 | Bacteria | 4778 |
| 189 | Ga0207694_10177688 | 3300025924 | Bacteria | 1725 |
| 190 | Ga0207694_10276512 | 3300025924 | Bacteria | 1378 |
| 191 | Ga0207694_10550978 | 3300025924 | Bacteria | 968 |
| 192 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 193 | Ga0207650_10326300 | 3300025925 | Bacteria | 1258 |
| 194 | Ga0207644_10024158 | 3300025931 | Bacteria | 4170 |
| 195 | Ga0207690_10000031 | 3300025932 | Bacteria | 154724 |
| 196 | Ga0207690_10083331 | 3300025932 | Bacteria | 2239 |
| 197 | Ga0207706_10013371 | 3300025933 | Bacteria | 7467 |
| 198 | Ga0207706_10280406 | 3300025933 | Bacteria | 1453 |
| 199 | Ga0207691_10222613 | 3300025940 | Bacteria | 1636 |
| 200 | Ga0207711_10000368 | 3300025941 | Bacteria | 47898 |
| 201 | Ga0207711_10000926 | 3300025941 | Bacteria | 28264 |
| 202 | Ga0207711_10001601 | 3300025941 | Bacteria | 20928 |
| 203 | Ga0207711_10055550 | 3300025941 | Bacteria | 3399 |
| 204 | Ga0207711_10186347 | 3300025941 | Bacteria | 1889 |
| 205 | Ga0207711_10333594 | 3300025941 | Bacteria | 1403 |
| 206 | Ga0207667_10015583 | 3300025949 | Bacteria | 8625 |
| 207 | Ga0207667_10131418 | 3300025949 | Bacteria | 2578 |
| 208 | Ga0207667_10187155 | 3300025949 | Bacteria | 2125 |
| 209 | Ga0207667_10319958 | 3300025949 | Bacteria | 1584 |
| 210 | Ga0207667_10508858 | 3300025949 | Bacteria | 1221 |
| 211 | Ga0207651_10340133 | 3300025960 | Bacteria | 1260 |
| 212 | Ga0207712_10016645 | 3300025961 | Bacteria | 4766 |
| 213 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 214 | Ga0207668_10000255 | 3300025972 | Bacteria | 35541 |
| 215 | Ga0207668_10003169 | 3300025972 | Bacteria | 9632 |
| 216 | Ga0207668_10003930 | 3300025972 | Bacteria | 8764 |
| 217 | Ga0207668_10005036 | 3300025972 | Bacteria | 7778 |
| 218 | Ga0207668_10042599 | 3300025972 | Bacteria | 3075 |
| 219 | Ga0207668_10118329 | 3300025972 | Bacteria | 2001 |
| 220 | Ga0207658_10000607 | 3300025986 | Bacteria | 31806 |
| 221 | Ga0207658_10120227 | 3300025986 | Bacteria | 2093 |
| 222 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 223 | Ga0207703_10011217 | 3300026035 | Bacteria | 6973 |
| 224 | Ga0207703_10194347 | 3300026035 | Bacteria | 1799 |
| 225 | Ga0207639_10008668 | 3300026041 | Bacteria | 6979 |
| 226 | Ga0207639_10060936 | 3300026041 | Bacteria | 2912 |
| 227 | Ga0207639_10659534 | 3300026041 | Bacteria | 968 |
| 228 | Ga0207702_10493659 | 3300026078 | Bacteria | 1193 |
| 229 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 230 | Ga0207641_10001763 | 3300026088 | Bacteria | 20861 |
| 231 | Ga0207641_10003861 | 3300026088 | Bacteria | 13121 |
| 232 | Ga0207641_10040183 | 3300026088 | Bacteria | 3915 |
| 233 | Ga0207641_10198483 | 3300026088 | Bacteria | 1848 |
| 234 | Ga0207648_10479835 | 3300026089 | Bacteria | 1135 |
| 235 | Ga0207676_10000175 | 3300026095 | Bacteria | 56138 |
| 236 | Ga0207676_10003810 | 3300026095 | Bacteria | 10658 |
| 237 | Ga0207676_10013622 | 3300026095 | Bacteria | 5837 |
| 238 | Ga0207674_10259120 | 3300026116 | Bacteria | 1686 |
| 239 | Ga0207698_10185146 | 3300026142 | Bacteria | 1849 |
| 240 | Ga0209981_1000576 | 3300027378 | Bacteria | 4652 |
| 241 | Ga0209983_1008035 | 3300027665 | Bacteria | 2157 |
| 242 | Ga0209813_10055546 | 3300027866 | Bacteria | 1251 |
| 243 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 244 | Ga0268266_10000970 | 3300028379 | Bacteria | 36427 |
| 245 | Ga0268266_10004426 | 3300028379 | Bacteria | 13452 |
| 246 | Ga0268266_10021359 | 3300028379 | Bacteria | 5515 |
| 247 | Ga0268266_10061387 | 3300028379 | Bacteria | 3242 |
| 248 | Ga0268265_10005393 | 3300028380 | Bacteria | 8753 |
| 249 | Ga0268265_10025500 | 3300028380 | Bacteria | 4198 |
| 250 | Ga0268265_10243257 | 3300028380 | Bacteria | 1589 |
| 251 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 252 | Ga0268264_10000113 | 3300028381 | Bacteria | 203262 |
| 253 | Ga0268264_10065189 | 3300028381 | Bacteria | 3068 |
| 254 | Ga0268264_10374208 | 3300028381 | Bacteria | 1362 |
| 255 | Ga0265337_1043322 | 3300028556 | Bacteria | 1287 |
| 256 | Ga0265334_10086777 | 3300028573 | Bacteria | 1146 |
| 257 | Ga0307517_10005788 | 3300028786 | Bacteria | 18484 |
| 258 | Ga0307517_10084629 | 3300028786 | Bacteria | 2667 |
| 259 | Ga0307515_10010603 | 3300028794 | Bacteria | 17640 |
| 260 | Ga0307515_10024332 | 3300028794 | Bacteria | 10559 |
| 261 | Ga0265338_10043089 | 3300028800 | Bacteria | 4192 |
| 262 | Ga0265338_10135343 | 3300028800 | Bacteria | 1938 |
| 263 | Ga0265338_10270957 | 3300028800 | Bacteria | 1244 |
| 264 | Ga0265338_10298119 | 3300028800 | Bacteria | 1173 |
| 265 | Ga0265330_10026247 | 3300031235 | Bacteria | 2636 |
| 266 | Ga0265320_10090631 | 3300031240 | Bacteria | 1416 |
| 267 | Ga0265325_10061346 | 3300031241 | Bacteria | 1907 |
| 268 | Ga0265340_10072033 | 3300031247 | Bacteria | 1637 |
| 269 | Ga0265327_10000442 | 3300031251 | Bacteria | 75162 |
| 270 | Ga0265327_10002781 | 3300031251 | Bacteria | 17689 |
| 271 | Ga0265327_10004906 | 3300031251 | Bacteria | 11548 |
| 272 | Ga0265327_10091619 | 3300031251 | Bacteria | 1481 |
| 273 | Ga0265316_10009583 | 3300031344 | Bacteria | 8901 |
| 274 | Ga0307513_10003286 | 3300031456 | Bacteria | 22017 |
| 275 | Ga0307513_10006509 | 3300031456 | Bacteria | 15255 |
| 276 | Ga0307513_10011589 | 3300031456 | Bacteria | 10947 |
| 277 | Ga0265313_10003742 | 3300031595 | Bacteria | 12102 |
| 278 | Ga0265314_10005570 | 3300031711 | Bacteria | 11322 |
| 279 | Ga0265314_10223771 | 3300031711 | Bacteria | 1096 |
| 280 | Ga0307516_10001321 | 3300031730 | Bacteria | 34374 |
| 281 | Ga0307413_10348201 | 3300031824 | Bacteria | 1142 |
| 282 | Ga0307406_10001177 | 3300031901 | Bacteria | 14642 |
| 283 | Ga0307407_10060407 | 3300031903 | Bacteria | 2212 |
| 284 | Ga0307412_10051120 | 3300031911 | Bacteria | 2730 |
| 285 | Ga0307414_10029061 | 3300032004 | Bacteria | 3594 |
| 286 | Ga0307411_10265740 | 3300032005 | Bacteria | 1357 |
| 287 | Ga0307510_10017145 | 3300033180 | Bacteria | 8544 |
| 288 | Ga0373926_0047811 | 3300035083 | Bacteria | 1538 |
| 289 | Ga0373936_0003245 | 3300035113 | Bacteria | 6098 |
| 290 | Ga0373936_0054472 | 3300035113 | Bacteria | 1623 |
| 291 | Ga0373946_0026074 | 3300035171 | Bacteria | 2303 |
| 292 | Ga0373931_0058938 | 3300035691 | Bacteria | 2064 |
| 293 | Ga0373935_0429036 | 3300035692 | Bacteria | 952 |
| 294 | Ga0373927_0000111 | 3300035695 | Bacteria | 62031 |
| 295 | Ga0373933_0123369 | 3300035724 | Bacteria | 1624 |
| 296 | Ga0373947_0040646 | 3300035725 | Bacteria | 2771 |
| 297 | Ga0373937_0485896 | 3300036401 | Bacteria | 1173 |
| 298 | Ga0373925_0000209 | 3300037068 | Bacteria | 64086 |
| 299 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 300 | Ga0395899_0001215 | 3300037312 | Bacteria | 22577 |
| 301 | Ga0395899_0041268 | 3300037312 | Bacteria | 3448 |
| 302 | Ga0395899_0128906 | 3300037312 | Bacteria | 1808 |
| 303 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 304 | Ga0395900_0046092 | 3300037418 | Bacteria | 4489 |
| 305 | Ga0395900_0155202 | 3300037418 | Bacteria | 2338 |
| 306 | Ga0395898_0015320 | 3300037466 | Bacteria | 7864 |
| 307 | Ga0395898_0039155 | 3300037466 | Bacteria | 4693 |
| 308 | Ga0395898_0260792 | 3300037466 | Bacteria | 1653 |
| 309 | Ga0395898_0272461 | 3300037466 | Bacteria | 1614 |
| 310 | Ga0395905_0000156 | 3300037471 | Bacteria | 112215 |
| 311 | Ga0395905_0002451 | 3300037471 | Bacteria | 20546 |
| 312 | Ga0395905_0019172 | 3300037471 | Bacteria | 6487 |
| 313 | Ga0395905_0175035 | 3300037471 | Bacteria | 2015 |
| 314 | Ga0436364_1149156 | 3300037853 | Bacteria | 950 |
| 315 | Ga0436364_1296096 | 3300037853 | Bacteria | 1501 |
| 316 | Ga0395901_0001134 | 3300038443 | Bacteria | 28242 |
| 317 | Ga0395901_0005477 | 3300038443 | Bacteria | 12856 |
| 318 | Ga0395901_0006909 | 3300038443 | Bacteria | 11467 |
| 319 | Ga0395901_0126730 | 3300038443 | Bacteria | 2683 |
| 320 | Ga0395901_0414114 | 3300038443 | Bacteria | 1383 |
| 321 | Ga0436365_0925532 | 3300039437 | Bacteria | 4943 |
| 322 | Ga0436365_1016387 | 3300039437 | Bacteria | 3291 |
