F465680

General Info

Members Datasets Scaffolds Average Seq Length
577 325 541 273

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221699|2644547764
Length 312
Sequence EGWNMPTGELMKGKKGLIMGVANANSIAWGIASQLAAQGAELAFTYLGEGLERRVRPLAESVGAKLLIQADVTDDASMDAAFAELEKAFGTIDFVIHSVAFANKDELKGSFVDNTSRDSFLLAMNISAFSFVDVAKRASKLMPNGGSLVTMTYLGSERAIPNYNTMGVAKAALEAATRYIARDLGPKGIRCNAISAGAMRTLSLAGISGGRGMISQGRAMSAMKEDTSMEGVAGAALWLCSDLGFSALSGGRGMISQGRAMSAMKEDTSMEGVAGAALWLCSDLGFSTTGEVIHVDAGFHMMGMAADEEAAG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
21 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
25 2849560528 Caulobacter zeae 410 Isolate Unclassified
26 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
27 2851153111 Caulobacter radicis 736 Isolate Unclassified
28 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
29 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
30 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
31 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
32 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
33 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
34 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
35 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
36 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
299 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
302 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
312 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
313 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
316 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
319 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
320 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
323 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
324 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0.35
Isolates 6.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.45
Nodule 0
Rhizoplane 3.99
Rhizosphere 65.51
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10016413 3300003215 Bacteria 2966
2 JGI25153J46596_10032502 3300003215 Bacteria 1739
3 rootL2_10075538 3300003322 Bacteria 2431
4 rootL2_10076302 3300003322 Bacteria 3930
5 Ga0006562J51391_1043118 3300003578 Bacteria 6110
6 Ga0006562J51391_1043120 3300003578 Bacteria 6930
7 Ga0055537_1003051 3300003773 Bacteria 5285
8 Ga0055524_1004063 3300003775 Bacteria 6876
9 Ga0055536_1001509 3300003781 Bacteria 13975
10 Ga0055536_1004147 3300003781 Bacteria 7510
11 Ga0055528_1003297 3300003790 Bacteria 8203
12 Ga0055530_10004450 3300003791 Bacteria 7197
13 Ga0055530_10006764 3300003791 Bacteria 5004
14 Ga0055530_10009547 3300003791 Bacteria 3711
15 Ga0055531_10000473 3300003794 Bacteria 37228
16 Ga0055531_10007442 3300003794 Bacteria 5976
17 Ga0055531_10012236 3300003794 Bacteria 4054
18 Ga0055531_10043766 3300003794 Bacteria 1264
19 Ga0065165_1001792 3300005262 Bacteria 21168
20 Ga0070658_10003653 3300005327 Bacteria 12599
21 Ga0070658_10009406 3300005327 Bacteria 7851
22 Ga0070658_10060026 3300005327 Bacteria 3096
23 Ga0070658_10115988 3300005327 Bacteria 2222
24 Ga0070670_100000004 3300005331 Bacteria 392110
25 Ga0070670_100035149 3300005331 Bacteria 4314
26 Ga0070670_100091271 3300005331 Bacteria 2618
27 Ga0070682_100446740 3300005337 Bacteria 989
28 Ga0070691_10017725 3300005341 Bacteria 3277
29 Ga0070661_100216675 3300005344 Bacteria 1467
30 Ga0070668_100001026 3300005347 Bacteria 19578
31 Ga0070668_100002884 3300005347 Bacteria 12687
32 Ga0070668_100002963 3300005347 Bacteria 12551
33 Ga0070668_100004810 3300005347 Bacteria 10014
34 Ga0070668_100005098 3300005347 Bacteria 9728
35 Ga0070668_100050299 3300005347 Bacteria 3209
36 Ga0070668_100061068 3300005347 Bacteria 2920
37 Ga0070669_100016959 3300005353 Bacteria 5201
38 Ga0070671_100006295 3300005355 Bacteria 9463
39 Ga0070671_100014773 3300005355 Bacteria 6310
40 Ga0070671_100172682 3300005355 Bacteria 1828
41 Ga0070673_100257574 3300005364 Bacteria 1523
42 Ga0070659_100001009 3300005366 Bacteria 20680
43 Ga0070659_100024167 3300005366 Bacteria 4656
44 Ga0070659_100117271 3300005366 Bacteria 2153
45 Ga0070667_100000105 3300005367 Bacteria 106633
46 Ga0070667_100007531 3300005367 Bacteria 9031
47 Ga0070662_100213139 3300005457 Bacteria 1538
48 Ga0070681_10008308 3300005458 Bacteria 10166
49 Ga0070681_10023353 3300005458 Bacteria 6218
50 Ga0070679_100007148 3300005530 Bacteria 10420
51 Ga0070679_100085543 3300005530 Bacteria 3140
52 Ga0068853_100037873 3300005539 Bacteria 4106
53 Ga0068853_100061011 3300005539 Bacteria 3261
54 Ga0068853_100077132 3300005539 Bacteria 2911
55 Ga0070686_100044060 3300005544 Bacteria 2802
56 Ga0070665_100000667 3300005548 Bacteria 46192
57 Ga0070665_100000721 3300005548 Bacteria 44003
58 Ga0070665_100000784 3300005548 Bacteria 41804
59 Ga0070665_100009966 3300005548 Bacteria 9611
60 Ga0070665_100144988 3300005548 Bacteria 2378
61 Ga0070665_100330983 3300005548 Bacteria 1528
62 Ga0068855_100017453 3300005563 Bacteria 8633
63 Ga0068855_100088878 3300005563 Bacteria 3568
64 Ga0068855_100170646 3300005563 Bacteria 2464
65 Ga0068854_100591000 3300005578 Bacteria 946
66 Ga0068856_100355057 3300005614 Bacteria 1485
67 Ga0068852_100008074 3300005616 Bacteria 7723
68 Ga0068852_100187617 3300005616 Bacteria 1948
69 Ga0068859_100001326 3300005617 Bacteria 25257
70 Ga0068864_100000058 3300005618 Bacteria 125688
71 Ga0068864_100000164 3300005618 Bacteria 61477
72 Ga0068864_100011174 3300005618 Bacteria 7419
73 Ga0068864_100068506 3300005618 Bacteria 3083
74 Ga0068864_100346908 3300005618 Bacteria 1400
75 Ga0068861_100077518 3300005719 Bacteria 2593
76 Ga0068863_100000290 3300005841 Bacteria 52019
77 Ga0068863_100017625 3300005841 Bacteria 6841
78 Ga0068863_100032357 3300005841 Bacteria 4985
79 Ga0068863_100187747 3300005841 Bacteria 1986
80 Ga0068863_100202095 3300005841 Bacteria 1912
81 Ga0068863_100246591 3300005841 Bacteria 1725
82 Ga0068858_100000006 3300005842 Bacteria 256011
83 Ga0068858_100001954 3300005842 Bacteria 21024
84 Ga0068860_100000066 3300005843 Bacteria 182836
85 Ga0068860_100000077 3300005843 Bacteria 171297
86 Ga0068860_100003889 3300005843 Bacteria 15347
87 Ga0068860_100272912 3300005843 Bacteria 1651
88 Ga0068860_100332577 3300005843 Bacteria 1492
89 Ga0068862_100007824 3300005844 Bacteria 8842
90 Ga0068862_100009828 3300005844 Bacteria 7903
91 Ga0068862_100013342 3300005844 Bacteria 6799
92 Ga0068862_100017696 3300005844 Bacteria 5933
93 Ga0068862_100025245 3300005844 Bacteria 4989
94 Ga0068862_100255620 3300005844 Bacteria 1598
95 Ga0075368_10018193 3300006042 Bacteria 2638
96 Ga0075363_100121989 3300006048 Bacteria 1456
97 Ga0075364_10000415 3300006051 Bacteria 21345
98 Ga0075364_10147652 3300006051 Bacteria 1584
99 Ga0075367_10014430 3300006178 Bacteria 4277
100 Ga0075369_10002774 3300006186 Bacteria 6291
101 Ga0075369_10051639 3300006186 Bacteria 1780
102 Ga0075370_10025765 3300006353 Bacteria 3254
103 Ga0075370_10105253 3300006353 Bacteria 1635
104 Ga0068865_100002365 3300006881 Bacteria 11133
105 Ga0097620_100001326 3300006931 Bacteria 25257
106 Ga0105250_10017473 3300009092 Bacteria 2917
107 Ga0105240_10009648 3300009093 Bacteria 13651
108 Ga0105240_10088456 3300009093 Bacteria 3790
109 Ga0105240_10137996 3300009093 Bacteria 2918
110 Ga0105240_10219399 3300009093 Bacteria 2217
111 Ga0105240_10373553 3300009093 Bacteria 1611
112 Ga0105240_10500583 3300009093 Bacteria 1351
113 Ga0105245_10885705 3300009098 Bacteria 934
114 Ga0105241_10338028 3300009174 Bacteria 1304
115 Ga0105242_10306750 3300009176 Bacteria 1451
116 Ga0105248_10000650 3300009177 Bacteria 39474
117 Ga0105248_10000746 3300009177 Bacteria 36566
118 Ga0105248_10223313 3300009177 Bacteria 2121
119 Ga0105237_10097435 3300009545 Bacteria 2931
120 Ga0105237_10329812 3300009545 Bacteria 1530
121 Ga0105238_10076749 3300009551 Bacteria 3333
122 Ga0105238_10365036 3300009551 Bacteria 1434
123 Ga0105238_10448837 3300009551 Bacteria 1286
124 Ga0105238_10603548 3300009551 Bacteria 1106
125 Ga0105249_10003268 3300009553 Bacteria 14047
126 Ga0105249_10074695 3300009553 Bacteria 3138
127 Ga0105249_10284378 3300009553 Bacteria 1653
128 Ga0105249_10299553 3300009553 Bacteria 1612
129 Ga0157373_10003332 3300013100 Bacteria 12134
130 Ga0157373_10004339 3300013100 Bacteria 10675
131 Ga0157373_10262799 3300013100 Bacteria 1221
132 Ga0157371_10007717 3300013102 Bacteria 8651
133 Ga0157370_10032819 3300013104 Bacteria 5068
134 Ga0157369_10135407 3300013105 Bacteria 2608
135 Ga0157374_10199420 3300013296 Bacteria 1959
136 Ga0157378_10510412 3300013297 Bacteria 1202
137 Ga0163162_10088212 3300013306 Bacteria 3181
138 Ga0157372_10278378 3300013307 Bacteria 1945
139 Ga0157375_10047309 3300013308 Bacteria 4200
140 Ga0163163_10004890 3300014325 Bacteria 11523
141 Ga0163163_10331971 3300014325 Bacteria 1575
142 Ga0157379_10018637 3300014968 Bacteria 6119
143 Ga0157379_10483777 3300014968 Bacteria 1146
144 Ga0183365_10005 3300015684 Bacteria 249619
145 Ga0213872_10039000 3300021361 Bacteria 2168
146 Ga0213875_10147955 3300021388 Bacteria 1100
147 Ga0209026_1000608 3300025250 Bacteria 23009
148 Ga0209148_1011417 3300025254 Bacteria 1651
149 Ga0209565_1000172 3300025263 Bacteria 84264
150 Ga0209673_1000451 3300025273 Bacteria 69853
151 Ga0209675_1006240 3300025291 Bacteria 4822
152 Ga0209676_1000217 3300025292 Bacteria 125740