| 323 | Ga0436360_0004857 | 3300039438 | Bacteria | 1050 |
| 324 | Ga0436360_0143736 | 3300039438 | Bacteria | 1373 |
| 325 | Ga0436361_1220324 | 3300039447 | Bacteria | 3922 |
| 326 | Ga0436363_0732400 | 3300039450 | Bacteria | 1613 |
| 327 | Ga0436362_0106222 | 3300039453 | Bacteria | 820 |
| 328 | Ga0439445_0016909 | 3300042004 | Bacteria | 1799 |
| 329 | Ga0439459_0008336 | 3300042438 | Bacteria | 1769 |
| 330 | Ga0466969_0008821 | 3300044656 | Bacteria | 5345 |
| 331 | Ga0466966_0000243 | 3300044684 | Bacteria | 36130 |
| 332 | Ga0466961_0001495 | 3300044693 | Bacteria | 14498 |
| 333 | Ga0466961_0031369 | 3300044693 | Bacteria | 3416 |
| 334 | Ga0466961_0219647 | 3300044693 | Bacteria | 1172 |
| 335 | Ga0466963_0358798 | 3300044694 | Bacteria | 1027 |
| 336 | Ga0466971_0002839 | 3300044719 | Bacteria | 7341 |
| 337 | Ga0466970_0002408 | 3300044765 | Bacteria | 9037 |
| 338 | Ga0466957_0004982 | 3300044842 | Bacteria | 7434 |
| 339 | Ga0466959_0007645 | 3300045049 | Bacteria | 7600 |
| 340 | Ga0466959_0121674 | 3300045049 | Bacteria | 1855 |
| 341 | Ga0466959_0158836 | 3300045049 | Bacteria | 1590 |
| 342 | Ga0466958_0004123 | 3300045836 | Bacteria | 7628 |
| 343 | Ga0495627_000655 | 3300046453 | Bacteria | 26680 |
| 344 | Ga0495590_0000533 | 3300046457 | Bacteria | 18274 |
| 345 | Ga0495629_0190954 | 3300046459 | Bacteria | 1418 |
| 346 | Ga0495638_0000630 | 3300046460 | Bacteria | 38937 |
| 347 | Ga0495638_0005885 | 3300046460 | Bacteria | 9012 |
| 348 | Ga0495638_0007935 | 3300046460 | Bacteria | 7570 |
| 349 | Ga0495638_0060249 | 3300046460 | Bacteria | 2348 |
| 350 | Ga0495650_0000168 | 3300046471 | Bacteria | 145714 |
| 351 | Ga0495585_0098335 | 3300046492 | Bacteria | 1568 |
| 352 | Ga0495607_0094437 | 3300046501 | Bacteria | 1613 |
| 353 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 354 | Ga0495606_0003044 | 3300046507 | Bacteria | 18275 |
| 355 | Ga0495610_0000304 | 3300046512 | Bacteria | 51895 |
| 356 | Ga0495610_0000327 | 3300046512 | Bacteria | 50683 |
| 357 | Ga0495610_0018028 | 3300046512 | Bacteria | 4002 |
| 358 | Ga0495616_0000424 | 3300046513 | Bacteria | 32547 |
| 359 | Ga0495631_0000936 | 3300046518 | Bacteria | 18204 |
| 360 | Ga0495632_0000704 | 3300046519 | Bacteria | 30414 |
| 361 | Ga0495632_0018593 | 3300046519 | Bacteria | 3809 |
| 362 | Ga0495637_0041553 | 3300046520 | Bacteria | 1971 |
| 363 | Ga0495637_0073235 | 3300046520 | Bacteria | 1378 |
| 364 | Ga0495643_0086072 | 3300046522 | Bacteria | 1628 |
| 365 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 366 | Ga0495642_0002890 | 3300046528 | Bacteria | 6853 |
| 367 | Ga0495642_0045401 | 3300046528 | Bacteria | 1796 |
| 368 | Ga0495654_0000085 | 3300046530 | Bacteria | 107010 |
| 369 | Ga0495654_0095575 | 3300046530 | Bacteria | 1374 |
| 370 | Ga0495621_0005555 | 3300046539 | Bacteria | 3631 |
| 371 | Ga0495645_0011398 | 3300046543 | Bacteria | 6255 |
| 372 | Ga0495645_0181120 | 3300046543 | Bacteria | 1444 |
| 373 | Ga0495622_0002815 | 3300046557 | Bacteria | 8296 |
| 374 | Ga0495633_0000400 | 3300046558 | Bacteria | 45378 |
| 375 | Ga0495668_0000746 | 3300046616 | Bacteria | 38674 |
| 376 | Ga0495668_0002777 | 3300046616 | Bacteria | 13961 |
| 377 | Ga0495668_0014958 | 3300046616 | Bacteria | 4540 |
| 378 | Ga0495668_0027699 | 3300046616 | Bacteria | 3211 |
| 379 | Ga0495668_0044627 | 3300046616 | Bacteria | 2463 |
| 380 | Ga0495668_0097116 | 3300046616 | Bacteria | 1612 |
| 381 | Ga0495611_0025585 | 3300046648 | Bacteria | 2573 |
| 382 | Ga0495625_0000767 | 3300046660 | Bacteria | 44760 |
| 383 | Ga0495625_0005395 | 3300046660 | Bacteria | 11685 |
| 384 | Ga0495625_0011200 | 3300046660 | Bacteria | 7333 |
| 385 | Ga0495625_0013345 | 3300046660 | Bacteria | 6604 |
| 386 | Ga0495625_0015310 | 3300046660 | Bacteria | 6078 |
| 387 | Ga0495625_0050437 | 3300046660 | Bacteria | 2986 |
| 388 | Ga0495625_0177851 | 3300046660 | Bacteria | 1417 |
| 389 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 390 | Ga0495669_0000731 | 3300046684 | Bacteria | 14261 |
| 391 | Ga0495669_0002870 | 3300046684 | Bacteria | 7073 |
| 392 | Ga0495669_0087647 | 3300046684 | Bacteria | 1435 |
| 393 | Ga0495613_0000049 | 3300046689 | Bacteria | 122792 |
| 394 | Ga0495649_0000077 | 3300046694 | Bacteria | 84222 |
| 395 | Ga0495589_0001462 | 3300046794 | Bacteria | 13600 |
| 396 | Ga0495660_0012648 | 3300046810 | Bacteria | 4899 |
| 397 | Ga0495660_0020528 | 3300046810 | Bacteria | 3787 |
| 398 | Ga0495581_0030427 | 3300047315 | Bacteria | 3128 |
| 399 | Ga0495636_0065022 | 3300047318 | Bacteria | 1549 |
| 400 | Ga0495672_0000928 | 3300047320 | Bacteria | 30608 |
| 401 | Ga0495672_0135041 | 3300047320 | Bacteria | 1294 |
| 402 | Ga0495683_0075943 | 3300047323 | Bacteria | 1645 |
| 403 | Ga0495679_001129 | 3300047446 | Bacteria | 16011 |
| 404 | Ga0495685_097256 | 3300047447 | Bacteria | 973 |
| 405 | Ga0495673_0000341 | 3300047469 | Bacteria | 59080 |
| 406 | Ga0495673_0001283 | 3300047469 | Bacteria | 20512 |
| 407 | Ga0495681_0027009 | 3300047470 | Bacteria | 2977 |
| 408 | Ga0495686_0000747 | 3300047472 | Bacteria | 43114 |
| 409 | Ga0495686_0011091 | 3300047472 | Bacteria | 6368 |
| 410 | Ga0495686_0063586 | 3300047472 | Bacteria | 2286 |
| 411 | Ga0495602_0398319 | 3300048088 | Bacteria | 982 |
| 412 | Ga0496101_0151747 | 3300048904 | Bacteria | 1773 |
| 413 | Ga0496101_0331904 | 3300048904 | Bacteria | 1194 |
| 414 | Ga0496102_0024604 | 3300048905 | Bacteria | 5354 |
| 415 | Ga0496102_0026068 | 3300048905 | Bacteria | 5210 |
| 416 | Ga0496103_0180468 | 3300048906 | Bacteria | 1357 |
| 417 | Ga0496106_0000700 | 3300048909 | Bacteria | 24093 |
| 418 | Ga0496106_0217607 | 3300048909 | Bacteria | 1523 |
| 419 | Ga0496107_0000039 | 3300048910 | Bacteria | 77588 |
| 420 | Ga0496107_0043896 | 3300048910 | Bacteria | 3213 |
| 421 | Ga0496107_0146951 | 3300048910 | Bacteria | 1743 |
| 422 | Ga0496109_0121267 | 3300048912 | Bacteria | 2436 |
| 423 | Ga0496110_0158936 | 3300048913 | Bacteria | 2048 |
| 424 | Ga0496111_0096490 | 3300048914 | Bacteria | 2170 |
| 425 | Ga0496112_0104960 | 3300048915 | Bacteria | 2795 |
| 426 | Ga0496112_0230569 | 3300048915 | Bacteria | 1806 |
| 427 | Ga0496112_0410367 | 3300048915 | Bacteria | 1294 |
| 428 | Ga0496115_0000460 | 3300048918 | Bacteria | 32584 |
| 429 | Ga0496115_0000467 | 3300048918 | Bacteria | 32205 |
| 430 | Ga0496115_0003347 | 3300048918 | Bacteria | 11499 |
| 431 | Ga0496115_0023054 | 3300048918 | Bacteria | 4829 |
| 432 | Ga0496115_0023938 | 3300048918 | Bacteria | 4743 |
| 433 | Ga0496115_0118120 | 3300048918 | Bacteria | 2181 |
| 434 | Ga0496115_0409535 | 3300048918 | Bacteria | 1099 |
| 435 | Ga0496116_0012484 | 3300048919 | Bacteria | 6938 |
| 436 | Ga0496117_0015210 | 3300048920 | Bacteria | 6580 |
| 437 | Ga0496118_0006612 | 3300048921 | Bacteria | 12659 |
| 438 | Ga0496119_0051361 | 3300048922 | Bacteria | 2534 |
| 439 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 440 | Ga0496121_0001159 | 3300048924 | Bacteria | 46235 |
| 441 | Ga0496121_0299484 | 3300048924 | Bacteria | 1092 |
| 442 | Ga0496122_0007549 | 3300048925 | Bacteria | 12037 |
| 443 | Ga0496123_0000968 | 3300048926 | Bacteria | 44375 |
| 444 | Ga0496124_0006081 | 3300048927 | Bacteria | 13274 |
| 445 | Ga0496125_0001013 | 3300048928 | Bacteria | 43693 |
| 446 | Ga0496125_0014570 | 3300048928 | Bacteria | 7651 |
| 447 | Ga0496125_0026301 | 3300048928 | Bacteria | 5307 |
| 448 | Ga0496126_0029844 | 3300048929 | Bacteria | 5176 |
| 449 | Ga0495678_002301 | 3300049459 | Bacteria | 13182 |
| 450 | Ga0495682_0066544 | 3300049460 | Bacteria | 1299 |
| 451 | Ga0501033_0002580 | 3300049570 | Bacteria | 15275 |
| 452 | Ga0501034_0001020 | 3300049571 | Bacteria | 40131 |
| 453 | Ga0501034_0005292 | 3300049571 | Bacteria | 14152 |
| 454 | Ga0501034_0247068 | 3300049571 | Bacteria | 1729 |
| 455 | Ga0501034_0372117 | 3300049571 | Bacteria | 1355 |
| 456 | Ga0501036_0196037 | 3300049572 | Bacteria | 1699 |
| 457 | Ga0501037_0012688 | 3300049573 | Bacteria | 6207 |
| 458 | Ga0501037_0494371 | 3300049573 | Bacteria | 830 |