153 Ga0209676_1000257 3300025292 Bacteria 112662
154 Ga0209676_1000316 3300025292 Bacteria 94380
155 Ga0209676_1003478 3300025292 Bacteria 9660
156 Ga0209564_1004152 3300025295 Bacteria 9075
157 Ga0209758_1001854 3300025297 Bacteria 23201
158 Ga0209758_1003752 3300025297 Bacteria 13449
159 Ga0209758_1006062 3300025297 Bacteria 8909
160 Ga0209050_1000053 3300025298 Bacteria 349521
161 Ga0209050_1000604 3300025298 Bacteria 57101
162 Ga0209050_1001151 3300025298 Bacteria 31696
163 Ga0209050_1006384 3300025298 Bacteria 6995
164 Ga0209256_1002978 3300025299 Bacteria 12650
165 Ga0209256_1005380 3300025299 Bacteria 7412
166 Ga0209051_1003216 3300025303 Bacteria 10907
167 Ga0209257_1000192 3300025304 Bacteria 151851
168 Ga0209257_1000230 3300025304 Bacteria 132032
169 Ga0209257_1000419 3300025304 Bacteria 81956
170 Ga0209257_1000541 3300025304 Bacteria 64943
171 Ga0209257_1001795 3300025304 Bacteria 23594
172 Ga0209257_1012647 3300025304 Bacteria 3869
173 Ga0207705_10003462 3300025909 Bacteria 12004
174 Ga0207705_10051010 3300025909 Bacteria 2979
175 Ga0207705_10078915 3300025909 Bacteria 2397
176 Ga0207705_10325847 3300025909 Bacteria 1181
177 Ga0207707_10133679 3300025912 Bacteria 2169
178 Ga0207707_10138738 3300025912 Bacteria 2126
179 Ga0207695_10000269 3300025913 Bacteria 130183
180 Ga0207695_10001168 3300025913 Bacteria 45314
181 Ga0207695_10010089 3300025913 Bacteria 11599
182 Ga0207660_10012589 3300025917 Bacteria 5540
183 Ga0207657_10000235 3300025919 Bacteria 58394
184 Ga0207657_10528860 3300025919 Bacteria 923
185 Ga0207652_10005742 3300025921 Bacteria 10071
186 Ga0207681_10078083 3300025923 Bacteria 2329
187 Ga0207681_10126769 3300025923 Bacteria 1881
188 Ga0207694_10022549 3300025924 Bacteria 4778
189 Ga0207694_10177688 3300025924 Bacteria 1725
190 Ga0207694_10276512 3300025924 Bacteria 1378
191 Ga0207694_10550978 3300025924 Bacteria 968
192 Ga0207650_10000033 3300025925 Bacteria 226809
193 Ga0207650_10326300 3300025925 Bacteria 1258
194 Ga0207644_10024158 3300025931 Bacteria 4170
195 Ga0207690_10000031 3300025932 Bacteria 154724
196 Ga0207690_10083331 3300025932 Bacteria 2239
197 Ga0207706_10013371 3300025933 Bacteria 7467
198 Ga0207706_10280406 3300025933 Bacteria 1453
199 Ga0207691_10222613 3300025940 Bacteria 1636
200 Ga0207711_10000368 3300025941 Bacteria 47898
201 Ga0207711_10000926 3300025941 Bacteria 28264
202 Ga0207711_10001601 3300025941 Bacteria 20928
203 Ga0207711_10055550 3300025941 Bacteria 3399
204 Ga0207711_10186347 3300025941 Bacteria 1889
205 Ga0207711_10333594 3300025941 Bacteria 1403
206 Ga0207667_10015583 3300025949 Bacteria 8625
207 Ga0207667_10131418 3300025949 Bacteria 2578
208 Ga0207667_10187155 3300025949 Bacteria 2125
209 Ga0207667_10319958 3300025949 Bacteria 1584
210 Ga0207667_10508858 3300025949 Bacteria 1221
211 Ga0207651_10340133 3300025960 Bacteria 1260
212 Ga0207712_10016645 3300025961 Bacteria 4766
213 Ga0207668_10000004 3300025972 Bacteria 201204
214 Ga0207668_10000255 3300025972 Bacteria 35541
215 Ga0207668_10003169 3300025972 Bacteria 9632
216 Ga0207668_10003930 3300025972 Bacteria 8764
217 Ga0207668_10005036 3300025972 Bacteria 7778
218 Ga0207668_10042599 3300025972 Bacteria 3075
219 Ga0207668_10118329 3300025972 Bacteria 2001
220 Ga0207658_10000607 3300025986 Bacteria 31806
221 Ga0207658_10120227 3300025986 Bacteria 2093
222 Ga0207703_10000027 3300026035 Bacteria 209608
223 Ga0207703_10011217 3300026035 Bacteria 6973
224 Ga0207703_10194347 3300026035 Bacteria 1799
225 Ga0207639_10008668 3300026041 Bacteria 6979
226 Ga0207639_10060936 3300026041 Bacteria 2912
227 Ga0207639_10659534 3300026041 Bacteria 968
228 Ga0207702_10493659 3300026078 Bacteria 1193
229 Ga0207641_10000003 3300026088 Bacteria 496984
230 Ga0207641_10001763 3300026088 Bacteria 20861
231 Ga0207641_10003861 3300026088 Bacteria 13121
232 Ga0207641_10040183 3300026088 Bacteria 3915
233 Ga0207641_10198483 3300026088 Bacteria 1848
234 Ga0207648_10479835 3300026089 Bacteria 1135
235 Ga0207676_10000175 3300026095 Bacteria 56138
236 Ga0207676_10003810 3300026095 Bacteria 10658
237 Ga0207676_10013622 3300026095 Bacteria 5837
238 Ga0207674_10259120 3300026116 Bacteria 1686
239 Ga0207698_10185146 3300026142 Bacteria 1849
240 Ga0209981_1000576 3300027378 Bacteria 4652
241 Ga0209983_1008035 3300027665 Bacteria 2157
242 Ga0209813_10055546 3300027866 Bacteria 1251
243 Ga0268266_10000003 3300028379 Bacteria 1701703
244 Ga0268266_10000970 3300028379 Bacteria 36427
245 Ga0268266_10004426 3300028379 Bacteria 13452
246 Ga0268266_10021359 3300028379 Bacteria 5515
247 Ga0268266_10061387 3300028379 Bacteria 3242
248 Ga0268265_10005393 3300028380 Bacteria 8753
249 Ga0268265_10025500 3300028380 Bacteria 4198
250 Ga0268265_10243257 3300028380 Bacteria 1589
251 Ga0268264_10000032 3300028381 Bacteria 408337
252 Ga0268264_10000113 3300028381 Bacteria 203262
253 Ga0268264_10065189 3300028381 Bacteria 3068
254 Ga0268264_10374208 3300028381 Bacteria 1362
255 Ga0265337_1043322 3300028556 Bacteria 1287
256 Ga0265334_10086777 3300028573 Bacteria 1146
257 Ga0307517_10005788 3300028786 Bacteria 18484
258 Ga0307517_10084629 3300028786 Bacteria 2667
259 Ga0307515_10010603 3300028794 Bacteria 17640
260 Ga0307515_10024332 3300028794 Bacteria 10559
261 Ga0265338_10043089 3300028800 Bacteria 4192
262 Ga0265338_10135343 3300028800 Bacteria 1938
263 Ga0265338_10270957 3300028800 Bacteria 1244
264 Ga0265338_10298119 3300028800 Bacteria 1173
265 Ga0265330_10026247 3300031235 Bacteria 2636
266 Ga0265320_10090631 3300031240 Bacteria 1416
267 Ga0265325_10061346 3300031241 Bacteria 1907
268 Ga0265340_10072033 3300031247 Bacteria 1637
269 Ga0265327_10000442 3300031251 Bacteria 75162
270 Ga0265327_10002781 3300031251 Bacteria 17689
271 Ga0265327_10004906 3300031251 Bacteria 11548
272 Ga0265327_10091619 3300031251 Bacteria 1481
273 Ga0265316_10009583 3300031344 Bacteria 8901
274 Ga0307513_10003286 3300031456 Bacteria 22017
275 Ga0307513_10006509 3300031456 Bacteria 15255
276 Ga0307513_10011589 3300031456 Bacteria 10947
277 Ga0265313_10003742 3300031595 Bacteria 12102
278 Ga0265314_10005570 3300031711 Bacteria 11322
279 Ga0265314_10223771 3300031711 Bacteria 1096
280 Ga0307516_10001321 3300031730 Bacteria 34374
281 Ga0307413_10348201 3300031824 Bacteria 1142
282 Ga0307406_10001177 3300031901 Bacteria 14642
283 Ga0307407_10060407 3300031903 Bacteria 2212
284 Ga0307412_10051120 3300031911 Bacteria 2730
285 Ga0307414_10029061 3300032004 Bacteria 3594
286 Ga0307411_10265740 3300032005 Bacteria 1357
287 Ga0307510_10017145 3300033180 Bacteria 8544
288 Ga0373926_0047811 3300035083 Bacteria 1538
289 Ga0373936_0003245 3300035113 Bacteria 6098
290 Ga0373936_0054472 3300035113 Bacteria 1623
291 Ga0373946_0026074 3300035171 Bacteria 2303
292 Ga0373931_0058938 3300035691 Bacteria 2064
293 Ga0373935_0429036 3300035692 Bacteria 952
294 Ga0373927_0000111 3300035695 Bacteria 62031
295 Ga0373933_0123369 3300035724 Bacteria 1624
296 Ga0373947_0040646 3300035725 Bacteria 2771
297 Ga0373937_0485896 3300036401 Bacteria 1173
298 Ga0373925_0000209 3300037068 Bacteria 64086
299 Ga0395899_0000003 3300037312 Bacteria 1232684
300 Ga0395899_0001215 3300037312 Bacteria 22577
301 Ga0395899_0041268 3300037312 Bacteria 3448
302 Ga0395899_0128906 3300037312 Bacteria 1808
303 Ga0395900_0000002 3300037418 Bacteria 671103
304 Ga0395900_0046092 3300037418 Bacteria 4489
305 Ga0395900_0155202 3300037418 Bacteria 2338
306 Ga0395898_0015320 3300037466 Bacteria 7864
307 Ga0395898_0039155 3300037466 Bacteria 4693
308 Ga0395898_0260792 3300037466 Bacteria 1653
309 Ga0395898_0272461 3300037466 Bacteria 1614
310 Ga0395905_0000156 3300037471 Bacteria 112215
311 Ga0395905_0002451 3300037471 Bacteria 20546
312 Ga0395905_0019172 3300037471 Bacteria 6487
313 Ga0395905_0175035 3300037471 Bacteria 2015
314 Ga0436364_1149156 3300037853 Bacteria 950
315 Ga0436364_1296096 3300037853 Bacteria 1501
316 Ga0395901_0001134 3300038443 Bacteria 28242
317 Ga0395901_0005477 3300038443 Bacteria 12856
318 Ga0395901_0006909 3300038443 Bacteria 11467
319 Ga0395901_0126730 3300038443 Bacteria 2683
320 Ga0395901_0414114 3300038443 Bacteria 1383
321 Ga0436365_0925532 3300039437 Bacteria 4943
322 Ga0436365_1016387 3300039437 Bacteria 3291
323 Ga0436360_0004857 3300039438 Bacteria 1050
324 Ga0436360_0143736 3300039438 Bacteria 1373
325 Ga0436361_1220324 3300039447 Bacteria 3922
326 Ga0436363_0732400 3300039450 Bacteria 1613
327 Ga0436362_0106222 3300039453 Bacteria 820
328 Ga0439445_0016909 3300042004 Bacteria 1799
329 Ga0439459_0008336 3300042438 Bacteria 1769
330 Ga0466969_0008821 3300044656 Bacteria 5345
331 Ga0466966_0000243 3300044684 Bacteria 36130
332 Ga0466961_0001495 3300044693 Bacteria 14498
333 Ga0466961_0031369 3300044693 Bacteria 3416
334 Ga0466961_0219647 3300044693 Bacteria 1172
335 Ga0466963_0358798 3300044694 Bacteria 1027
336 Ga0466971_0002839 3300044719 Bacteria 7341
337 Ga0466970_0002408 3300044765 Bacteria 9037
338 Ga0466957_0004982 3300044842 Bacteria 7434
339 Ga0466959_0007645 3300045049 Bacteria 7600
340 Ga0466959_0121674 3300045049 Bacteria 1855
341 Ga0466959_0158836 3300045049 Bacteria 1590
342 Ga0466958_0004123 3300045836 Bacteria 7628
343 Ga0495627_000655 3300046453 Bacteria 26680
344 Ga0495590_0000533 3300046457 Bacteria 18274
345 Ga0495629_0190954 3300046459 Bacteria 1418
346 Ga0495638_0000630 3300046460 Bacteria 38937
347 Ga0495638_0005885 3300046460 Bacteria 9012
348 Ga0495638_0007935 3300046460 Bacteria 7570
349 Ga0495638_0060249 3300046460 Bacteria 2348
350 Ga0495650_0000168 3300046471 Bacteria 145714
351 Ga0495585_0098335 3300046492 Bacteria 1568
352 Ga0495607_0094437 3300046501 Bacteria 1613
353 Ga0495583_0000003 3300046506 Bacteria 709273
354 Ga0495606_0003044 3300046507 Bacteria 18275
355 Ga0495610_0000304 3300046512 Bacteria 51895
356 Ga0495610_0000327 3300046512 Bacteria 50683
357 Ga0495610_0018028 3300046512 Bacteria 4002
358 Ga0495616_0000424 3300046513 Bacteria 32547
359 Ga0495631_0000936 3300046518 Bacteria 18204
360 Ga0495632_0000704 3300046519 Bacteria 30414
361 Ga0495632_0018593 3300046519 Bacteria 3809
362 Ga0495637_0041553 3300046520 Bacteria 1971
363 Ga0495637_0073235 3300046520 Bacteria 1378
364 Ga0495643_0086072 3300046522 Bacteria 1628
365 Ga0495648_0000107 3300046524 Bacteria 104376
366 Ga0495642_0002890 3300046528 Bacteria 6853
367 Ga0495642_0045401 3300046528 Bacteria 1796
368 Ga0495654_0000085 3300046530 Bacteria 107010
369 Ga0495654_0095575 3300046530 Bacteria 1374
370 Ga0495621_0005555 3300046539 Bacteria 3631
371 Ga0495645_0011398 3300046543 Bacteria 6255
372 Ga0495645_0181120 3300046543 Bacteria 1444
373 Ga0495622_0002815 3300046557 Bacteria 8296
374 Ga0495633_0000400 3300046558 Bacteria 45378
375 Ga0495668_0000746 3300046616 Bacteria 38674
376 Ga0495668_0002777 3300046616 Bacteria 13961
377 Ga0495668_0014958 3300046616 Bacteria 4540
378 Ga0495668_0027699 3300046616 Bacteria 3211
379 Ga0495668_0044627 3300046616 Bacteria 2463
380 Ga0495668_0097116 3300046616 Bacteria 1612
381 Ga0495611_0025585 3300046648 Bacteria 2573
382 Ga0495625_0000767 3300046660 Bacteria 44760
383 Ga0495625_0005395 3300046660 Bacteria 11685
384 Ga0495625_0011200 3300046660 Bacteria 7333
385 Ga0495625_0013345 3300046660 Bacteria 6604
386 Ga0495625_0015310 3300046660 Bacteria 6078
387 Ga0495625_0050437 3300046660 Bacteria 2986
388 Ga0495625_0177851 3300046660 Bacteria 1417
389 Ga0495669_0000007 3300046684 Bacteria 180797
390 Ga0495669_0000731 3300046684 Bacteria 14261
391 Ga0495669_0002870 3300046684 Bacteria 7073
392 Ga0495669_0087647 3300046684 Bacteria 1435
393 Ga0495613_0000049 3300046689 Bacteria 122792
394 Ga0495649_0000077 3300046694 Bacteria 84222
395 Ga0495589_0001462 3300046794 Bacteria 13600
396 Ga0495660_0012648 3300046810 Bacteria 4899
397 Ga0495660_0020528 3300046810 Bacteria 3787
398 Ga0495581_0030427 3300047315 Bacteria 3128
399 Ga0495636_0065022 3300047318 Bacteria 1549
400 Ga0495672_0000928 3300047320 Bacteria 30608
401 Ga0495672_0135041 3300047320 Bacteria 1294
402 Ga0495683_0075943 3300047323 Bacteria 1645
403 Ga0495679_001129 3300047446 Bacteria 16011
404 Ga0495685_097256 3300047447 Bacteria 973
405 Ga0495673_0000341 3300047469 Bacteria 59080
406 Ga0495673_0001283 3300047469 Bacteria 20512
407 Ga0495681_0027009 3300047470 Bacteria 2977
408 Ga0495686_0000747 3300047472 Bacteria 43114
409 Ga0495686_0011091 3300047472 Bacteria 6368
410 Ga0495686_0063586 3300047472 Bacteria 2286
411 Ga0495602_0398319 3300048088 Bacteria 982
412 Ga0496101_0151747 3300048904 Bacteria 1773
413 Ga0496101_0331904 3300048904 Bacteria 1194
414 Ga0496102_0024604 3300048905 Bacteria 5354
415 Ga0496102_0026068 3300048905 Bacteria 5210
416 Ga0496103_0180468 3300048906 Bacteria 1357
417 Ga0496106_0000700 3300048909 Bacteria 24093
418 Ga0496106_0217607 3300048909 Bacteria 1523
419 Ga0496107_0000039 3300048910 Bacteria 77588
420 Ga0496107_0043896 3300048910 Bacteria 3213
421 Ga0496107_0146951 3300048910 Bacteria 1743
422 Ga0496109_0121267 3300048912 Bacteria 2436
423 Ga0496110_0158936 3300048913 Bacteria 2048
424 Ga0496111_0096490 3300048914 Bacteria 2170
425 Ga0496112_0104960 3300048915 Bacteria 2795
426 Ga0496112_0230569 3300048915 Bacteria 1806
427 Ga0496112_0410367 3300048915 Bacteria 1294
428 Ga0496115_0000460 3300048918 Bacteria 32584
429 Ga0496115_0000467 3300048918 Bacteria 32205
430 Ga0496115_0003347 3300048918 Bacteria 11499
431 Ga0496115_0023054 3300048918 Bacteria 4829
432 Ga0496115_0023938 3300048918 Bacteria 4743
433 Ga0496115_0118120 3300048918 Bacteria 2181
434 Ga0496115_0409535 3300048918 Bacteria 1099
435 Ga0496116_0012484 3300048919 Bacteria 6938
436 Ga0496117_0015210 3300048920 Bacteria 6580
437 Ga0496118_0006612 3300048921 Bacteria 12659
438 Ga0496119_0051361 3300048922 Bacteria 2534
439 Ga0496121_0000042 3300048924 Bacteria 342304
440 Ga0496121_0001159 3300048924 Bacteria 46235
441 Ga0496121_0299484 3300048924 Bacteria 1092
442 Ga0496122_0007549 3300048925 Bacteria 12037
443 Ga0496123_0000968 3300048926 Bacteria 44375
444 Ga0496124_0006081 3300048927 Bacteria 13274
445 Ga0496125_0001013 3300048928 Bacteria 43693
446 Ga0496125_0014570 3300048928 Bacteria 7651
447 Ga0496125_0026301 3300048928 Bacteria 5307
448 Ga0496126_0029844 3300048929 Bacteria 5176
449 Ga0495678_002301 3300049459 Bacteria 13182
450 Ga0495682_0066544 3300049460 Bacteria 1299
451 Ga0501033_0002580 3300049570 Bacteria 15275
452 Ga0501034_0001020 3300049571 Bacteria 40131
453 Ga0501034_0005292 3300049571 Bacteria 14152
454 Ga0501034_0247068 3300049571 Bacteria 1729
455 Ga0501034_0372117 3300049571 Bacteria 1355
456 Ga0501036_0196037 3300049572 Bacteria 1699
457 Ga0501037_0012688 3300049573 Bacteria 6207
458 Ga0501037_0494371 3300049573 Bacteria 830
459 Ga0501039_0480881 3300049575 Bacteria 975
460 Ga0501043_0020099 3300049579 Bacteria 5242
461 Ga0501043_0145535 3300049579 Bacteria 1856
462 Ga0501047_0006163 3300049581 Bacteria 11276
463 Ga0501047_0006395 3300049581 Bacteria 11080
464 Ga0501047_0107689 3300049581 Bacteria 2669
465 Ga0501048_0045657 3300049582 Bacteria 3129
466 Ga0501070_0096934 3300049586 Bacteria 2440
467 Ga0501238_001447 3300049671 Bacteria 2755
468 Ga0501035_0007673 3300049822 Bacteria 10079
469 Ga0501044_0012706 3300049823 Bacteria 9120
470 Ga0501044_0047950 3300049823 Bacteria 4417
471 Ga0501044_0158885 3300049823 Bacteria 2238
472 Ga0501044_0678509 3300049823 Bacteria 917
473 nmdc:mga03n38_125582_c1 3300050490 Bacteria 1266
474 nmdc:mga00v17_494_c1 3300050491 Bacteria 22171
475 nmdc:mga0k408_13076_c1 3300050493 Bacteria 4545
476 nmdc:mga06z11_68743_c1 3300050494 Bacteria 1377
477 nmdc:mga0sz30_6092_c1 3300050516 Bacteria 4463
478 Ga0500635_0000236 3300053080 Bacteria 24446
479 Ga0500635_0000399 3300053080 Bacteria 13188
480 Ga0500578_0000015 3300053086 Bacteria 179217
481 Ga0500578_0267067 3300053086 Bacteria 1025
482 Ga0500643_016809 3300053087 Bacteria 2467
483 Ga0500643_024568 3300053087 Bacteria 1911
484 Ga0500644_0000124 3300053088 Bacteria 47262
485 Ga0500644_0002839 3300053088 Bacteria 4305
486 Ga0500644_0005283 3300053088 Bacteria 3255
487 Ga0500647_0004390 3300053091 Bacteria 5670
488 Ga0500583_0009227 3300053092 Bacteria 3593
489 Ga0500651_0021284 3300053093 Bacteria 4042
490 Ga0500651_0027381 3300053093 Bacteria 3585
491 Ga0500651_0133214 3300053093 Bacteria 1502
492 Ga0500641_0004493 3300053096 Bacteria 4928
493 Ga0500641_0105058 3300053096 Bacteria 1213
494 Ga0500641_0126450 3300053096 Bacteria 1102
495 Ga0500554_002981 3300053102 Bacteria 3400
496 Ga0500555_000832 3300053103 Bacteria 11017
497 Ga0500555_013451 3300053103 Bacteria 2361
498 Ga0500556_0000933 3300053104 Bacteria 15845
499 Ga0500556_0001668 3300053104 Bacteria 8614
500 Ga0500562_000309 3300053108 Bacteria 11881
501 Ga0500569_014045 3300053109 Bacteria 1975
502 Ga0500572_000593 3300053111 Bacteria 12235
503 Ga0500594_0000058 3300053118 Bacteria 34612
504 Ga0500595_038518 3300053119 Bacteria 1553
505 Ga0500608_000011 3300053122 Bacteria 92215
506 Ga0500608_000096 3300053122 Bacteria 35522
507 Ga0500608_033133 3300053122 Bacteria 2457
508 Ga0500614_016440 3300053123 Bacteria 1660
509 Ga0500614_040219 3300053123 Bacteria 1185
510 Ga0500618_000159 3300053125 Bacteria 56114
511 Ga0500642_0133841 3300053130 Bacteria 1162
512 Ga0500658_0022120 3300053134 Bacteria 2413
513 Ga0500559_0000004 3300053136 Bacteria 241551
514 Ga0500559_0000009 3300053136 Bacteria 174153
515 Ga0500564_000063 3300053138 Bacteria 28411
516 Ga0500577_0001434 3300053142 Bacteria 6106
517 Ga0500590_073723 3300053148 Bacteria 1691
518 Ga0500603_018874 3300053150 Bacteria 1667
519 Ga0500616_0020318 3300053153 Bacteria 3732
520 Ga0500616_0028673 3300053153 Bacteria 3067
521 Ga0500619_013183 3300053154 Bacteria 2184
522 Ga0500622_0000346 3300053156 Bacteria 45265
523 Ga0500622_0010123 3300053156 Bacteria 5192
524 Ga0500622_0047939 3300053156 Bacteria 2205
525 Ga0500624_006243 3300053157 Bacteria 1607
526 Ga0500627_0004864 3300053158 Bacteria 4381
527 Ga0500633_0156059 3300053160 Bacteria 856
528 Ga0500638_152333 3300053162 Bacteria 1027
529 Ga0500636_0005912 3300053177 Bacteria 7014
530 Ga0500637_0012246 3300053178 Bacteria 4463
531 Ga0500611_011313 3300053727 Bacteria 1472
532 Ga0500625_073392 3300053729 Bacteria 1515
533 Ga0500645_000487 3300053730 Bacteria 26840
534 Ga0500645_001712 3300053730 Bacteria 10672
535 Ga0500645_002212 3300053730 Bacteria 8872
536 Ga0500645_003843 3300053730 Bacteria 5952
537 Ga0500645_042669 3300053730 Bacteria 1337
538 Ga0500609_000294 3300053731 Bacteria 7368
539 Ga0500596_003859 3300053735 Bacteria 2805
540 Ga0500601_012371 3300053737 Bacteria 963
541 Ga0466962_0000097 3300061719 Bacteria 35226