| 459 | Ga0501039_0480881 | 3300049575 | Bacteria | 975 |
| 460 | Ga0501043_0020099 | 3300049579 | Bacteria | 5242 |
| 461 | Ga0501043_0145535 | 3300049579 | Bacteria | 1856 |
| 462 | Ga0501047_0006163 | 3300049581 | Bacteria | 11276 |
| 463 | Ga0501047_0006395 | 3300049581 | Bacteria | 11080 |
| 464 | Ga0501047_0107689 | 3300049581 | Bacteria | 2669 |
| 465 | Ga0501048_0045657 | 3300049582 | Bacteria | 3129 |
| 466 | Ga0501070_0096934 | 3300049586 | Bacteria | 2440 |
| 467 | Ga0501238_001447 | 3300049671 | Bacteria | 2755 |
| 468 | Ga0501035_0007673 | 3300049822 | Bacteria | 10079 |
| 469 | Ga0501044_0012706 | 3300049823 | Bacteria | 9120 |
| 470 | Ga0501044_0047950 | 3300049823 | Bacteria | 4417 |
| 471 | Ga0501044_0158885 | 3300049823 | Bacteria | 2238 |
| 472 | Ga0501044_0678509 | 3300049823 | Bacteria | 917 |
| 473 | nmdc:mga03n38_125582_c1 | 3300050490 | Bacteria | 1266 |
| 474 | nmdc:mga00v17_494_c1 | 3300050491 | Bacteria | 22171 |
| 475 | nmdc:mga0k408_13076_c1 | 3300050493 | Bacteria | 4545 |
| 476 | nmdc:mga06z11_68743_c1 | 3300050494 | Bacteria | 1377 |
| 477 | nmdc:mga0sz30_6092_c1 | 3300050516 | Bacteria | 4463 |
| 478 | Ga0500635_0000236 | 3300053080 | Bacteria | 24446 |
| 479 | Ga0500635_0000399 | 3300053080 | Bacteria | 13188 |
| 480 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 481 | Ga0500578_0267067 | 3300053086 | Bacteria | 1025 |
| 482 | Ga0500643_016809 | 3300053087 | Bacteria | 2467 |
| 483 | Ga0500643_024568 | 3300053087 | Bacteria | 1911 |
| 484 | Ga0500644_0000124 | 3300053088 | Bacteria | 47262 |
| 485 | Ga0500644_0002839 | 3300053088 | Bacteria | 4305 |
| 486 | Ga0500644_0005283 | 3300053088 | Bacteria | 3255 |
| 487 | Ga0500647_0004390 | 3300053091 | Bacteria | 5670 |
| 488 | Ga0500583_0009227 | 3300053092 | Bacteria | 3593 |
| 489 | Ga0500651_0021284 | 3300053093 | Bacteria | 4042 |
| 490 | Ga0500651_0027381 | 3300053093 | Bacteria | 3585 |
| 491 | Ga0500651_0133214 | 3300053093 | Bacteria | 1502 |
| 492 | Ga0500641_0004493 | 3300053096 | Bacteria | 4928 |
| 493 | Ga0500641_0105058 | 3300053096 | Bacteria | 1213 |
| 494 | Ga0500641_0126450 | 3300053096 | Bacteria | 1102 |
| 495 | Ga0500554_002981 | 3300053102 | Bacteria | 3400 |
| 496 | Ga0500555_000832 | 3300053103 | Bacteria | 11017 |
| 497 | Ga0500555_013451 | 3300053103 | Bacteria | 2361 |
| 498 | Ga0500556_0000933 | 3300053104 | Bacteria | 15845 |
| 499 | Ga0500556_0001668 | 3300053104 | Bacteria | 8614 |
| 500 | Ga0500562_000309 | 3300053108 | Bacteria | 11881 |
| 501 | Ga0500569_014045 | 3300053109 | Bacteria | 1975 |
| 502 | Ga0500572_000593 | 3300053111 | Bacteria | 12235 |
| 503 | Ga0500594_0000058 | 3300053118 | Bacteria | 34612 |
| 504 | Ga0500595_038518 | 3300053119 | Bacteria | 1553 |
| 505 | Ga0500608_000011 | 3300053122 | Bacteria | 92215 |
| 506 | Ga0500608_000096 | 3300053122 | Bacteria | 35522 |
| 507 | Ga0500608_033133 | 3300053122 | Bacteria | 2457 |
| 508 | Ga0500614_016440 | 3300053123 | Bacteria | 1660 |
| 509 | Ga0500614_040219 | 3300053123 | Bacteria | 1185 |
| 510 | Ga0500618_000159 | 3300053125 | Bacteria | 56114 |
| 511 | Ga0500642_0133841 | 3300053130 | Bacteria | 1162 |
| 512 | Ga0500658_0022120 | 3300053134 | Bacteria | 2413 |
| 513 | Ga0500559_0000004 | 3300053136 | Bacteria | 241551 |
| 514 | Ga0500559_0000009 | 3300053136 | Bacteria | 174153 |
| 515 | Ga0500564_000063 | 3300053138 | Bacteria | 28411 |
| 516 | Ga0500577_0001434 | 3300053142 | Bacteria | 6106 |
| 517 | Ga0500590_073723 | 3300053148 | Bacteria | 1691 |
| 518 | Ga0500603_018874 | 3300053150 | Bacteria | 1667 |
| 519 | Ga0500616_0020318 | 3300053153 | Bacteria | 3732 |
| 520 | Ga0500616_0028673 | 3300053153 | Bacteria | 3067 |
| 521 | Ga0500619_013183 | 3300053154 | Bacteria | 2184 |
| 522 | Ga0500622_0000346 | 3300053156 | Bacteria | 45265 |
| 523 | Ga0500622_0010123 | 3300053156 | Bacteria | 5192 |
| 524 | Ga0500622_0047939 | 3300053156 | Bacteria | 2205 |
| 525 | Ga0500624_006243 | 3300053157 | Bacteria | 1607 |
| 526 | Ga0500627_0004864 | 3300053158 | Bacteria | 4381 |
| 527 | Ga0500633_0156059 | 3300053160 | Bacteria | 856 |
| 528 | Ga0500638_152333 | 3300053162 | Bacteria | 1027 |
| 529 | Ga0500636_0005912 | 3300053177 | Bacteria | 7014 |
| 530 | Ga0500637_0012246 | 3300053178 | Bacteria | 4463 |
| 531 | Ga0500611_011313 | 3300053727 | Bacteria | 1472 |
| 532 | Ga0500625_073392 | 3300053729 | Bacteria | 1515 |
| 533 | Ga0500645_000487 | 3300053730 | Bacteria | 26840 |
| 534 | Ga0500645_001712 | 3300053730 | Bacteria | 10672 |
| 535 | Ga0500645_002212 | 3300053730 | Bacteria | 8872 |
| 536 | Ga0500645_003843 | 3300053730 | Bacteria | 5952 |
| 537 | Ga0500645_042669 | 3300053730 | Bacteria | 1337 |
| 538 | Ga0500609_000294 | 3300053731 | Bacteria | 7368 |
| 539 | Ga0500596_003859 | 3300053735 | Bacteria | 2805 |
| 540 | Ga0500601_012371 | 3300053737 | Bacteria | 963 |
| 541 | Ga0466962_0000097 | 3300061719 | Bacteria | 35226 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0106222 | Ga0436362_0106222_36_794 | 249 |
| 2 | 3300053160 | Ga0500633_0156059 | Ga0500633_0156059_18_773 | 251 |
| 3 | 3300053162 | Ga0500638_152333 | Ga0500638_152333_257_1015 | 251 |
| 4 | 3300049573 | Ga0501037_0494371 | Ga0501037_0494371_25_810 | 252 |
| 5 | 3300037466 | Ga0395898_0272461 | Ga0395898_0272461_137_964 | 255 |
| 6 | 3300049571 | Ga0501034_0001020 | Ga0501034_0001020_32271_33047 | 255 |
| 7 | iso_pu_bacteria | 2854681122 | 2854684990 | 255 |
| 8 | iso_pu_bacteria | 3000405567 | 3000406993 | 255 |
| 9 | 3300053153 | Ga0500616_0020318 | Ga0500616_0020318_2322_3143 | 256 |
| 10 | 3300031235 | Ga0265330_10026247 | Ga0265330_100262472 | 258 |
| 11 | 3300031344 | Ga0265316_10009583 | Ga0265316_100095839 | 258 |
| 12 | 3300031595 | Ga0265313_10003742 | Ga0265313_100037428 | 258 |
| 13 | 3300031711 | Ga0265314_10005570 | Ga0265314_100055706 | 258 |
| 14 | 3300046528 | Ga0495642_0002890 | Ga0495642_0002890_5719_6501 | 258 |
| 15 | 3300046684 | Ga0495669_0087647 | Ga0495669_0087647_256_1038 | 258 |
| 16 | 3300053096 | Ga0500641_0126450 | Ga0500641_0126450_304_1086 | 258 |
| 17 | 3300005544 | Ga0070686_100044060 | Ga0070686_1000440602 | 259 |
| 18 | 3300006051 | Ga0075364_10147652 | Ga0075364_101476522 | 259 |
| 19 | 3300005327 | Ga0070658_10003653 | Ga0070658_100036537 | 260 |
| 20 | 3300037312 | Ga0395899_0041268 | Ga0395899_0041268_765_1559 | 260 |
| 21 | 3300037418 | Ga0395900_0046092 | Ga0395900_0046092_2030_2824 | 260 |
| 22 | 3300037466 | Ga0395898_0039155 | Ga0395898_0039155_151_945 | 260 |
| 23 | 3300038443 | Ga0395901_0005477 | Ga0395901_0005477_9755_10549 | 260 |
| 24 | 3300039450 | Ga0436363_0732400 | Ga0436363_0732400_99_929 | 260 |
| 25 | 3300049586 | Ga0501070_0096934 | Ga0501070_0096934_851_1639 | 260 |
| 26 | 3300049575 | Ga0501039_0480881 | Ga0501039_0480881_41_847 | 261 |
| 27 | 3300049571 | Ga0501034_0247068 | Ga0501034_0247068_372_1229 | 262 |
| 28 | 3300031241 | Ga0265325_10061346 | Ga0265325_100613462 | 263 |
| 29 | 3300046660 | Ga0495625_0013345 | Ga0495625_0013345_55_852 | 263 |
| 30 | 3300046684 | Ga0495669_0002870 | Ga0495669_0002870_6263_7057 | 263 |
| 31 | 3300005616 | Ga0068852_100187617 | Ga0068852_1001876171 | 264 |
| 32 | 3300035113 | Ga0373936_0054472 | Ga0373936_0054472_120_920 | 264 |
| 33 | 3300035692 | Ga0373935_0429036 | Ga0373935_0429036_16_816 | 264 |
| 34 | 3300037312 | Ga0395899_0001215 | Ga0395899_0001215_17237_18043 | 264 |
| 35 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_301571_302377 | 264 |
| 36 | 3300037466 | Ga0395898_0015320 | Ga0395898_0015320_6341_7147 | 264 |
| 37 | 3300037471 | Ga0395905_0002451 | Ga0395905_0002451_2504_3310 | 264 |
| 38 | 3300038443 | Ga0395901_0001134 | Ga0395901_0001134_1634_2440 | 264 |
| 39 | 3300046616 | Ga0495668_0014958 | Ga0495668_0014958_1412_2212 | 264 |
| 40 | 3300046648 | Ga0495611_0025585 | Ga0495611_0025585_1761_2561 | 264 |
| 41 | 3300046660 | Ga0495625_0177851 | Ga0495625_0177851_266_1066 | 264 |
| 42 | 3300048904 | Ga0496101_0331904 | Ga0496101_0331904_348_1148 | 264 |
| 43 | 3300048918 | Ga0496115_0118120 | Ga0496115_0118120_1185_1985 | 264 |