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0106222 Ga0436362_0106222_36_794 249
2 3300053160 Ga0500633_0156059 Ga0500633_0156059_18_773 251
3 3300053162 Ga0500638_152333 Ga0500638_152333_257_1015 251
4 3300049573 Ga0501037_0494371 Ga0501037_0494371_25_810 252
5 3300037466 Ga0395898_0272461 Ga0395898_0272461_137_964 255
6 3300049571 Ga0501034_0001020 Ga0501034_0001020_32271_33047 255
7 iso_pu_bacteria 2854681122 2854684990 255
8 iso_pu_bacteria 3000405567 3000406993 255
9 3300053153 Ga0500616_0020318 Ga0500616_0020318_2322_3143 256
10 3300031235 Ga0265330_10026247 Ga0265330_100262472 258
11 3300031344 Ga0265316_10009583 Ga0265316_100095839 258
12 3300031595 Ga0265313_10003742 Ga0265313_100037428 258
13 3300031711 Ga0265314_10005570 Ga0265314_100055706 258
14 3300046528 Ga0495642_0002890 Ga0495642_0002890_5719_6501 258
15 3300046684 Ga0495669_0087647 Ga0495669_0087647_256_1038 258
16 3300053096 Ga0500641_0126450 Ga0500641_0126450_304_1086 258
17 3300005544 Ga0070686_100044060 Ga0070686_1000440602 259
18 3300006051 Ga0075364_10147652 Ga0075364_101476522 259
19 3300005327 Ga0070658_10003653 Ga0070658_100036537 260
20 3300037312 Ga0395899_0041268 Ga0395899_0041268_765_1559 260
21 3300037418 Ga0395900_0046092 Ga0395900_0046092_2030_2824 260
22 3300037466 Ga0395898_0039155 Ga0395898_0039155_151_945 260
23 3300038443 Ga0395901_0005477 Ga0395901_0005477_9755_10549 260
24 3300039450 Ga0436363_0732400 Ga0436363_0732400_99_929 260
25 3300049586 Ga0501070_0096934 Ga0501070_0096934_851_1639 260
26 3300049575 Ga0501039_0480881 Ga0501039_0480881_41_847 261
27 3300049571 Ga0501034_0247068 Ga0501034_0247068_372_1229 262
28 3300031241 Ga0265325_10061346 Ga0265325_100613462 263
29 3300046660 Ga0495625_0013345 Ga0495625_0013345_55_852 263
30 3300046684 Ga0495669_0002870 Ga0495669_0002870_6263_7057 263
31 3300005616 Ga0068852_100187617 Ga0068852_1001876171 264
32 3300035113 Ga0373936_0054472 Ga0373936_0054472_120_920 264
33 3300035692 Ga0373935_0429036 Ga0373935_0429036_16_816 264
34 3300037312 Ga0395899_0001215 Ga0395899_0001215_17237_18043 264
35 3300037418 Ga0395900_0000002 Ga0395900_0000002_301571_302377 264
36 3300037466 Ga0395898_0015320 Ga0395898_0015320_6341_7147 264
37 3300037471 Ga0395905_0002451 Ga0395905_0002451_2504_3310 264
38 3300038443 Ga0395901_0001134 Ga0395901_0001134_1634_2440 264
39 3300046616 Ga0495668_0014958 Ga0495668_0014958_1412_2212 264
40 3300046648 Ga0495611_0025585 Ga0495611_0025585_1761_2561 264
41 3300046660 Ga0495625_0177851 Ga0495625_0177851_266_1066 264
42 3300048904 Ga0496101_0331904 Ga0496101_0331904_348_1148 264
43 3300048918 Ga0496115_0118120 Ga0496115_0118120_1185_1985 264
44 3300049572 Ga0501036_0196037 Ga0501036_0196037_140_1003 264
45 3300049823 Ga0501044_0158885 Ga0501044_0158885_286_1107 264
46 3300005458 Ga0070681_10023353 Ga0070681_100233532 265
47 3300005578 Ga0068854_100591000 Ga0068854_1005910001 265
48 3300005616 Ga0068852_100008074 Ga0068852_1000080743 265
49 3300009093 Ga0105240_10009648 Ga0105240_1000964817 265
50 3300009093 Ga0105240_10088456 Ga0105240_100884564 265
51 3300013307 Ga0157372_10278378 Ga0157372_102783782 265
52 3300025912 Ga0207707_10133679 Ga0207707_101336792 265
53 3300025913 Ga0207695_10001168 Ga0207695_1000116824 265
54 3300025913 Ga0207695_10010089 Ga0207695_100100893 265
55 3300025949 Ga0207667_10508858 Ga0207667_105088582 265
56 iso_pu_bacteria 2643221598 2643999595 265
57 iso_pu_bacteria 2643221614 2644087582 265
58 iso_pu_bacteria 2643221661 2644344374 265
59 iso_pu_bacteria 2643221666 2644366941 265
60 iso_pu_bacteria 2739367756 2739791958 266
61 3300037471 Ga0395905_0175035 Ga0395905_0175035_542_1354 267
62 iso_pu_bacteria 2510917020 2511122298 267
63 iso_pu_bacteria 2582581279 2585149762 267
64 iso_pu_bacteria 2582581280 2585151226 267
65 iso_pu_bacteria 2582581293 2585197095 267
66 iso_pu_bacteria 2585428106 2587919984 267
67 iso_pu_bacteria 2643221545 2643747648 267
68 iso_pu_bacteria 2643221552 2643781950 267
69 iso_pu_bacteria 2643221583 2643924118 267
70 iso_pu_bacteria 2643221584 2643931920 267
71 iso_pu_bacteria 2643221640 2644223384 267
72 iso_pu_bacteria 2643221642 2644237126 267
73 iso_pu_bacteria 2643221691 2644506970 267
74 iso_pu_bacteria 2791355048 2792463093 267
75 iso_pu_bacteria 2818991435 2819538302 267
76 iso_pu_bacteria 2818991454 2819647128 267
77 iso_pu_bacteria 2843744320 2843745421 267
78 iso_pu_bacteria 2849560528 2849561032 267
79 iso_pu_bacteria 2849573788 2849576222 267
80 iso_pu_bacteria 2851153111 2851157070 267
81 iso_pu_bacteria 2857504554 2857505761 267
82 iso_pu_bacteria 2884960567 2884965577 267
83 iso_pu_bacteria 2898329390 2898332741 267
84 iso_pu_bacteria 2928531327 2928532126 267
85 3300009093 Ga0105240_10500583 Ga0105240_105005832 268
86 3300015684 Ga0183365_10005 Ga0183365_1000577 268
87 3300031251 Ga0265327_10000442 Ga0265327_1000044267 268
88 3300031251 Ga0265327_10002781 Ga0265327_1000278119 268
89 3300031730 Ga0307516_10001321 Ga0307516_1000132138 268
90 3300031824 Ga0307413_10348201 Ga0307413_103482012 268
91 3300044656 Ga0466969_0008821 Ga0466969_0008821_2849_3664 268
92 3300044684 Ga0466966_0000243 Ga0466966_0000243_31395_32210 268
93 3300044693 Ga0466961_0001495 Ga0466961_0001495_2722_3537 268
94 3300044719 Ga0466971_0002839 Ga0466971_0002839_2560_3375 268
95 3300044765 Ga0466970_0002408 Ga0466970_0002408_4120_4935 268
96 3300044842 Ga0466957_0004982 Ga0466957_0004982_2991_3806 268
97 3300045049 Ga0466959_0007645 Ga0466959_0007645_3166_3981 268
98 3300045836 Ga0466958_0004123 Ga0466958_0004123_3194_4009 268
99 3300046543 Ga0495645_0181120 Ga0495645_0181120_147_959 268
100 3300047320 Ga0495672_0135041 Ga0495672_0135041_59_871 268
101 3300048928 Ga0496125_0014570 Ga0496125_0014570_190_1005 268
102 3300049571 Ga0501034_0372117 Ga0501034_0372117_287_1165 268
103 3300049579 Ga0501043_0020099 Ga0501043_0020099_122_937 268
104 3300049581 Ga0501047_0006395 Ga0501047_0006395_9153_9965 268
105 3300049822 Ga0501035_0007673 Ga0501035_0007673_8739_9554 268
106 3300049823 Ga0501044_0047950 Ga0501044_0047950_3547_4359 268
107 3300053080 Ga0500635_0000236 Ga0500635_0000236_3459_4274 268
108 3300053122 Ga0500608_000096 Ga0500608_000096_7630_8445 268
109 3300061719 Ga0466962_0000097 Ga0466962_0000097_2735_3550 268
110 iso_pu_bacteria 2643221663 2644351304 268
111 3300005327 Ga0070658_10115988 Ga0070658_101159883 269
112 3300005331 Ga0070670_100000004 Ga0070670_10000000461 269
113 3300005341 Ga0070691_10017725 Ga0070691_100177253 269
114 3300005347 Ga0070668_100001026 Ga0070668_1000010269 269
115 3300005347 Ga0070668_100002884 Ga0070668_10000288412 269
116 3300005347 Ga0070668_100061068 Ga0070668_1000610682 269
117 3300005355 Ga0070671_100014773 Ga0070671_1000147733 269
118 3300005367 Ga0070667_100000105 Ga0070667_10000010578 269
119 3300005530 Ga0070679_100007148 Ga0070679_1000071486 269
120 3300005539 Ga0068853_100077132 Ga0068853_1000771322 269
121 3300005548 Ga0070665_100000667 Ga0070665_10000066726 269
122 3300005548 Ga0070665_100000784 Ga0070665_10000078439 269
123 3300005563 Ga0068855_100088878 Ga0068855_1000888782 269
124 3300005618 Ga0068864_100000058 Ga0068864_10000005876 269
125 3300005618 Ga0068864_100000164 Ga0068864_10000016419 269
126 3300005841 Ga0068863_100000290 Ga0068863_10000029042 269
127 3300005841 Ga0068863_100032357 Ga0068863_1000323573 269
128 3300005842 Ga0068858_100000006 Ga0068858_100000006213 269
129 3300005842 Ga0068858_100001954 Ga0068858_1000019542 269
130 3300005843 Ga0068860_100000077 Ga0068860_10000007761 269
131 3300005844 Ga0068862_100013342 Ga0068862_1000133422 269
132 3300005844 Ga0068862_100025245 Ga0068862_1000252454 269
133 3300005844 Ga0068862_100255620 Ga0068862_1002556202 269
134 3300006048 Ga0075363_100121989 Ga0075363_1001219892 269
135 3300009092 Ga0105250_10017473 Ga0105250_100174734 269
136 3300009093 Ga0105240_10137996 Ga0105240_101379962 269
137 3300009093 Ga0105240_10373553 Ga0105240_103735532 269
138 3300009177 Ga0105248_10223313 Ga0105248_102233132 269
139 3300009545 Ga0105237_10097435 Ga0105237_100974351 269
140 3300009551 Ga0105238_10365036 Ga0105238_103650361 269
141 3300009553 Ga0105249_10003268 Ga0105249_1000326818 269
142 3300009553 Ga0105249_10074695 Ga0105249_100746952 269
143 3300014968 Ga0157379_10018637 Ga0157379_100186377 269
144 3300025909 Ga0207705_10078915 Ga0207705_100789151 269
145 3300025913 Ga0207695_10000269 Ga0207695_10000269120 269
146 3300025925 Ga0207650_10000033 Ga0207650_10000033155 269
147 3300025941 Ga0207711_10000926 Ga0207711_100009265 269
148 3300025941 Ga0207711_10055550 Ga0207711_100555504 269
149 3300025949 Ga0207667_10319958 Ga0207667_103199581 269
150 3300025961 Ga0207712_10016645 Ga0207712_100166456 269
151 3300025972 Ga0207668_10000004 Ga0207668_10000004171 269
152 3300025972 Ga0207668_10000255 Ga0207668_1000025518 269
153 3300025972 Ga0207668_10118329 Ga0207668_101183292 269
154 3300025986 Ga0207658_10000607 Ga0207658_100006073 269
155 3300026035 Ga0207703_10000027 Ga0207703_10000027138 269
156 3300026035 Ga0207703_10011217 Ga0207703_100112172 269
157 3300026088 Ga0207641_10000003 Ga0207641_10000003236 269
158 3300026088 Ga0207641_10003861 Ga0207641_100038619 269
159 3300026089 Ga0207648_10479835 Ga0207648_104798351 269
160 3300026095 Ga0207676_10000175 Ga0207676_1000017555 269
161 3300026095 Ga0207676_10003810 Ga0207676_100038105 269
162 3300028379 Ga0268266_10000970 Ga0268266_1000097038 269
163 3300028379 Ga0268266_10004426 Ga0268266_1000442617 269
164 3300028380 Ga0268265_10025500 Ga0268265_100255001 269
165 3300028380 Ga0268265_10243257 Ga0268265_102432572 269
166 3300028381 Ga0268264_10000032 Ga0268264_10000032355 269
167 3300028786 Ga0307517_10005788 Ga0307517_1000578820 269
168 3300028800 Ga0265338_10135343 Ga0265338_101353431 269
169 3300031456 Ga0307513_10006509 Ga0307513_100065093 269
170 3300031456 Ga0307513_10011589 Ga0307513_100115899 269
171 3300037471 Ga0395905_0000156 Ga0395905_0000156_93694_94512 269
172 3300039437 Ga0436365_0925532 Ga0436365_0925532_3754_4566 269
173 3300039437 Ga0436365_1016387 Ga0436365_1016387_1716_2531 269
174 3300044693 Ga0466961_0031369 Ga0466961_0031369_2326_3144 269
175 3300045049 Ga0466959_0158836 Ga0466959_0158836_366_1184 269
176 3300046616 Ga0495668_0027699 Ga0495668_0027699_66_896 269
177 3300046616 Ga0495668_0097116 Ga0495668_0097116_548_1360 269
178 3300046694 Ga0495649_0000077 Ga0495649_0000077_74475_75293 269
179 3300047315 Ga0495581_0030427 Ga0495581_0030427_1099_1911 269
180 3300047447 Ga0495685_097256 Ga0495685_097256_62_874 269
181 3300048088 Ga0495602_0398319 Ga0495602_0398319_47_859 269
182 3300048905 Ga0496102_0024604 Ga0496102_0024604_191_1006 269
183 3300048905 Ga0496102_0026068 Ga0496102_0026068_1097_2014 269
184 3300048920 Ga0496117_0015210 Ga0496117_0015210_4202_5017 269
185 3300048921 Ga0496118_0006612 Ga0496118_0006612_21_836 269
186 3300048922 Ga0496119_0051361 Ga0496119_0051361_1607_2422 269
187 3300048924 Ga0496121_0000042 Ga0496121_0000042_233349_234164 269
188 3300049460 Ga0495682_0066544 Ga0495682_0066544_44_856 269
189 3300049581 Ga0501047_0107689 Ga0501047_0107689_1284_2102 269
190 3300053080 Ga0500635_0000399 Ga0500635_0000399_648_1460 269
191 3300053086 Ga0500578_0267067 Ga0500578_0267067_91_903 269
192 3300053087 Ga0500643_016809 Ga0500643_016809_1221_2111 269
193 3300053092 Ga0500583_0009227 Ga0500583_0009227_393_1205 269
194 3300053093 Ga0500651_0021284 Ga0500651_0021284_793_1611 269
195 3300053093 Ga0500651_0133214 Ga0500651_0133214_503_1315 269
196 3300053103 Ga0500555_000832 Ga0500555_000832_820_1635 269
197 3300053109 Ga0500569_014045 Ga0500569_014045_1037_1849 269
198 3300053119 Ga0500595_038518 Ga0500595_038518_588_1400 269
199 3300053123 Ga0500614_040219 Ga0500614_040219_252_1064 269
200 3300053130 Ga0500642_0133841 Ga0500642_0133841_307_1119 269
201 3300053148 Ga0500590_073723 Ga0500590_073723_548_1360 269
202 3300053150 Ga0500603_018874 Ga0500603_018874_51_863 269
203 3300053157 Ga0500624_006243 Ga0500624_006243_30_842 269
204 3300053729 Ga0500625_073392 Ga0500625_073392_575_1387 269
205 3300053730 Ga0500645_002212 Ga0500645_002212_6356_7171 269
206 3300053735 Ga0500596_003859 Ga0500596_003859_273_1085 269
207 3300053737 Ga0500601_012371 Ga0500601_012371_30_842 269
208 iso_pu_bacteria 2643221574 2643882214 269
209 iso_pu_bacteria 2643221699 2644547764 269
210 iso_pu_bacteria 2928972540 2928973405 269
211 iso_pu_bacteria 2941485952 2941489400 269
212 iso_pu_bacteria 2977240413 2977240617 269
213 3300003781 Ga0055536_1004147 Ga0055536_10041474 270
214 3300003791 Ga0055530_10006764 Ga0055530_100067643 270
215 3300003794 Ga0055531_10012236 Ga0055531_100122362 270
216 3300005327 Ga0070658_10009406 Ga0070658_100094063 270
217 3300005327 Ga0070658_10060026 Ga0070658_100600262 270
218 3300005331 Ga0070670_100035149 Ga0070670_1000351494 270
219 3300005331 Ga0070670_100091271 Ga0070670_1000912713 270
220 3300005337 Ga0070682_100446740 Ga0070682_1004467401 270
221 3300005344 Ga0070661_100216675 Ga0070661_1002166752 270
222 3300005347 Ga0070668_100002963 Ga0070668_1000029639 270
223 3300005347 Ga0070668_100004810 Ga0070668_1000048107 270
224 3300005347 Ga0070668_100005098 Ga0070668_1000050988 270
225 3300005347 Ga0070668_100050299 Ga0070668_1000502992 270
226 3300005353 Ga0070669_100016959 Ga0070669_1000169595 270
227 3300005355 Ga0070671_100006295 Ga0070671_1000062958 270
228 3300005355 Ga0070671_100172682 Ga0070671_1001726822 270
229 3300005364 Ga0070673_100257574 Ga0070673_1002575742 270
230 3300005366 Ga0070659_100001009 Ga0070659_10000100913 270
231 3300005366 Ga0070659_100024167 Ga0070659_1000241673 270
232 3300005366 Ga0070659_100117271 Ga0070659_1001172712 270
233 3300005367 Ga0070667_100007531 Ga0070667_1000075312 270
234 3300005457 Ga0070662_100213139 Ga0070662_1002131392 270
235 3300005458 Ga0070681_10008308 Ga0070681_100083089 270
236 3300005530 Ga0070679_100085543 Ga0070679_1000855432 270
237 3300005539 Ga0068853_100037873 Ga0068853_1000378734 270
238 3300005539 Ga0068853_100061011 Ga0068853_1000610112 270
239 3300005548 Ga0070665_100000721 Ga0070665_10000072138 270
240 3300005548 Ga0070665_100009966 Ga0070665_1000099665 270
241 3300005548 Ga0070665_100144988 Ga0070665_1001449882 270
242 3300005548 Ga0070665_100330983 Ga0070665_1003309832 270
243 3300005563 Ga0068855_100017453 Ga0068855_1000174535 270
244 3300005563 Ga0068855_100170646 Ga0068855_1001706462 270
245 3300005617 Ga0068859_100001326 Ga0068859_10000132628 270
246 3300005618 Ga0068864_100011174 Ga0068864_1000111744 270
247 3300005618 Ga0068864_100068506 Ga0068864_1000685062 270
248 3300005618 Ga0068864_100346908 Ga0068864_1003469082 270
249 3300005719 Ga0068861_100077518 Ga0068861_1000775184 270