| 44 | 3300049572 | Ga0501036_0196037 | Ga0501036_0196037_140_1003 | 264 |
| 45 | 3300049823 | Ga0501044_0158885 | Ga0501044_0158885_286_1107 | 264 |
| 46 | 3300005458 | Ga0070681_10023353 | Ga0070681_100233532 | 265 |
| 47 | 3300005578 | Ga0068854_100591000 | Ga0068854_1005910001 | 265 |
| 48 | 3300005616 | Ga0068852_100008074 | Ga0068852_1000080743 | 265 |
| 49 | 3300009093 | Ga0105240_10009648 | Ga0105240_1000964817 | 265 |
| 50 | 3300009093 | Ga0105240_10088456 | Ga0105240_100884564 | 265 |
| 51 | 3300013307 | Ga0157372_10278378 | Ga0157372_102783782 | 265 |
| 52 | 3300025912 | Ga0207707_10133679 | Ga0207707_101336792 | 265 |
| 53 | 3300025913 | Ga0207695_10001168 | Ga0207695_1000116824 | 265 |
| 54 | 3300025913 | Ga0207695_10010089 | Ga0207695_100100893 | 265 |
| 55 | 3300025949 | Ga0207667_10508858 | Ga0207667_105088582 | 265 |
| 56 | iso_pu_bacteria | 2643221598 | 2643999595 | 265 |
| 57 | iso_pu_bacteria | 2643221614 | 2644087582 | 265 |
| 58 | iso_pu_bacteria | 2643221661 | 2644344374 | 265 |
| 59 | iso_pu_bacteria | 2643221666 | 2644366941 | 265 |
| 60 | iso_pu_bacteria | 2739367756 | 2739791958 | 266 |
| 61 | 3300037471 | Ga0395905_0175035 | Ga0395905_0175035_542_1354 | 267 |
| 62 | iso_pu_bacteria | 2510917020 | 2511122298 | 267 |
| 63 | iso_pu_bacteria | 2582581279 | 2585149762 | 267 |
| 64 | iso_pu_bacteria | 2582581280 | 2585151226 | 267 |
| 65 | iso_pu_bacteria | 2582581293 | 2585197095 | 267 |
| 66 | iso_pu_bacteria | 2585428106 | 2587919984 | 267 |
| 67 | iso_pu_bacteria | 2643221545 | 2643747648 | 267 |
| 68 | iso_pu_bacteria | 2643221552 | 2643781950 | 267 |
| 69 | iso_pu_bacteria | 2643221583 | 2643924118 | 267 |
| 70 | iso_pu_bacteria | 2643221584 | 2643931920 | 267 |
| 71 | iso_pu_bacteria | 2643221640 | 2644223384 | 267 |
| 72 | iso_pu_bacteria | 2643221642 | 2644237126 | 267 |
| 73 | iso_pu_bacteria | 2643221691 | 2644506970 | 267 |
| 74 | iso_pu_bacteria | 2791355048 | 2792463093 | 267 |
| 75 | iso_pu_bacteria | 2818991435 | 2819538302 | 267 |
| 76 | iso_pu_bacteria | 2818991454 | 2819647128 | 267 |
| 77 | iso_pu_bacteria | 2843744320 | 2843745421 | 267 |
| 78 | iso_pu_bacteria | 2849560528 | 2849561032 | 267 |
| 79 | iso_pu_bacteria | 2849573788 | 2849576222 | 267 |
| 80 | iso_pu_bacteria | 2851153111 | 2851157070 | 267 |
| 81 | iso_pu_bacteria | 2857504554 | 2857505761 | 267 |
| 82 | iso_pu_bacteria | 2884960567 | 2884965577 | 267 |
| 83 | iso_pu_bacteria | 2898329390 | 2898332741 | 267 |
| 84 | iso_pu_bacteria | 2928531327 | 2928532126 | 267 |
| 85 | 3300009093 | Ga0105240_10500583 | Ga0105240_105005832 | 268 |
| 86 | 3300015684 | Ga0183365_10005 | Ga0183365_1000577 | 268 |
| 87 | 3300031251 | Ga0265327_10000442 | Ga0265327_1000044267 | 268 |
| 88 | 3300031251 | Ga0265327_10002781 | Ga0265327_1000278119 | 268 |
| 89 | 3300031730 | Ga0307516_10001321 | Ga0307516_1000132138 | 268 |
| 90 | 3300031824 | Ga0307413_10348201 | Ga0307413_103482012 | 268 |
| 91 | 3300044656 | Ga0466969_0008821 | Ga0466969_0008821_2849_3664 | 268 |
| 92 | 3300044684 | Ga0466966_0000243 | Ga0466966_0000243_31395_32210 | 268 |
| 93 | 3300044693 | Ga0466961_0001495 | Ga0466961_0001495_2722_3537 | 268 |
| 94 | 3300044719 | Ga0466971_0002839 | Ga0466971_0002839_2560_3375 | 268 |
| 95 | 3300044765 | Ga0466970_0002408 | Ga0466970_0002408_4120_4935 | 268 |
| 96 | 3300044842 | Ga0466957_0004982 | Ga0466957_0004982_2991_3806 | 268 |
| 97 | 3300045049 | Ga0466959_0007645 | Ga0466959_0007645_3166_3981 | 268 |
| 98 | 3300045836 | Ga0466958_0004123 | Ga0466958_0004123_3194_4009 | 268 |
| 99 | 3300046543 | Ga0495645_0181120 | Ga0495645_0181120_147_959 | 268 |
| 100 | 3300047320 | Ga0495672_0135041 | Ga0495672_0135041_59_871 | 268 |
| 101 | 3300048928 | Ga0496125_0014570 | Ga0496125_0014570_190_1005 | 268 |
| 102 | 3300049571 | Ga0501034_0372117 | Ga0501034_0372117_287_1165 | 268 |
| 103 | 3300049579 | Ga0501043_0020099 | Ga0501043_0020099_122_937 | 268 |
| 104 | 3300049581 | Ga0501047_0006395 | Ga0501047_0006395_9153_9965 | 268 |
| 105 | 3300049822 | Ga0501035_0007673 | Ga0501035_0007673_8739_9554 | 268 |
| 106 | 3300049823 | Ga0501044_0047950 | Ga0501044_0047950_3547_4359 | 268 |
| 107 | 3300053080 | Ga0500635_0000236 | Ga0500635_0000236_3459_4274 | 268 |
| 108 | 3300053122 | Ga0500608_000096 | Ga0500608_000096_7630_8445 | 268 |
| 109 | 3300061719 | Ga0466962_0000097 | Ga0466962_0000097_2735_3550 | 268 |
| 110 | iso_pu_bacteria | 2643221663 | 2644351304 | 268 |
| 111 | 3300005327 | Ga0070658_10115988 | Ga0070658_101159883 | 269 |
| 112 | 3300005331 | Ga0070670_100000004 | Ga0070670_10000000461 | 269 |
| 113 | 3300005341 | Ga0070691_10017725 | Ga0070691_100177253 | 269 |
| 114 | 3300005347 | Ga0070668_100001026 | Ga0070668_1000010269 | 269 |
| 115 | 3300005347 | Ga0070668_100002884 | Ga0070668_10000288412 | 269 |
| 116 | 3300005347 | Ga0070668_100061068 | Ga0070668_1000610682 | 269 |
| 117 | 3300005355 | Ga0070671_100014773 | Ga0070671_1000147733 | 269 |
| 118 | 3300005367 | Ga0070667_100000105 | Ga0070667_10000010578 | 269 |
| 119 | 3300005530 | Ga0070679_100007148 | Ga0070679_1000071486 | 269 |
| 120 | 3300005539 | Ga0068853_100077132 | Ga0068853_1000771322 | 269 |
| 121 | 3300005548 | Ga0070665_100000667 | Ga0070665_10000066726 | 269 |
| 122 | 3300005548 | Ga0070665_100000784 | Ga0070665_10000078439 | 269 |
| 123 | 3300005563 | Ga0068855_100088878 | Ga0068855_1000888782 | 269 |
| 124 | 3300005618 | Ga0068864_100000058 | Ga0068864_10000005876 | 269 |
| 125 | 3300005618 | Ga0068864_100000164 | Ga0068864_10000016419 | 269 |
| 126 | 3300005841 | Ga0068863_100000290 | Ga0068863_10000029042 | 269 |
| 127 | 3300005841 | Ga0068863_100032357 | Ga0068863_1000323573 | 269 |
| 128 | 3300005842 | Ga0068858_100000006 | Ga0068858_100000006213 | 269 |
| 129 | 3300005842 | Ga0068858_100001954 | Ga0068858_1000019542 | 269 |
| 130 | 3300005843 | Ga0068860_100000077 | Ga0068860_10000007761 | 269 |
| 131 | 3300005844 | Ga0068862_100013342 | Ga0068862_1000133422 | 269 |
| 132 | 3300005844 | Ga0068862_100025245 | Ga0068862_1000252454 | 269 |
| 133 | 3300005844 | Ga0068862_100255620 | Ga0068862_1002556202 | 269 |
| 134 | 3300006048 | Ga0075363_100121989 | Ga0075363_1001219892 | 269 |
| 135 | 3300009092 | Ga0105250_10017473 | Ga0105250_100174734 | 269 |
| 136 | 3300009093 | Ga0105240_10137996 | Ga0105240_101379962 | 269 |
| 137 | 3300009093 | Ga0105240_10373553 | Ga0105240_103735532 | 269 |
| 138 | 3300009177 | Ga0105248_10223313 | Ga0105248_102233132 | 269 |
| 139 | 3300009545 | Ga0105237_10097435 | Ga0105237_100974351 | 269 |
| 140 | 3300009551 | Ga0105238_10365036 | Ga0105238_103650361 | 269 |
| 141 | 3300009553 | Ga0105249_10003268 | Ga0105249_1000326818 | 269 |
| 142 | 3300009553 | Ga0105249_10074695 | Ga0105249_100746952 | 269 |
| 143 | 3300014968 | Ga0157379_10018637 | Ga0157379_100186377 | 269 |
| 144 | 3300025909 | Ga0207705_10078915 | Ga0207705_100789151 | 269 |
| 145 | 3300025913 | Ga0207695_10000269 | Ga0207695_10000269120 | 269 |
| 146 | 3300025925 | Ga0207650_10000033 | Ga0207650_10000033155 | 269 |
| 147 | 3300025941 | Ga0207711_10000926 | Ga0207711_100009265 | 269 |
| 148 | 3300025941 | Ga0207711_10055550 | Ga0207711_100555504 | 269 |
| 149 | 3300025949 | Ga0207667_10319958 | Ga0207667_103199581 | 269 |
| 150 | 3300025961 | Ga0207712_10016645 | Ga0207712_100166456 | 269 |
| 151 | 3300025972 | Ga0207668_10000004 | Ga0207668_10000004171 | 269 |
| 152 | 3300025972 | Ga0207668_10000255 | Ga0207668_1000025518 | 269 |
| 153 | 3300025972 | Ga0207668_10118329 | Ga0207668_101183292 | 269 |
| 154 | 3300025986 | Ga0207658_10000607 | Ga0207658_100006073 | 269 |
| 155 | 3300026035 | Ga0207703_10000027 | Ga0207703_10000027138 | 269 |
| 156 | 3300026035 | Ga0207703_10011217 | Ga0207703_100112172 | 269 |
| 157 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003236 | 269 |
| 158 | 3300026088 | Ga0207641_10003861 | Ga0207641_100038619 | 269 |
| 159 | 3300026089 | Ga0207648_10479835 | Ga0207648_104798351 | 269 |
| 160 | 3300026095 | Ga0207676_10000175 | Ga0207676_1000017555 | 269 |
| 161 | 3300026095 | Ga0207676_10003810 | Ga0207676_100038105 | 269 |
| 162 | 3300028379 | Ga0268266_10000970 | Ga0268266_1000097038 | 269 |
| 163 | 3300028379 | Ga0268266_10004426 | Ga0268266_1000442617 | 269 |
| 164 | 3300028380 | Ga0268265_10025500 | Ga0268265_100255001 | 269 |
| 165 | 3300028380 | Ga0268265_10243257 | Ga0268265_102432572 | 269 |
| 166 | 3300028381 | Ga0268264_10000032 | Ga0268264_10000032355 | 269 |
| 167 | 3300028786 | Ga0307517_10005788 | Ga0307517_1000578820 | 269 |
| 168 | 3300028800 | Ga0265338_10135343 | Ga0265338_101353431 | 269 |
| 169 | 3300031456 | Ga0307513_10006509 | Ga0307513_100065093 | 269 |
| 170 | 3300031456 | Ga0307513_10011589 | Ga0307513_100115899 | 269 |
| 171 | 3300037471 | Ga0395905_0000156 | Ga0395905_0000156_93694_94512 | 269 |
| 172 | 3300039437 | Ga0436365_0925532 | Ga0436365_0925532_3754_4566 | 269 |
| 173 | 3300039437 | Ga0436365_1016387 | Ga0436365_1016387_1716_2531 | 269 |
| 174 | 3300044693 | Ga0466961_0031369 | Ga0466961_0031369_2326_3144 | 269 |
| 175 | 3300045049 | Ga0466959_0158836 | Ga0466959_0158836_366_1184 | 269 |
| 176 | 3300046616 | Ga0495668_0027699 | Ga0495668_0027699_66_896 | 269 |
| 177 | 3300046616 | Ga0495668_0097116 | Ga0495668_0097116_548_1360 | 269 |
| 178 | 3300046694 | Ga0495649_0000077 | Ga0495649_0000077_74475_75293 | 269 |
| 179 | 3300047315 | Ga0495581_0030427 | Ga0495581_0030427_1099_1911 | 269 |
| 180 | 3300047447 | Ga0495685_097256 | Ga0495685_097256_62_874 | 269 |
| 181 | 3300048088 | Ga0495602_0398319 | Ga0495602_0398319_47_859 | 269 |
| 182 | 3300048905 | Ga0496102_0024604 | Ga0496102_0024604_191_1006 | 269 |
| 183 | 3300048905 | Ga0496102_0026068 | Ga0496102_0026068_1097_2014 | 269 |
| 184 | 3300048920 | Ga0496117_0015210 | Ga0496117_0015210_4202_5017 | 269 |
| 185 | 3300048921 | Ga0496118_0006612 | Ga0496118_0006612_21_836 | 269 |
| 186 | 3300048922 | Ga0496119_0051361 | Ga0496119_0051361_1607_2422 | 269 |
| 187 | 3300048924 | Ga0496121_0000042 | Ga0496121_0000042_233349_234164 | 269 |
| 188 | 3300049460 | Ga0495682_0066544 | Ga0495682_0066544_44_856 | 269 |
| 189 | 3300049581 | Ga0501047_0107689 | Ga0501047_0107689_1284_2102 | 269 |
| 190 | 3300053080 | Ga0500635_0000399 | Ga0500635_0000399_648_1460 | 269 |
| 191 | 3300053086 | Ga0500578_0267067 | Ga0500578_0267067_91_903 | 269 |
| 192 | 3300053087 | Ga0500643_016809 | Ga0500643_016809_1221_2111 | 269 |
| 193 | 3300053092 | Ga0500583_0009227 | Ga0500583_0009227_393_1205 | 269 |
| 194 | 3300053093 | Ga0500651_0021284 | Ga0500651_0021284_793_1611 | 269 |
| 195 | 3300053093 | Ga0500651_0133214 | Ga0500651_0133214_503_1315 | 269 |
| 196 | 3300053103 | Ga0500555_000832 | Ga0500555_000832_820_1635 | 269 |
| 197 | 3300053109 | Ga0500569_014045 | Ga0500569_014045_1037_1849 | 269 |
| 198 | 3300053119 | Ga0500595_038518 | Ga0500595_038518_588_1400 | 269 |
| 199 | 3300053123 | Ga0500614_040219 | Ga0500614_040219_252_1064 | 269 |
| 200 | 3300053130 | Ga0500642_0133841 | Ga0500642_0133841_307_1119 | 269 |
| 201 | 3300053148 | Ga0500590_073723 | Ga0500590_073723_548_1360 | 269 |
| 202 | 3300053150 | Ga0500603_018874 | Ga0500603_018874_51_863 | 269 |
| 203 | 3300053157 | Ga0500624_006243 | Ga0500624_006243_30_842 | 269 |
| 204 | 3300053729 | Ga0500625_073392 | Ga0500625_073392_575_1387 | 269 |
| 205 | 3300053730 | Ga0500645_002212 | Ga0500645_002212_6356_7171 | 269 |
| 206 | 3300053735 | Ga0500596_003859 | Ga0500596_003859_273_1085 | 269 |
| 207 | 3300053737 | Ga0500601_012371 | Ga0500601_012371_30_842 | 269 |
| 208 | iso_pu_bacteria | 2643221574 | 2643882214 | 269 |
| 209 | iso_pu_bacteria | 2643221699 | 2644547764 | 269 |
| 210 | iso_pu_bacteria | 2928972540 | 2928973405 | 269 |
| 211 | iso_pu_bacteria | 2941485952 | 2941489400 | 269 |
| 212 | iso_pu_bacteria | 2977240413 | 2977240617 | 269 |
| 213 | 3300003781 | Ga0055536_1004147 | Ga0055536_10041474 | 270 |
| 214 | 3300003791 | Ga0055530_10006764 | Ga0055530_100067643 | 270 |
| 215 | 3300003794 | Ga0055531_10012236 | Ga0055531_100122362 | 270 |
| 216 | 3300005327 | Ga0070658_10009406 | Ga0070658_100094063 | 270 |
| 217 | 3300005327 | Ga0070658_10060026 | Ga0070658_100600262 | 270 |
| 218 | 3300005331 | Ga0070670_100035149 | Ga0070670_1000351494 | 270 |
| 219 | 3300005331 | Ga0070670_100091271 | Ga0070670_1000912713 | 270 |
| 220 | 3300005337 | Ga0070682_100446740 | Ga0070682_1004467401 | 270 |
| 221 | 3300005344 | Ga0070661_100216675 | Ga0070661_1002166752 | 270 |
| 222 | 3300005347 | Ga0070668_100002963 | Ga0070668_1000029639 | 270 |
| 223 | 3300005347 | Ga0070668_100004810 | Ga0070668_1000048107 | 270 |
| 224 | 3300005347 | Ga0070668_100005098 | Ga0070668_1000050988 | 270 |
| 225 | 3300005347 | Ga0070668_100050299 | Ga0070668_1000502992 | 270 |
| 226 | 3300005353 | Ga0070669_100016959 | Ga0070669_1000169595 | 270 |
| 227 | 3300005355 | Ga0070671_100006295 | Ga0070671_1000062958 | 270 |
| 228 | 3300005355 | Ga0070671_100172682 | Ga0070671_1001726822 | 270 |
| 229 | 3300005364 | Ga0070673_100257574 | Ga0070673_1002575742 | 270 |
| 230 | 3300005366 | Ga0070659_100001009 | Ga0070659_10000100913 | 270 |
| 231 | 3300005366 | Ga0070659_100024167 | Ga0070659_1000241673 | 270 |
| 232 | 3300005366 | Ga0070659_100117271 | Ga0070659_1001172712 | 270 |
| 233 | 3300005367 | Ga0070667_100007531 | Ga0070667_1000075312 | 270 |
| 234 | 3300005457 | Ga0070662_100213139 | Ga0070662_1002131392 | 270 |
| 235 | 3300005458 | Ga0070681_10008308 | Ga0070681_100083089 | 270 |
| 236 | 3300005530 | Ga0070679_100085543 | Ga0070679_1000855432 | 270 |
| 237 | 3300005539 | Ga0068853_100037873 | Ga0068853_1000378734 | 270 |
| 238 | 3300005539 | Ga0068853_100061011 | Ga0068853_1000610112 | 270 |
| 239 | 3300005548 | Ga0070665_100000721 | Ga0070665_10000072138 | 270 |
| 240 | 3300005548 | Ga0070665_100009966 | Ga0070665_1000099665 | 270 |
| 241 | 3300005548 | Ga0070665_100144988 | Ga0070665_1001449882 | 270 |
| 242 | 3300005548 | Ga0070665_100330983 | Ga0070665_1003309832 | 270 |
| 243 | 3300005563 | Ga0068855_100017453 | Ga0068855_1000174535 | 270 |
| 244 | 3300005563 | Ga0068855_100170646 | Ga0068855_1001706462 | 270 |
| 245 | 3300005617 | Ga0068859_100001326 | Ga0068859_10000132628 | 270 |
| 246 | 3300005618 | Ga0068864_100011174 | Ga0068864_1000111744 | 270 |
| 247 | 3300005618 | Ga0068864_100068506 | Ga0068864_1000685062 | 270 |
| 248 | 3300005618 | Ga0068864_100346908 | Ga0068864_1003469082 | 270 |
| 249 | 3300005719 | Ga0068861_100077518 | Ga0068861_1000775184 | 270 |
| 250 | 3300005841 | Ga0068863_100017625 | Ga0068863_1000176251 | 270 |
| 251 | 3300005841 | Ga0068863_100187747 | Ga0068863_1001877472 | 270 |
| 252 | 3300005841 | Ga0068863_100202095 | Ga0068863_1002020952 | 270 |
| 253 | 3300005841 | Ga0068863_100246591 | Ga0068863_1002465912 | 270 |
| 254 | 3300005843 | Ga0068860_100000066 | Ga0068860_10000006650 | 270 |
| 255 | 3300005843 | Ga0068860_100003889 | Ga0068860_1000038894 | 270 |
| 256 | 3300005843 | Ga0068860_100272912 | Ga0068860_1002729122 | 270 |
| 257 | 3300005843 | Ga0068860_100332577 | Ga0068860_1003325772 | 270 |
| 258 | 3300005844 | Ga0068862_100007824 | Ga0068862_1000078244 | 270 |
| 259 | 3300005844 | Ga0068862_100009828 | Ga0068862_1000098285 | 270 |
| 260 | 3300005844 | Ga0068862_100017696 | Ga0068862_1000176963 | 270 |
| 261 | 3300006042 | Ga0075368_10018193 | Ga0075368_100181931 | 270 |
| 262 | 3300006051 | Ga0075364_10000415 | Ga0075364_1000041523 | 270 |
| 263 | 3300006178 | Ga0075367_10014430 | Ga0075367_100144301 | 270 |
| 264 | 3300006186 | Ga0075369_10051639 | Ga0075369_100516392 | 270 |
| 265 | 3300006353 | Ga0075370_10025765 | Ga0075370_100257654 | 270 |
| 266 | 3300006353 | Ga0075370_10105253 | Ga0075370_101052533 | 270 |
| 267 | 3300006881 | Ga0068865_100002365 | Ga0068865_1000023651 | 270 |
| 268 | 3300006931 | Ga0097620_100001326 | Ga0097620_10000132628 | 270 |
| 269 | 3300009093 | Ga0105240_10219399 | Ga0105240_102193992 | 270 |
| 270 | 3300009174 | Ga0105241_10338028 | Ga0105241_103380281 | 270 |
| 271 | 3300009177 | Ga0105248_10000650 | Ga0105248_1000065028 | 270 |
| 272 | 3300009177 | Ga0105248_10000746 | Ga0105248_1000074623 | 270 |
| 273 | 3300009545 | Ga0105237_10329812 | Ga0105237_103298122 | 270 |