250 3300005841 Ga0068863_100017625 Ga0068863_1000176251 270
251 3300005841 Ga0068863_100187747 Ga0068863_1001877472 270
252 3300005841 Ga0068863_100202095 Ga0068863_1002020952 270
253 3300005841 Ga0068863_100246591 Ga0068863_1002465912 270
254 3300005843 Ga0068860_100000066 Ga0068860_10000006650 270
255 3300005843 Ga0068860_100003889 Ga0068860_1000038894 270
256 3300005843 Ga0068860_100272912 Ga0068860_1002729122 270
257 3300005843 Ga0068860_100332577 Ga0068860_1003325772 270
258 3300005844 Ga0068862_100007824 Ga0068862_1000078244 270
259 3300005844 Ga0068862_100009828 Ga0068862_1000098285 270
260 3300005844 Ga0068862_100017696 Ga0068862_1000176963 270
261 3300006042 Ga0075368_10018193 Ga0075368_100181931 270
262 3300006051 Ga0075364_10000415 Ga0075364_1000041523 270
263 3300006178 Ga0075367_10014430 Ga0075367_100144301 270
264 3300006186 Ga0075369_10051639 Ga0075369_100516392 270
265 3300006353 Ga0075370_10025765 Ga0075370_100257654 270
266 3300006353 Ga0075370_10105253 Ga0075370_101052533 270
267 3300006881 Ga0068865_100002365 Ga0068865_1000023651 270
268 3300006931 Ga0097620_100001326 Ga0097620_10000132628 270
269 3300009093 Ga0105240_10219399 Ga0105240_102193992 270
270 3300009174 Ga0105241_10338028 Ga0105241_103380281 270
271 3300009177 Ga0105248_10000650 Ga0105248_1000065028 270
272 3300009177 Ga0105248_10000746 Ga0105248_1000074623 270
273 3300009545 Ga0105237_10329812 Ga0105237_103298122 270
274 3300009551 Ga0105238_10076749 Ga0105238_100767493 270
275 3300009551 Ga0105238_10448837 Ga0105238_104488372 270
276 3300009551 Ga0105238_10603548 Ga0105238_106035481 270
277 3300009553 Ga0105249_10284378 Ga0105249_102843782 270
278 3300009553 Ga0105249_10299553 Ga0105249_102995532 270
279 3300013100 Ga0157373_10003332 Ga0157373_100033322 270
280 3300013100 Ga0157373_10004339 Ga0157373_100043398 270
281 3300013100 Ga0157373_10262799 Ga0157373_102627992 270
282 3300013306 Ga0163162_10088212 Ga0163162_100882124 270
283 3300013308 Ga0157375_10047309 Ga0157375_100473093 270
284 3300014325 Ga0163163_10004890 Ga0163163_1000489010 270
285 3300014325 Ga0163163_10331971 Ga0163163_103319712 270
286 3300014968 Ga0157379_10483777 Ga0157379_104837772 270
287 3300021388 Ga0213875_10147955 Ga0213875_101479551 270
288 3300025250 Ga0209026_1000608 Ga0209026_100060818 270
289 3300025254 Ga0209148_1011417 Ga0209148_10114171 270
290 3300025292 Ga0209676_1000217 Ga0209676_100021774 270
291 3300025292 Ga0209676_1003478 Ga0209676_10034789 270
292 3300025297 Ga0209758_1003752 Ga0209758_10037526 270
293 3300025298 Ga0209050_1000053 Ga0209050_1000053130 270
294 3300025304 Ga0209257_1000230 Ga0209257_1000230106 270
295 3300025304 Ga0209257_1000419 Ga0209257_100041918 270
296 3300025304 Ga0209257_1001795 Ga0209257_100179518 270
297 3300025909 Ga0207705_10003462 Ga0207705_100034629 270
298 3300025909 Ga0207705_10051010 Ga0207705_100510102 270
299 3300025909 Ga0207705_10325847 Ga0207705_103258471 270
300 3300025912 Ga0207707_10138738 Ga0207707_101387382 270
301 3300025917 Ga0207660_10012589 Ga0207660_100125893 270
302 3300025919 Ga0207657_10000235 Ga0207657_1000023562 270
303 3300025921 Ga0207652_10005742 Ga0207652_100057423 270
304 3300025923 Ga0207681_10078083 Ga0207681_100780832 270
305 3300025923 Ga0207681_10126769 Ga0207681_101267692 270
306 3300025924 Ga0207694_10022549 Ga0207694_100225493 270
307 3300025924 Ga0207694_10177688 Ga0207694_101776882 270
308 3300025924 Ga0207694_10276512 Ga0207694_102765122 270
309 3300025924 Ga0207694_10550978 Ga0207694_105509781 270
310 3300025925 Ga0207650_10326300 Ga0207650_103263001 270
311 3300025931 Ga0207644_10024158 Ga0207644_100241582 270
312 3300025932 Ga0207690_10000031 Ga0207690_10000031125 270
313 3300025932 Ga0207690_10083331 Ga0207690_100833313 270
314 3300025933 Ga0207706_10013371 Ga0207706_100133719 270
315 3300025933 Ga0207706_10280406 Ga0207706_102804062 270
316 3300025940 Ga0207691_10222613 Ga0207691_102226133 270
317 3300025941 Ga0207711_10000368 Ga0207711_1000036846 270
318 3300025941 Ga0207711_10001601 Ga0207711_1000160115 270
319 3300025941 Ga0207711_10186347 Ga0207711_101863472 270
320 3300025941 Ga0207711_10333594 Ga0207711_103335942 270
321 3300025949 Ga0207667_10015583 Ga0207667_100155832 270
322 3300025949 Ga0207667_10131418 Ga0207667_101314182 270
323 3300025949 Ga0207667_10187155 Ga0207667_101871552 270
324 3300025960 Ga0207651_10340133 Ga0207651_103401332 270
325 3300025972 Ga0207668_10003169 Ga0207668_100031695 270
326 3300025972 Ga0207668_10003930 Ga0207668_100039308 270
327 3300025972 Ga0207668_10005036 Ga0207668_100050365 270
328 3300025972 Ga0207668_10042599 Ga0207668_100425993 270
329 3300025986 Ga0207658_10120227 Ga0207658_101202273 270
330 3300026035 Ga0207703_10194347 Ga0207703_101943472 270
331 3300026041 Ga0207639_10008668 Ga0207639_100086685 270
332 3300026041 Ga0207639_10060936 Ga0207639_100609362 270
333 3300026041 Ga0207639_10659534 Ga0207639_106595341 270
334 3300026088 Ga0207641_10001763 Ga0207641_1000176322 270
335 3300026088 Ga0207641_10040183 Ga0207641_100401833 270
336 3300026088 Ga0207641_10198483 Ga0207641_101984833 270
337 3300026095 Ga0207676_10013622 Ga0207676_100136224 270
338 3300026116 Ga0207674_10259120 Ga0207674_102591202 270
339 3300026142 Ga0207698_10185146 Ga0207698_101851462 270
340 3300027378 Ga0209981_1000576 Ga0209981_10005766 270
341 3300027665 Ga0209983_1008035 Ga0209983_10080352 270
342 3300027866 Ga0209813_10055546 Ga0209813_100555462 270
343 3300028379 Ga0268266_10000003 Ga0268266_100000031414 270
344 3300028379 Ga0268266_10021359 Ga0268266_100213592 270
345 3300028379 Ga0268266_10061387 Ga0268266_100613871 270
346 3300028380 Ga0268265_10005393 Ga0268265_100053934 270
347 3300028381 Ga0268264_10000113 Ga0268264_10000113143 270
348 3300028381 Ga0268264_10065189 Ga0268264_100651892 270
349 3300028381 Ga0268264_10374208 Ga0268264_103742081 270
350 3300028573 Ga0265334_10086777 Ga0265334_100867772 270
351 3300028786 Ga0307517_10084629 Ga0307517_100846293 270
352 3300028800 Ga0265338_10270957 Ga0265338_102709572 270
353 3300028800 Ga0265338_10298119 Ga0265338_102981191 270
354 3300031247 Ga0265340_10072033 Ga0265340_100720332 270
355 3300031251 Ga0265327_10004906 Ga0265327_1000490610 270
356 3300031251 Ga0265327_10091619 Ga0265327_100916191 270
357 3300031456 Ga0307513_10003286 Ga0307513_1000328613 270
358 3300031711 Ga0265314_10223771 Ga0265314_102237712 270
359 3300031901 Ga0307406_10001177 Ga0307406_100011773 270
360 3300031911 Ga0307412_10051120 Ga0307412_100511202 270
361 3300033180 Ga0307510_10017145 Ga0307510_100171455 270
362 3300035083 Ga0373926_0047811 Ga0373926_0047811_166_984 270
363 3300035113 Ga0373936_0003245 Ga0373936_0003245_4734_5552 270
364 3300035171 Ga0373946_0026074 Ga0373946_0026074_968_1789 270
365 3300035691 Ga0373931_0058938 Ga0373931_0058938_1191_2009 270
366 3300035695 Ga0373927_0000111 Ga0373927_0000111_42344_43165 270
367 3300035725 Ga0373947_0040646 Ga0373947_0040646_1555_2376 270
368 3300037068 Ga0373925_0000209 Ga0373925_0000209_20935_21756 270
369 3300037471 Ga0395905_0019172 Ga0395905_0019172_276_1094 270
370 3300037853 Ga0436364_1149156 Ga0436364_1149156_36_848 270
371 3300037853 Ga0436364_1296096 Ga0436364_1296096_380_1192 270
372 3300038443 Ga0395901_0126730 Ga0395901_0126730_1500_2318 270
373 3300038443 Ga0395901_0414114 Ga0395901_0414114_96_914 270
374 3300039438 Ga0436360_0143736 Ga0436360_0143736_58_879 270
375 3300042004 Ga0439445_0016909 Ga0439445_0016909_55_879 270
376 3300044693 Ga0466961_0219647 Ga0466961_0219647_59_877 270
377 3300044694 Ga0466963_0358798 Ga0466963_0358798_153_974 270
378 3300046459 Ga0495629_0190954 Ga0495629_0190954_523_1407 270
379 3300046528 Ga0495642_0045401 Ga0495642_0045401_399_1217 270
380 3300046543 Ga0495645_0011398 Ga0495645_0011398_496_1317 270
381 3300046557 Ga0495622_0002815 Ga0495622_0002815_228_1046 270
382 3300046684 Ga0495669_0000007 Ga0495669_0000007_176470_177294 270
383 3300046684 Ga0495669_0000731 Ga0495669_0000731_5254_6075 270
384 3300047318 Ga0495636_0065022 Ga0495636_0065022_720_1538 270
385 3300047472 Ga0495686_0011091 Ga0495686_0011091_5223_6044 270
386 3300048904 Ga0496101_0151747 Ga0496101_0151747_93_911 270
387 3300048906 Ga0496103_0180468 Ga0496103_0180468_121_1044 270
388 3300048909 Ga0496106_0217607 Ga0496106_0217607_148_966 270
389 3300048910 Ga0496107_0146951 Ga0496107_0146951_601_1419 270
390 3300048912 Ga0496109_0121267 Ga0496109_0121267_1050_1868 270
391 3300048913 Ga0496110_0158936 Ga0496110_0158936_431_1249 270
392 3300048914 Ga0496111_0096490 Ga0496111_0096490_971_1789 270
393 3300048915 Ga0496112_0104960 Ga0496112_0104960_1894_2715 270
394 3300048915 Ga0496112_0230569 Ga0496112_0230569_360_1178 270
395 3300048915 Ga0496112_0410367 Ga0496112_0410367_328_1146 270
396 3300048918 Ga0496115_0000460 Ga0496115_0000460_20575_21396 270
397 3300048918 Ga0496115_0000467 Ga0496115_0000467_22151_22969 270
398 3300048918 Ga0496115_0409535 Ga0496115_0409535_95_913 270
399 3300048924 Ga0496121_0299484 Ga0496121_0299484_67_891 270
400 3300049570 Ga0501033_0002580 Ga0501033_0002580_4944_5768 270
401 3300049571 Ga0501034_0005292 Ga0501034_0005292_4257_5069 270
402 3300049573 Ga0501037_0012688 Ga0501037_0012688_3063_3875 270
403 3300049579 Ga0501043_0145535 Ga0501043_0145535_729_1550 270
404 3300049581 Ga0501047_0006163 Ga0501047_0006163_5005_5826 270
405 3300049582 Ga0501048_0045657 Ga0501048_0045657_1952_2770 270
406 3300049823 Ga0501044_0012706 Ga0501044_0012706_1664_2476 270
407 3300049823 Ga0501044_0678509 Ga0501044_0678509_64_876 270
408 3300050490 nmdc:mga03n38_125582_c1 nmdc:mga03n38_125582_c1_305_1168 270
409 3300050491 nmdc:mga00v17_494_c1 nmdc:mga00v17_494_c1_16207_17067 270
410 3300050493 nmdc:mga0k408_13076_c1 nmdc:mga0k408_13076_c1_1039_1902 270
411 3300050494 nmdc:mga06z11_68743_c1 nmdc:mga06z11_68743_c1_382_1242 270
412 3300053087 Ga0500643_024568 Ga0500643_024568_177_1001 270
413 3300053088 Ga0500644_0002839 Ga0500644_0002839_1430_2251 270
414 3300053093 Ga0500651_0027381 Ga0500651_0027381_1526_2347 270
415 3300053096 Ga0500641_0004493 Ga0500641_0004493_735_1559 270
416 3300053111 Ga0500572_000593 Ga0500572_000593_4510_5334 270
417 3300053122 Ga0500608_033133 Ga0500608_033133_1334_2152 270
418 3300053154 Ga0500619_013183 Ga0500619_013183_234_1052 270
419 3300053156 Ga0500622_0047939 Ga0500622_0047939_1000_1824 270
420 3300053178 Ga0500637_0012246 Ga0500637_0012246_412_1230 270
421 3300053730 Ga0500645_000487 Ga0500645_000487_10842_11666 270
422 3300053730 Ga0500645_042669 Ga0500645_042669_160_981 270
423 3300003215 JGI25153J46596_10016413 JGI25153J46596_100164133 271
424 3300003215 JGI25153J46596_10032502 JGI25153J46596_100325022 271
425 3300003322 rootL2_10075538 rootL2_100755381 271
426 3300003322 rootL2_10076302 rootL2_100763024 271
427 3300003578 Ga0006562J51391_1043118 Ga0006562J51391_10431183 271
428 3300003578 Ga0006562J51391_1043120 Ga0006562J51391_10431207 271
429 3300003773 Ga0055537_1003051 Ga0055537_10030512 271
430 3300003775 Ga0055524_1004063 Ga0055524_10040632 271
431 3300003781 Ga0055536_1001509 Ga0055536_10015091 271
432 3300003790 Ga0055528_1003297 Ga0055528_10032977 271
433 3300003791 Ga0055530_10004450 Ga0055530_100044507 271
434 3300003791 Ga0055530_10009547 Ga0055530_100095472 271
435 3300003794 Ga0055531_10000473 Ga0055531_1000047317 271
436 3300003794 Ga0055531_10007442 Ga0055531_100074423 271
437 3300003794 Ga0055531_10043766 Ga0055531_100437662 271
438 3300005262 Ga0065165_1001792 Ga0065165_10017929 271
439 3300005614 Ga0068856_100355057 Ga0068856_1003550572 271
440 3300006186 Ga0075369_10002774 Ga0075369_100027744 271
441 3300009098 Ga0105245_10885705 Ga0105245_108857051 271
442 3300009176 Ga0105242_10306750 Ga0105242_103067502 271
443 3300013102 Ga0157371_10007717 Ga0157371_100077172 271
444 3300013104 Ga0157370_10032819 Ga0157370_100328195 271
445 3300013105 Ga0157369_10135407 Ga0157369_101354073 271
446 3300013296 Ga0157374_10199420 Ga0157374_101994202 271
447 3300013297 Ga0157378_10510412 Ga0157378_105104122 271
448 3300021361 Ga0213872_10039000 Ga0213872_100390003 271
449 3300025263 Ga0209565_1000172 Ga0209565_100017241 271
450 3300025273 Ga0209673_1000451 Ga0209673_10004519 271
451 3300025291 Ga0209675_1006240 Ga0209675_10062404 271
452 3300025292 Ga0209676_1000257 Ga0209676_100025758 271
453 3300025292 Ga0209676_1000316 Ga0209676_100031643 271
454 3300025295 Ga0209564_1004152 Ga0209564_10041528 271
455 3300025297 Ga0209758_1001854 Ga0209758_10018544 271
456 3300025297 Ga0209758_1006062 Ga0209758_10060623 271
457 3300025298 Ga0209050_1000604 Ga0209050_100060443 271
458 3300025298 Ga0209050_1001151 Ga0209050_100115126 271
459 3300025298 Ga0209050_1006384 Ga0209050_10063847 271
460 3300025299 Ga0209256_1002978 Ga0209256_100297810 271
461 3300025299 Ga0209256_1005380 Ga0209256_10053807 271
462 3300025303 Ga0209051_1003216 Ga0209051_10032164 271
463 3300025304 Ga0209257_1000192 Ga0209257_100019298 271
464 3300025304 Ga0209257_1000541 Ga0209257_100054121 271
465 3300025304 Ga0209257_1012647 Ga0209257_10126472 271
466 3300025919 Ga0207657_10528860 Ga0207657_105288601 271
467 3300026078 Ga0207702_10493659 Ga0207702_104936591 271
468 3300028556 Ga0265337_1043322 Ga0265337_10433221 271
469 3300028794 Ga0307515_10010603 Ga0307515_1001060310 271
470 3300028794 Ga0307515_10024332 Ga0307515_100243323 271
471 3300028800 Ga0265338_10043089 Ga0265338_100430895 271
472 3300031240 Ga0265320_10090631 Ga0265320_100906311 271
473 3300031903 Ga0307407_10060407 Ga0307407_100604074 271
474 3300032004 Ga0307414_10029061 Ga0307414_100290614 271
475 3300032005 Ga0307411_10265740 Ga0307411_102657402 271
476 3300035724 Ga0373933_0123369 Ga0373933_0123369_279_1100 271
477 3300036401 Ga0373937_0485896 Ga0373937_0485896_104_925 271
478 3300037312 Ga0395899_0000003 Ga0395899_0000003_181790_182608 271
479 3300037312 Ga0395899_0128906 Ga0395899_0128906_147_971 271
480 3300037418 Ga0395900_0155202 Ga0395900_0155202_486_1307 271
481 3300037466 Ga0395898_0260792 Ga0395898_0260792_137_958 271
482 3300038443 Ga0395901_0006909 Ga0395901_0006909_5022_5843 271
483 3300039438 Ga0436360_0004857 Ga0436360_0004857_80_907 271
484 3300039447 Ga0436361_1220324 Ga0436361_1220324_438_1259 271
485 3300042438 Ga0439459_0008336 Ga0439459_0008336_673_1488 271
486 3300045049 Ga0466959_0121674 Ga0466959_0121674_1005_1841 271
487 3300046453 Ga0495627_000655 Ga0495627_000655_24958_25773 271
488 3300046457 Ga0495590_0000533 Ga0495590_0000533_5758_6573 271
489 3300046460 Ga0495638_0000630 Ga0495638_0000630_28626_29441 271
490 3300046460 Ga0495638_0005885 Ga0495638_0005885_475_1290 271
491 3300046460 Ga0495638_0007935 Ga0495638_0007935_2098_2913 271
492 3300046460 Ga0495638_0060249 Ga0495638_0060249_1471_2286 271