| 274 | 3300009551 | Ga0105238_10076749 | Ga0105238_100767493 | 270 |
| 275 | 3300009551 | Ga0105238_10448837 | Ga0105238_104488372 | 270 |
| 276 | 3300009551 | Ga0105238_10603548 | Ga0105238_106035481 | 270 |
| 277 | 3300009553 | Ga0105249_10284378 | Ga0105249_102843782 | 270 |
| 278 | 3300009553 | Ga0105249_10299553 | Ga0105249_102995532 | 270 |
| 279 | 3300013100 | Ga0157373_10003332 | Ga0157373_100033322 | 270 |
| 280 | 3300013100 | Ga0157373_10004339 | Ga0157373_100043398 | 270 |
| 281 | 3300013100 | Ga0157373_10262799 | Ga0157373_102627992 | 270 |
| 282 | 3300013306 | Ga0163162_10088212 | Ga0163162_100882124 | 270 |
| 283 | 3300013308 | Ga0157375_10047309 | Ga0157375_100473093 | 270 |
| 284 | 3300014325 | Ga0163163_10004890 | Ga0163163_1000489010 | 270 |
| 285 | 3300014325 | Ga0163163_10331971 | Ga0163163_103319712 | 270 |
| 286 | 3300014968 | Ga0157379_10483777 | Ga0157379_104837772 | 270 |
| 287 | 3300021388 | Ga0213875_10147955 | Ga0213875_101479551 | 270 |
| 288 | 3300025250 | Ga0209026_1000608 | Ga0209026_100060818 | 270 |
| 289 | 3300025254 | Ga0209148_1011417 | Ga0209148_10114171 | 270 |
| 290 | 3300025292 | Ga0209676_1000217 | Ga0209676_100021774 | 270 |
| 291 | 3300025292 | Ga0209676_1003478 | Ga0209676_10034789 | 270 |
| 292 | 3300025297 | Ga0209758_1003752 | Ga0209758_10037526 | 270 |
| 293 | 3300025298 | Ga0209050_1000053 | Ga0209050_1000053130 | 270 |
| 294 | 3300025304 | Ga0209257_1000230 | Ga0209257_1000230106 | 270 |
| 295 | 3300025304 | Ga0209257_1000419 | Ga0209257_100041918 | 270 |
| 296 | 3300025304 | Ga0209257_1001795 | Ga0209257_100179518 | 270 |
| 297 | 3300025909 | Ga0207705_10003462 | Ga0207705_100034629 | 270 |
| 298 | 3300025909 | Ga0207705_10051010 | Ga0207705_100510102 | 270 |
| 299 | 3300025909 | Ga0207705_10325847 | Ga0207705_103258471 | 270 |
| 300 | 3300025912 | Ga0207707_10138738 | Ga0207707_101387382 | 270 |
| 301 | 3300025917 | Ga0207660_10012589 | Ga0207660_100125893 | 270 |
| 302 | 3300025919 | Ga0207657_10000235 | Ga0207657_1000023562 | 270 |
| 303 | 3300025921 | Ga0207652_10005742 | Ga0207652_100057423 | 270 |
| 304 | 3300025923 | Ga0207681_10078083 | Ga0207681_100780832 | 270 |
| 305 | 3300025923 | Ga0207681_10126769 | Ga0207681_101267692 | 270 |
| 306 | 3300025924 | Ga0207694_10022549 | Ga0207694_100225493 | 270 |
| 307 | 3300025924 | Ga0207694_10177688 | Ga0207694_101776882 | 270 |
| 308 | 3300025924 | Ga0207694_10276512 | Ga0207694_102765122 | 270 |
| 309 | 3300025924 | Ga0207694_10550978 | Ga0207694_105509781 | 270 |
| 310 | 3300025925 | Ga0207650_10326300 | Ga0207650_103263001 | 270 |
| 311 | 3300025931 | Ga0207644_10024158 | Ga0207644_100241582 | 270 |
| 312 | 3300025932 | Ga0207690_10000031 | Ga0207690_10000031125 | 270 |
| 313 | 3300025932 | Ga0207690_10083331 | Ga0207690_100833313 | 270 |
| 314 | 3300025933 | Ga0207706_10013371 | Ga0207706_100133719 | 270 |
| 315 | 3300025933 | Ga0207706_10280406 | Ga0207706_102804062 | 270 |
| 316 | 3300025940 | Ga0207691_10222613 | Ga0207691_102226133 | 270 |
| 317 | 3300025941 | Ga0207711_10000368 | Ga0207711_1000036846 | 270 |
| 318 | 3300025941 | Ga0207711_10001601 | Ga0207711_1000160115 | 270 |
| 319 | 3300025941 | Ga0207711_10186347 | Ga0207711_101863472 | 270 |
| 320 | 3300025941 | Ga0207711_10333594 | Ga0207711_103335942 | 270 |
| 321 | 3300025949 | Ga0207667_10015583 | Ga0207667_100155832 | 270 |
| 322 | 3300025949 | Ga0207667_10131418 | Ga0207667_101314182 | 270 |
| 323 | 3300025949 | Ga0207667_10187155 | Ga0207667_101871552 | 270 |
| 324 | 3300025960 | Ga0207651_10340133 | Ga0207651_103401332 | 270 |
| 325 | 3300025972 | Ga0207668_10003169 | Ga0207668_100031695 | 270 |
| 326 | 3300025972 | Ga0207668_10003930 | Ga0207668_100039308 | 270 |
| 327 | 3300025972 | Ga0207668_10005036 | Ga0207668_100050365 | 270 |
| 328 | 3300025972 | Ga0207668_10042599 | Ga0207668_100425993 | 270 |
| 329 | 3300025986 | Ga0207658_10120227 | Ga0207658_101202273 | 270 |
| 330 | 3300026035 | Ga0207703_10194347 | Ga0207703_101943472 | 270 |
| 331 | 3300026041 | Ga0207639_10008668 | Ga0207639_100086685 | 270 |
| 332 | 3300026041 | Ga0207639_10060936 | Ga0207639_100609362 | 270 |
| 333 | 3300026041 | Ga0207639_10659534 | Ga0207639_106595341 | 270 |
| 334 | 3300026088 | Ga0207641_10001763 | Ga0207641_1000176322 | 270 |
| 335 | 3300026088 | Ga0207641_10040183 | Ga0207641_100401833 | 270 |
| 336 | 3300026088 | Ga0207641_10198483 | Ga0207641_101984833 | 270 |
| 337 | 3300026095 | Ga0207676_10013622 | Ga0207676_100136224 | 270 |
| 338 | 3300026116 | Ga0207674_10259120 | Ga0207674_102591202 | 270 |
| 339 | 3300026142 | Ga0207698_10185146 | Ga0207698_101851462 | 270 |
| 340 | 3300027378 | Ga0209981_1000576 | Ga0209981_10005766 | 270 |
| 341 | 3300027665 | Ga0209983_1008035 | Ga0209983_10080352 | 270 |
| 342 | 3300027866 | Ga0209813_10055546 | Ga0209813_100555462 | 270 |
| 343 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031414 | 270 |
| 344 | 3300028379 | Ga0268266_10021359 | Ga0268266_100213592 | 270 |
| 345 | 3300028379 | Ga0268266_10061387 | Ga0268266_100613871 | 270 |
| 346 | 3300028380 | Ga0268265_10005393 | Ga0268265_100053934 | 270 |
| 347 | 3300028381 | Ga0268264_10000113 | Ga0268264_10000113143 | 270 |
| 348 | 3300028381 | Ga0268264_10065189 | Ga0268264_100651892 | 270 |
| 349 | 3300028381 | Ga0268264_10374208 | Ga0268264_103742081 | 270 |
| 350 | 3300028573 | Ga0265334_10086777 | Ga0265334_100867772 | 270 |
| 351 | 3300028786 | Ga0307517_10084629 | Ga0307517_100846293 | 270 |
| 352 | 3300028800 | Ga0265338_10270957 | Ga0265338_102709572 | 270 |
| 353 | 3300028800 | Ga0265338_10298119 | Ga0265338_102981191 | 270 |
| 354 | 3300031247 | Ga0265340_10072033 | Ga0265340_100720332 | 270 |
| 355 | 3300031251 | Ga0265327_10004906 | Ga0265327_1000490610 | 270 |
| 356 | 3300031251 | Ga0265327_10091619 | Ga0265327_100916191 | 270 |
| 357 | 3300031456 | Ga0307513_10003286 | Ga0307513_1000328613 | 270 |
| 358 | 3300031711 | Ga0265314_10223771 | Ga0265314_102237712 | 270 |
| 359 | 3300031901 | Ga0307406_10001177 | Ga0307406_100011773 | 270 |
| 360 | 3300031911 | Ga0307412_10051120 | Ga0307412_100511202 | 270 |
| 361 | 3300033180 | Ga0307510_10017145 | Ga0307510_100171455 | 270 |
| 362 | 3300035083 | Ga0373926_0047811 | Ga0373926_0047811_166_984 | 270 |
| 363 | 3300035113 | Ga0373936_0003245 | Ga0373936_0003245_4734_5552 | 270 |
| 364 | 3300035171 | Ga0373946_0026074 | Ga0373946_0026074_968_1789 | 270 |
| 365 | 3300035691 | Ga0373931_0058938 | Ga0373931_0058938_1191_2009 | 270 |
| 366 | 3300035695 | Ga0373927_0000111 | Ga0373927_0000111_42344_43165 | 270 |
| 367 | 3300035725 | Ga0373947_0040646 | Ga0373947_0040646_1555_2376 | 270 |
| 368 | 3300037068 | Ga0373925_0000209 | Ga0373925_0000209_20935_21756 | 270 |
| 369 | 3300037471 | Ga0395905_0019172 | Ga0395905_0019172_276_1094 | 270 |
| 370 | 3300037853 | Ga0436364_1149156 | Ga0436364_1149156_36_848 | 270 |
| 371 | 3300037853 | Ga0436364_1296096 | Ga0436364_1296096_380_1192 | 270 |
| 372 | 3300038443 | Ga0395901_0126730 | Ga0395901_0126730_1500_2318 | 270 |
| 373 | 3300038443 | Ga0395901_0414114 | Ga0395901_0414114_96_914 | 270 |
| 374 | 3300039438 | Ga0436360_0143736 | Ga0436360_0143736_58_879 | 270 |
| 375 | 3300042004 | Ga0439445_0016909 | Ga0439445_0016909_55_879 | 270 |
| 376 | 3300044693 | Ga0466961_0219647 | Ga0466961_0219647_59_877 | 270 |
| 377 | 3300044694 | Ga0466963_0358798 | Ga0466963_0358798_153_974 | 270 |
| 378 | 3300046459 | Ga0495629_0190954 | Ga0495629_0190954_523_1407 | 270 |
| 379 | 3300046528 | Ga0495642_0045401 | Ga0495642_0045401_399_1217 | 270 |
| 380 | 3300046543 | Ga0495645_0011398 | Ga0495645_0011398_496_1317 | 270 |
| 381 | 3300046557 | Ga0495622_0002815 | Ga0495622_0002815_228_1046 | 270 |
| 382 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_176470_177294 | 270 |
| 383 | 3300046684 | Ga0495669_0000731 | Ga0495669_0000731_5254_6075 | 270 |
| 384 | 3300047318 | Ga0495636_0065022 | Ga0495636_0065022_720_1538 | 270 |
| 385 | 3300047472 | Ga0495686_0011091 | Ga0495686_0011091_5223_6044 | 270 |
| 386 | 3300048904 | Ga0496101_0151747 | Ga0496101_0151747_93_911 | 270 |
| 387 | 3300048906 | Ga0496103_0180468 | Ga0496103_0180468_121_1044 | 270 |
| 388 | 3300048909 | Ga0496106_0217607 | Ga0496106_0217607_148_966 | 270 |
| 389 | 3300048910 | Ga0496107_0146951 | Ga0496107_0146951_601_1419 | 270 |
| 390 | 3300048912 | Ga0496109_0121267 | Ga0496109_0121267_1050_1868 | 270 |
| 391 | 3300048913 | Ga0496110_0158936 | Ga0496110_0158936_431_1249 | 270 |
| 392 | 3300048914 | Ga0496111_0096490 | Ga0496111_0096490_971_1789 | 270 |
| 393 | 3300048915 | Ga0496112_0104960 | Ga0496112_0104960_1894_2715 | 270 |
| 394 | 3300048915 | Ga0496112_0230569 | Ga0496112_0230569_360_1178 | 270 |
| 395 | 3300048915 | Ga0496112_0410367 | Ga0496112_0410367_328_1146 | 270 |
| 396 | 3300048918 | Ga0496115_0000460 | Ga0496115_0000460_20575_21396 | 270 |
| 397 | 3300048918 | Ga0496115_0000467 | Ga0496115_0000467_22151_22969 | 270 |
| 398 | 3300048918 | Ga0496115_0409535 | Ga0496115_0409535_95_913 | 270 |
| 399 | 3300048924 | Ga0496121_0299484 | Ga0496121_0299484_67_891 | 270 |
| 400 | 3300049570 | Ga0501033_0002580 | Ga0501033_0002580_4944_5768 | 270 |
| 401 | 3300049571 | Ga0501034_0005292 | Ga0501034_0005292_4257_5069 | 270 |
| 402 | 3300049573 | Ga0501037_0012688 | Ga0501037_0012688_3063_3875 | 270 |
| 403 | 3300049579 | Ga0501043_0145535 | Ga0501043_0145535_729_1550 | 270 |
| 404 | 3300049581 | Ga0501047_0006163 | Ga0501047_0006163_5005_5826 | 270 |
| 405 | 3300049582 | Ga0501048_0045657 | Ga0501048_0045657_1952_2770 | 270 |
| 406 | 3300049823 | Ga0501044_0012706 | Ga0501044_0012706_1664_2476 | 270 |
| 407 | 3300049823 | Ga0501044_0678509 | Ga0501044_0678509_64_876 | 270 |
| 408 | 3300050490 | nmdc:mga03n38_125582_c1 | nmdc:mga03n38_125582_c1_305_1168 | 270 |
| 409 | 3300050491 | nmdc:mga00v17_494_c1 | nmdc:mga00v17_494_c1_16207_17067 | 270 |
| 410 | 3300050493 | nmdc:mga0k408_13076_c1 | nmdc:mga0k408_13076_c1_1039_1902 | 270 |
| 411 | 3300050494 | nmdc:mga06z11_68743_c1 | nmdc:mga06z11_68743_c1_382_1242 | 270 |
| 412 | 3300053087 | Ga0500643_024568 | Ga0500643_024568_177_1001 | 270 |
| 413 | 3300053088 | Ga0500644_0002839 | Ga0500644_0002839_1430_2251 | 270 |
| 414 | 3300053093 | Ga0500651_0027381 | Ga0500651_0027381_1526_2347 | 270 |
| 415 | 3300053096 | Ga0500641_0004493 | Ga0500641_0004493_735_1559 | 270 |
| 416 | 3300053111 | Ga0500572_000593 | Ga0500572_000593_4510_5334 | 270 |
| 417 | 3300053122 | Ga0500608_033133 | Ga0500608_033133_1334_2152 | 270 |
| 418 | 3300053154 | Ga0500619_013183 | Ga0500619_013183_234_1052 | 270 |
| 419 | 3300053156 | Ga0500622_0047939 | Ga0500622_0047939_1000_1824 | 270 |
| 420 | 3300053178 | Ga0500637_0012246 | Ga0500637_0012246_412_1230 | 270 |
| 421 | 3300053730 | Ga0500645_000487 | Ga0500645_000487_10842_11666 | 270 |
| 422 | 3300053730 | Ga0500645_042669 | Ga0500645_042669_160_981 | 270 |
| 423 | 3300003215 | JGI25153J46596_10016413 | JGI25153J46596_100164133 | 271 |
| 424 | 3300003215 | JGI25153J46596_10032502 | JGI25153J46596_100325022 | 271 |
| 425 | 3300003322 | rootL2_10075538 | rootL2_100755381 | 271 |
| 426 | 3300003322 | rootL2_10076302 | rootL2_100763024 | 271 |
| 427 | 3300003578 | Ga0006562J51391_1043118 | Ga0006562J51391_10431183 | 271 |
| 428 | 3300003578 | Ga0006562J51391_1043120 | Ga0006562J51391_10431207 | 271 |
| 429 | 3300003773 | Ga0055537_1003051 | Ga0055537_10030512 | 271 |
| 430 | 3300003775 | Ga0055524_1004063 | Ga0055524_10040632 | 271 |
| 431 | 3300003781 | Ga0055536_1001509 | Ga0055536_10015091 | 271 |
| 432 | 3300003790 | Ga0055528_1003297 | Ga0055528_10032977 | 271 |
| 433 | 3300003791 | Ga0055530_10004450 | Ga0055530_100044507 | 271 |
| 434 | 3300003791 | Ga0055530_10009547 | Ga0055530_100095472 | 271 |
| 435 | 3300003794 | Ga0055531_10000473 | Ga0055531_1000047317 | 271 |
| 436 | 3300003794 | Ga0055531_10007442 | Ga0055531_100074423 | 271 |
| 437 | 3300003794 | Ga0055531_10043766 | Ga0055531_100437662 | 271 |
| 438 | 3300005262 | Ga0065165_1001792 | Ga0065165_10017929 | 271 |
| 439 | 3300005614 | Ga0068856_100355057 | Ga0068856_1003550572 | 271 |
| 440 | 3300006186 | Ga0075369_10002774 | Ga0075369_100027744 | 271 |
| 441 | 3300009098 | Ga0105245_10885705 | Ga0105245_108857051 | 271 |
| 442 | 3300009176 | Ga0105242_10306750 | Ga0105242_103067502 | 271 |
| 443 | 3300013102 | Ga0157371_10007717 | Ga0157371_100077172 | 271 |
| 444 | 3300013104 | Ga0157370_10032819 | Ga0157370_100328195 | 271 |
| 445 | 3300013105 | Ga0157369_10135407 | Ga0157369_101354073 | 271 |
| 446 | 3300013296 | Ga0157374_10199420 | Ga0157374_101994202 | 271 |
| 447 | 3300013297 | Ga0157378_10510412 | Ga0157378_105104122 | 271 |
| 448 | 3300021361 | Ga0213872_10039000 | Ga0213872_100390003 | 271 |
| 449 | 3300025263 | Ga0209565_1000172 | Ga0209565_100017241 | 271 |
| 450 | 3300025273 | Ga0209673_1000451 | Ga0209673_10004519 | 271 |
| 451 | 3300025291 | Ga0209675_1006240 | Ga0209675_10062404 | 271 |
| 452 | 3300025292 | Ga0209676_1000257 | Ga0209676_100025758 | 271 |
| 453 | 3300025292 | Ga0209676_1000316 | Ga0209676_100031643 | 271 |
| 454 | 3300025295 | Ga0209564_1004152 | Ga0209564_10041528 | 271 |
| 455 | 3300025297 | Ga0209758_1001854 | Ga0209758_10018544 | 271 |
| 456 | 3300025297 | Ga0209758_1006062 | Ga0209758_10060623 | 271 |
| 457 | 3300025298 | Ga0209050_1000604 | Ga0209050_100060443 | 271 |
| 458 | 3300025298 | Ga0209050_1001151 | Ga0209050_100115126 | 271 |
| 459 | 3300025298 | Ga0209050_1006384 | Ga0209050_10063847 | 271 |
| 460 | 3300025299 | Ga0209256_1002978 | Ga0209256_100297810 | 271 |
| 461 | 3300025299 | Ga0209256_1005380 | Ga0209256_10053807 | 271 |
| 462 | 3300025303 | Ga0209051_1003216 | Ga0209051_10032164 | 271 |
| 463 | 3300025304 | Ga0209257_1000192 | Ga0209257_100019298 | 271 |
| 464 | 3300025304 | Ga0209257_1000541 | Ga0209257_100054121 | 271 |
| 465 | 3300025304 | Ga0209257_1012647 | Ga0209257_10126472 | 271 |
| 466 | 3300025919 | Ga0207657_10528860 | Ga0207657_105288601 | 271 |
| 467 | 3300026078 | Ga0207702_10493659 | Ga0207702_104936591 | 271 |
| 468 | 3300028556 | Ga0265337_1043322 | Ga0265337_10433221 | 271 |
| 469 | 3300028794 | Ga0307515_10010603 | Ga0307515_1001060310 | 271 |
| 470 | 3300028794 | Ga0307515_10024332 | Ga0307515_100243323 | 271 |
| 471 | 3300028800 | Ga0265338_10043089 | Ga0265338_100430895 | 271 |
| 472 | 3300031240 | Ga0265320_10090631 | Ga0265320_100906311 | 271 |
| 473 | 3300031903 | Ga0307407_10060407 | Ga0307407_100604074 | 271 |
| 474 | 3300032004 | Ga0307414_10029061 | Ga0307414_100290614 | 271 |
| 475 | 3300032005 | Ga0307411_10265740 | Ga0307411_102657402 | 271 |
| 476 | 3300035724 | Ga0373933_0123369 | Ga0373933_0123369_279_1100 | 271 |
| 477 | 3300036401 | Ga0373937_0485896 | Ga0373937_0485896_104_925 | 271 |
| 478 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_181790_182608 | 271 |
| 479 | 3300037312 | Ga0395899_0128906 | Ga0395899_0128906_147_971 | 271 |
| 480 | 3300037418 | Ga0395900_0155202 | Ga0395900_0155202_486_1307 | 271 |
| 481 | 3300037466 | Ga0395898_0260792 | Ga0395898_0260792_137_958 | 271 |
| 482 | 3300038443 | Ga0395901_0006909 | Ga0395901_0006909_5022_5843 | 271 |
| 483 | 3300039438 | Ga0436360_0004857 | Ga0436360_0004857_80_907 | 271 |
| 484 | 3300039447 | Ga0436361_1220324 | Ga0436361_1220324_438_1259 | 271 |
| 485 | 3300042438 | Ga0439459_0008336 | Ga0439459_0008336_673_1488 | 271 |
| 486 | 3300045049 | Ga0466959_0121674 | Ga0466959_0121674_1005_1841 | 271 |
| 487 | 3300046453 | Ga0495627_000655 | Ga0495627_000655_24958_25773 | 271 |
| 488 | 3300046457 | Ga0495590_0000533 | Ga0495590_0000533_5758_6573 | 271 |
| 489 | 3300046460 | Ga0495638_0000630 | Ga0495638_0000630_28626_29441 | 271 |
| 490 | 3300046460 | Ga0495638_0005885 | Ga0495638_0005885_475_1290 | 271 |
| 491 | 3300046460 | Ga0495638_0007935 | Ga0495638_0007935_2098_2913 | 271 |
| 492 | 3300046460 | Ga0495638_0060249 | Ga0495638_0060249_1471_2286 | 271 |
| 493 | 3300046471 | Ga0495650_0000168 | Ga0495650_0000168_23847_24662 | 271 |
| 494 | 3300046492 | Ga0495585_0098335 | Ga0495585_0098335_276_1091 | 271 |
| 495 | 3300046501 | Ga0495607_0094437 | Ga0495607_0094437_298_1113 | 271 |
| 496 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_491046_491861 | 271 |