493 3300046471 Ga0495650_0000168 Ga0495650_0000168_23847_24662 271
494 3300046492 Ga0495585_0098335 Ga0495585_0098335_276_1091 271
495 3300046501 Ga0495607_0094437 Ga0495607_0094437_298_1113 271
496 3300046506 Ga0495583_0000003 Ga0495583_0000003_491046_491861 271
497 3300046507 Ga0495606_0003044 Ga0495606_0003044_1069_1884 271
498 3300046512 Ga0495610_0000304 Ga0495610_0000304_28791_29606 271
499 3300046512 Ga0495610_0000327 Ga0495610_0000327_28189_29004 271
500 3300046512 Ga0495610_0018028 Ga0495610_0018028_1197_2012 271
501 3300046513 Ga0495616_0000424 Ga0495616_0000424_8283_9098 271
502 3300046518 Ga0495631_0000936 Ga0495631_0000936_5782_6597 271
503 3300046519 Ga0495632_0000704 Ga0495632_0000704_25032_25847 271
504 3300046519 Ga0495632_0018593 Ga0495632_0018593_2272_3087 271
505 3300046520 Ga0495637_0041553 Ga0495637_0041553_47_862 271
506 3300046520 Ga0495637_0073235 Ga0495637_0073235_112_927 271
507 3300046522 Ga0495643_0086072 Ga0495643_0086072_371_1186 271
508 3300046524 Ga0495648_0000107 Ga0495648_0000107_27812_28627 271
509 3300046530 Ga0495654_0000085 Ga0495654_0000085_21476_22291 271
510 3300046530 Ga0495654_0095575 Ga0495654_0095575_538_1353 271
511 3300046539 Ga0495621_0005555 Ga0495621_0005555_1685_2506 271
512 3300046558 Ga0495633_0000400 Ga0495633_0000400_43216_44037 271
513 3300046616 Ga0495668_0000746 Ga0495668_0000746_15578_16393 271
514 3300046616 Ga0495668_0002777 Ga0495668_0002777_12837_13652 271
515 3300046616 Ga0495668_0044627 Ga0495668_0044627_433_1248 271
516 3300046660 Ga0495625_0000767 Ga0495625_0000767_41366_42181 271
517 3300046660 Ga0495625_0005395 Ga0495625_0005395_2232_3047 271
518 3300046660 Ga0495625_0011200 Ga0495625_0011200_4681_5496 271
519 3300046660 Ga0495625_0015310 Ga0495625_0015310_596_1411 271
520 3300046660 Ga0495625_0050437 Ga0495625_0050437_755_1570 271
521 3300046689 Ga0495613_0000049 Ga0495613_0000049_79245_80066 271
522 3300046794 Ga0495589_0001462 Ga0495589_0001462_1958_2773 271
523 3300046810 Ga0495660_0012648 Ga0495660_0012648_1334_2149 271
524 3300046810 Ga0495660_0020528 Ga0495660_0020528_1756_2571 271
525 3300047320 Ga0495672_0000928 Ga0495672_0000928_16303_17118 271
526 3300047323 Ga0495683_0075943 Ga0495683_0075943_512_1327 271
527 3300047446 Ga0495679_001129 Ga0495679_001129_3608_4423 271
528 3300047469 Ga0495673_0000341 Ga0495673_0000341_10385_11200 271
529 3300047469 Ga0495673_0001283 Ga0495673_0001283_18836_19651 271
530 3300047470 Ga0495681_0027009 Ga0495681_0027009_1552_2367 271
531 3300047472 Ga0495686_0000747 Ga0495686_0000747_30311_31126 271
532 3300047472 Ga0495686_0063586 Ga0495686_0063586_905_1720 271
533 3300048909 Ga0496106_0000700 Ga0496106_0000700_1047_1862 271
534 3300048910 Ga0496107_0000039 Ga0496107_0000039_18617_19432 271
535 3300048910 Ga0496107_0043896 Ga0496107_0043896_107_931 271
536 3300048918 Ga0496115_0003347 Ga0496115_0003347_708_1523 271
537 3300048918 Ga0496115_0023054 Ga0496115_0023054_3851_4672 271
538 3300048918 Ga0496115_0023938 Ga0496115_0023938_254_1075 271
539 3300048919 Ga0496116_0012484 Ga0496116_0012484_5960_6781 271
540 3300048924 Ga0496121_0001159 Ga0496121_0001159_34650_35465 271
541 3300048925 Ga0496122_0007549 Ga0496122_0007549_3941_4762 271
542 3300048926 Ga0496123_0000968 Ga0496123_0000968_9770_10591 271
543 3300048927 Ga0496124_0006081 Ga0496124_0006081_3301_4116 271
544 3300048928 Ga0496125_0001013 Ga0496125_0001013_34346_35167 271
545 3300048928 Ga0496125_0026301 Ga0496125_0026301_2675_3490 271
546 3300048929 Ga0496126_0029844 Ga0496126_0029844_2660_3475 271
547 3300049459 Ga0495678_002301 Ga0495678_002301_7175_7990 271
548 3300049671 Ga0501238_001447 Ga0501238_001447_1753_2568 271
549 3300050516 nmdc:mga0sz30_6092_c1 nmdc:mga0sz30_6092_c1_2132_2947 271
550 3300053086 Ga0500578_0000015 Ga0500578_0000015_21625_22440 271
551 3300053088 Ga0500644_0000124 Ga0500644_0000124_27296_28111 271
552 3300053088 Ga0500644_0005283 Ga0500644_0005283_576_1391 271
553 3300053091 Ga0500647_0004390 Ga0500647_0004390_3591_4418 271
554 3300053096 Ga0500641_0105058 Ga0500641_0105058_293_1108 271
555 3300053102 Ga0500554_002981 Ga0500554_002981_2066_2881 271
556 3300053103 Ga0500555_013451 Ga0500555_013451_1461_2276 271
557 3300053104 Ga0500556_0000933 Ga0500556_0000933_7105_7920 271
558 3300053104 Ga0500556_0001668 Ga0500556_0001668_6135_6962 271
559 3300053108 Ga0500562_000309 Ga0500562_000309_10003_10830 271
560 3300053118 Ga0500594_0000058 Ga0500594_0000058_12395_13210 271
561 3300053122 Ga0500608_000011 Ga0500608_000011_59412_60227 271
562 3300053123 Ga0500614_016440 Ga0500614_016440_72_887 271
563 3300053125 Ga0500618_000159 Ga0500618_000159_55236_56051 271
564 3300053134 Ga0500658_0022120 Ga0500658_0022120_457_1272 271
565 3300053136 Ga0500559_0000004 Ga0500559_0000004_129461_130291 271
566 3300053136 Ga0500559_0000009 Ga0500559_0000009_120566_121381 271
567 3300053138 Ga0500564_000063 Ga0500564_000063_1602_2417 271
568 3300053142 Ga0500577_0001434 Ga0500577_0001434_2869_3684 271
569 3300053153 Ga0500616_0028673 Ga0500616_0028673_472_1287 271
570 3300053156 Ga0500622_0000346 Ga0500622_0000346_29117_29932 271
571 3300053156 Ga0500622_0010123 Ga0500622_0010123_1461_2276 271
572 3300053158 Ga0500627_0004864 Ga0500627_0004864_3011_3826 271
573 3300053177 Ga0500636_0005912 Ga0500636_0005912_2388_3218 271
574 3300053727 Ga0500611_011313 Ga0500611_011313_202_1017 271
575 3300053730 Ga0500645_001712 Ga0500645_001712_6838_7665 271
576 3300053730 Ga0500645_003843 Ga0500645_003843_285_1100 271
577 3300053731 Ga0500609_000294 Ga0500609_000294_3566_4381 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

20

250

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

244

300

0.93

PF00106

adh_short

short chain dehydrogenase

17

209

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5koi-assembly3.cif.gz_E crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis 0.9791 12 270
4nk4-assembly1.cif.gz_A crystal structure of fabi from candidatus liberibacter asiaticus 0.979 11 267
5koi-assembly2.cif.gz_C crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis 0.9788 12 270
3grk-assembly2.cif.gz_G crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis 0.9779 12 265
4m87-assembly1.cif.gz_A crystal structure of enoyl-acyl carrier protein reductase (fabi) from neisseria meningitidis in complex with nad+ 0.9779 12 266
ID Description Score Start End Superfamily
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9814 11 268 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9768 12 265 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9713 12 266 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.969 12 265 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 13 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A261DBJ9-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9904 13 262 GO:0004318
GO:0006633
AF-A0A0R2TKG6-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9886 12 241 GO:0004318
GO:0006633
AF-A0A259KAQ2-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9885 10 241 GO:0004318
GO:0006633
AF-A0A7C5QQH0-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9885 3 169 GO:0004318
GO:0006633
AF-A0A258KE18-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9882 1 197 GO:0004318
GO:0006633

Feature Viewer

pLDDT pTM Quality
90.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map