| 497 | 3300046507 | Ga0495606_0003044 | Ga0495606_0003044_1069_1884 | 271 |
| 498 | 3300046512 | Ga0495610_0000304 | Ga0495610_0000304_28791_29606 | 271 |
| 499 | 3300046512 | Ga0495610_0000327 | Ga0495610_0000327_28189_29004 | 271 |
| 500 | 3300046512 | Ga0495610_0018028 | Ga0495610_0018028_1197_2012 | 271 |
| 501 | 3300046513 | Ga0495616_0000424 | Ga0495616_0000424_8283_9098 | 271 |
| 502 | 3300046518 | Ga0495631_0000936 | Ga0495631_0000936_5782_6597 | 271 |
| 503 | 3300046519 | Ga0495632_0000704 | Ga0495632_0000704_25032_25847 | 271 |
| 504 | 3300046519 | Ga0495632_0018593 | Ga0495632_0018593_2272_3087 | 271 |
| 505 | 3300046520 | Ga0495637_0041553 | Ga0495637_0041553_47_862 | 271 |
| 506 | 3300046520 | Ga0495637_0073235 | Ga0495637_0073235_112_927 | 271 |
| 507 | 3300046522 | Ga0495643_0086072 | Ga0495643_0086072_371_1186 | 271 |
| 508 | 3300046524 | Ga0495648_0000107 | Ga0495648_0000107_27812_28627 | 271 |
| 509 | 3300046530 | Ga0495654_0000085 | Ga0495654_0000085_21476_22291 | 271 |
| 510 | 3300046530 | Ga0495654_0095575 | Ga0495654_0095575_538_1353 | 271 |
| 511 | 3300046539 | Ga0495621_0005555 | Ga0495621_0005555_1685_2506 | 271 |
| 512 | 3300046558 | Ga0495633_0000400 | Ga0495633_0000400_43216_44037 | 271 |
| 513 | 3300046616 | Ga0495668_0000746 | Ga0495668_0000746_15578_16393 | 271 |
| 514 | 3300046616 | Ga0495668_0002777 | Ga0495668_0002777_12837_13652 | 271 |
| 515 | 3300046616 | Ga0495668_0044627 | Ga0495668_0044627_433_1248 | 271 |
| 516 | 3300046660 | Ga0495625_0000767 | Ga0495625_0000767_41366_42181 | 271 |
| 517 | 3300046660 | Ga0495625_0005395 | Ga0495625_0005395_2232_3047 | 271 |
| 518 | 3300046660 | Ga0495625_0011200 | Ga0495625_0011200_4681_5496 | 271 |
| 519 | 3300046660 | Ga0495625_0015310 | Ga0495625_0015310_596_1411 | 271 |
| 520 | 3300046660 | Ga0495625_0050437 | Ga0495625_0050437_755_1570 | 271 |
| 521 | 3300046689 | Ga0495613_0000049 | Ga0495613_0000049_79245_80066 | 271 |
| 522 | 3300046794 | Ga0495589_0001462 | Ga0495589_0001462_1958_2773 | 271 |
| 523 | 3300046810 | Ga0495660_0012648 | Ga0495660_0012648_1334_2149 | 271 |
| 524 | 3300046810 | Ga0495660_0020528 | Ga0495660_0020528_1756_2571 | 271 |
| 525 | 3300047320 | Ga0495672_0000928 | Ga0495672_0000928_16303_17118 | 271 |
| 526 | 3300047323 | Ga0495683_0075943 | Ga0495683_0075943_512_1327 | 271 |
| 527 | 3300047446 | Ga0495679_001129 | Ga0495679_001129_3608_4423 | 271 |
| 528 | 3300047469 | Ga0495673_0000341 | Ga0495673_0000341_10385_11200 | 271 |
| 529 | 3300047469 | Ga0495673_0001283 | Ga0495673_0001283_18836_19651 | 271 |
| 530 | 3300047470 | Ga0495681_0027009 | Ga0495681_0027009_1552_2367 | 271 |
| 531 | 3300047472 | Ga0495686_0000747 | Ga0495686_0000747_30311_31126 | 271 |
| 532 | 3300047472 | Ga0495686_0063586 | Ga0495686_0063586_905_1720 | 271 |
| 533 | 3300048909 | Ga0496106_0000700 | Ga0496106_0000700_1047_1862 | 271 |
| 534 | 3300048910 | Ga0496107_0000039 | Ga0496107_0000039_18617_19432 | 271 |
| 535 | 3300048910 | Ga0496107_0043896 | Ga0496107_0043896_107_931 | 271 |
| 536 | 3300048918 | Ga0496115_0003347 | Ga0496115_0003347_708_1523 | 271 |
| 537 | 3300048918 | Ga0496115_0023054 | Ga0496115_0023054_3851_4672 | 271 |
| 538 | 3300048918 | Ga0496115_0023938 | Ga0496115_0023938_254_1075 | 271 |
| 539 | 3300048919 | Ga0496116_0012484 | Ga0496116_0012484_5960_6781 | 271 |
| 540 | 3300048924 | Ga0496121_0001159 | Ga0496121_0001159_34650_35465 | 271 |
| 541 | 3300048925 | Ga0496122_0007549 | Ga0496122_0007549_3941_4762 | 271 |
| 542 | 3300048926 | Ga0496123_0000968 | Ga0496123_0000968_9770_10591 | 271 |
| 543 | 3300048927 | Ga0496124_0006081 | Ga0496124_0006081_3301_4116 | 271 |
| 544 | 3300048928 | Ga0496125_0001013 | Ga0496125_0001013_34346_35167 | 271 |
| 545 | 3300048928 | Ga0496125_0026301 | Ga0496125_0026301_2675_3490 | 271 |
| 546 | 3300048929 | Ga0496126_0029844 | Ga0496126_0029844_2660_3475 | 271 |
| 547 | 3300049459 | Ga0495678_002301 | Ga0495678_002301_7175_7990 | 271 |
| 548 | 3300049671 | Ga0501238_001447 | Ga0501238_001447_1753_2568 | 271 |
| 549 | 3300050516 | nmdc:mga0sz30_6092_c1 | nmdc:mga0sz30_6092_c1_2132_2947 | 271 |
| 550 | 3300053086 | Ga0500578_0000015 | Ga0500578_0000015_21625_22440 | 271 |
| 551 | 3300053088 | Ga0500644_0000124 | Ga0500644_0000124_27296_28111 | 271 |
| 552 | 3300053088 | Ga0500644_0005283 | Ga0500644_0005283_576_1391 | 271 |
| 553 | 3300053091 | Ga0500647_0004390 | Ga0500647_0004390_3591_4418 | 271 |
| 554 | 3300053096 | Ga0500641_0105058 | Ga0500641_0105058_293_1108 | 271 |
| 555 | 3300053102 | Ga0500554_002981 | Ga0500554_002981_2066_2881 | 271 |
| 556 | 3300053103 | Ga0500555_013451 | Ga0500555_013451_1461_2276 | 271 |
| 557 | 3300053104 | Ga0500556_0000933 | Ga0500556_0000933_7105_7920 | 271 |
| 558 | 3300053104 | Ga0500556_0001668 | Ga0500556_0001668_6135_6962 | 271 |
| 559 | 3300053108 | Ga0500562_000309 | Ga0500562_000309_10003_10830 | 271 |
| 560 | 3300053118 | Ga0500594_0000058 | Ga0500594_0000058_12395_13210 | 271 |
| 561 | 3300053122 | Ga0500608_000011 | Ga0500608_000011_59412_60227 | 271 |
| 562 | 3300053123 | Ga0500614_016440 | Ga0500614_016440_72_887 | 271 |
| 563 | 3300053125 | Ga0500618_000159 | Ga0500618_000159_55236_56051 | 271 |
| 564 | 3300053134 | Ga0500658_0022120 | Ga0500658_0022120_457_1272 | 271 |
| 565 | 3300053136 | Ga0500559_0000004 | Ga0500559_0000004_129461_130291 | 271 |
| 566 | 3300053136 | Ga0500559_0000009 | Ga0500559_0000009_120566_121381 | 271 |
| 567 | 3300053138 | Ga0500564_000063 | Ga0500564_000063_1602_2417 | 271 |
| 568 | 3300053142 | Ga0500577_0001434 | Ga0500577_0001434_2869_3684 | 271 |
| 569 | 3300053153 | Ga0500616_0028673 | Ga0500616_0028673_472_1287 | 271 |
| 570 | 3300053156 | Ga0500622_0000346 | Ga0500622_0000346_29117_29932 | 271 |
| 571 | 3300053156 | Ga0500622_0010123 | Ga0500622_0010123_1461_2276 | 271 |
| 572 | 3300053158 | Ga0500627_0004864 | Ga0500627_0004864_3011_3826 | 271 |
| 573 | 3300053177 | Ga0500636_0005912 | Ga0500636_0005912_2388_3218 | 271 |
| 574 | 3300053727 | Ga0500611_011313 | Ga0500611_011313_202_1017 | 271 |
| 575 | 3300053730 | Ga0500645_001712 | Ga0500645_001712_6838_7665 | 271 |
| 576 | 3300053730 | Ga0500645_003843 | Ga0500645_003843_285_1100 | 271 |
| 577 | 3300053731 | Ga0500609_000294 | Ga0500609_000294_3566_4381 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5koi-assembly3.cif.gz_E | crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis | 0.9791 | 12 | 270 |
| 4nk4-assembly1.cif.gz_A | crystal structure of fabi from candidatus liberibacter asiaticus | 0.979 | 11 | 267 |
| 5koi-assembly2.cif.gz_C | crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis | 0.9788 | 12 | 270 |
| 3grk-assembly2.cif.gz_G | crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis | 0.9779 | 12 | 265 |
| 4m87-assembly1.cif.gz_A | crystal structure of enoyl-acyl carrier protein reductase (fabi) from neisseria meningitidis in complex with nad+ | 0.9779 | 12 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEK4_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9814 | 11 | 268 | 3.40.50.720 |
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9768 | 12 | 265 | 3.40.50.720 |
| 2p91A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9713 | 12 | 266 | 3.40.50.720 |
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.969 | 12 | 265 | 3.40.50.720 |
| 2p91C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9664 | 13 | 265 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A261DBJ9-F1-model_v4 | Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) | 0.9904 | 13 | 262 |
GO:0004318
GO:0006633 |
| AF-A0A0R2TKG6-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9886 | 12 | 241 |
GO:0004318
GO:0006633 |
| AF-A0A259KAQ2-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9885 | 10 | 241 |
GO:0004318
GO:0006633 |
| AF-A0A7C5QQH0-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9885 | 3 | 169 |
GO:0004318
GO:0006633 |
| AF-A0A258KE18-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9882 | 1 | 197 |
GO:0004318
GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar