F465698

General Info

Members Datasets Scaffolds Average Seq Length
578 342 577 332

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000746|Ga0070703_100007463
Length 373
Sequence MAAHLVYKEILGDSEMRQAQVLGQWPAPRGGGDGEDWTMLISRHARRTAAILFGLGVALTSTAAIGQKREFSFAYDQPKNSGYGVGADIFSKKLVELSKGTLSINQYPSAQLGTEAQTMQKVQTGDIDFVMLSTANASTAQPESGVFSLHFIFRDEAHAIKVLGDPSVIAAMKDLYAAKIKGAHMLALGSQGLRHMYGKKAVQKLADIKGAKMRVQATVTEDTLFPAYGAQVVHMPFGEVYTSLQTGVVDMAENGINNYLINKHYEPAPVLSLTEHEANNAALFVSDKVWQSLSAEQKGWVQAAADEISRNEPAAAFMLEHEALAKLQKIGVKIVRDVDKSGFQSVSKPIQDKLAKDLGPNAVKVLGLVRNVK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
107 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
108 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
336 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 3.46
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214800760 2209111006 Bacteria 10890
2 ARSoilYngRDRAFT_c00057 3300000042 Bacteria 18462
3 ARcpr5yngRDRAFT_c000673 3300000043 Bacteria 4250
4 ARSoilOldRDRAFT_c000044 3300000044 Bacteria 26451
5 ARCol0yngRDRAFT_1000153 3300000652 Bacteria 12275
6 JGI25406J46586_10000826 3300003203 Bacteria 14573
7 JGI25405J52794_10001935 3300003911 Bacteria 3505
8 Ga0065717_1002193 3300005276 Bacteria 2535
9 Ga0065716_1001695 3300005277 Bacteria 4115
10 Ga0065704_10084341 3300005289 Bacteria 3345
11 Ga0065712_10071542 3300005290 Bacteria 5192
12 Ga0065715_10001318 3300005293 Bacteria 10293
13 Ga0065715_10144991 3300005293 Bacteria 1800
14 Ga0070658_10035834 3300005327 Bacteria 3997
15 Ga0070658_10123637 3300005327 Bacteria 2152
16 Ga0070676_10113303 3300005328 Bacteria 1692
17 Ga0070683_100078518 3300005329 Bacteria 3088
18 Ga0070683_100115860 3300005329 Bacteria 2530
19 Ga0070690_100022947 3300005330 Bacteria 3823
20 Ga0070670_100070304 3300005331 Bacteria 3005
21 Ga0070670_100309827 3300005331 Bacteria 1382
22 Ga0070677_10020348 3300005333 Bacteria 2417
23 Ga0070677_10098690 3300005333 Bacteria 1284
24 Ga0068869_100000039 3300005334 Bacteria 54386
25 Ga0068869_100144735 3300005334 Bacteria 1838
26 Ga0070680_100000933 3300005336 Bacteria 20696
27 Ga0070680_100003206 3300005336 Bacteria 12165
28 Ga0070680_100169296 3300005336 Bacteria 1838
29 Ga0070682_100035457 3300005337 Bacteria 3046
30 Ga0070660_100014143 3300005339 Bacteria 5745
31 Ga0070660_100027333 3300005339 Bacteria 4257
32 Ga0070660_100267836 3300005339 Bacteria 1396
33 Ga0070689_100017381 3300005340 Bacteria 5281
34 Ga0070689_100150147 3300005340 Bacteria 1879
35 Ga0070691_10009000 3300005341 Bacteria 4567
36 Ga0070691_10025475 3300005341 Bacteria 2754
37 Ga0070687_100049318 3300005343 Bacteria 2169
38 Ga0070687_100166548 3300005343 Bacteria 1308
39 Ga0070687_100194776 3300005343 Bacteria 1224
40 Ga0070661_100055552 3300005344 Bacteria 2899
41 Ga0070661_100128324 3300005344 Bacteria 1903
42 Ga0070692_10030076 3300005345 Bacteria 2713
43 Ga0070668_100017292 3300005347 Bacteria 5399
44 Ga0070668_100042788 3300005347 Bacteria 3472
45 Ga0070668_100136857 3300005347 Bacteria 1971
46 Ga0070668_100150793 3300005347 Bacteria 1880
47 Ga0070669_100059437 3300005353 Bacteria 2807
48 Ga0070675_100296524 3300005354 Bacteria 1424
49 Ga0070673_100481900 3300005364 Bacteria 1120
50 Ga0070688_100001879 3300005365 Bacteria 10522
51 Ga0070659_100009187 3300005366 Bacteria 7254
52 Ga0070659_100023236 3300005366 Bacteria 4742
53 Ga0070667_100000488 3300005367 Bacteria 40240
54 Ga0070667_100102127 3300005367 Bacteria 2477
55 Ga0070703_10000746 3300005406 Bacteria 10858
56 Ga0070709_10017300 3300005434 Bacteria 4133
57 Ga0070709_10188712 3300005434 Bacteria 1452
58 Ga0070709_10258273 3300005434 Bacteria 1258
59 Ga0070714_100018028 3300005435 Bacteria 5727
60 Ga0070714_100076575 3300005435 Bacteria 2904
61 Ga0070714_100110567 3300005435 Bacteria 2433
62 Ga0070713_100075891 3300005436 Bacteria 2852
63 Ga0070711_100058899 3300005439 Bacteria 2665
64 Ga0070705_100000029 3300005440 Bacteria 74892
65 Ga0070705_100038253 3300005440 Bacteria 2713
66 Ga0070705_100113402 3300005440 Bacteria 1737
67 Ga0070700_100001497 3300005441 Bacteria 11629
68 Ga0070700_100015163 3300005441 Bacteria 4364
69 Ga0070694_100000652 3300005444 Bacteria 19181
70 Ga0070708_100002320 3300005445 Bacteria 14723
71 Ga0070663_100008847 3300005455 Bacteria 6213
72 Ga0070663_100023132 3300005455 Bacteria 4162
73 Ga0070678_100006921 3300005456 Bacteria 6689
74 Ga0070678_100092721 3300005456 Bacteria 2321
75 Ga0070662_100003081 3300005457 Bacteria 10344
76 Ga0070662_100013722 3300005457 Bacteria 5395
77 Ga0070681_10038482 3300005458 Bacteria 4796
78 Ga0070681_10115718 3300005458 Bacteria 2619
79 Ga0070681_10157011 3300005458 Bacteria 2199
80 Ga0070681_10192388 3300005458 Bacteria 1960
81 Ga0070681_10219770 3300005458 Bacteria 1815
82 Ga0068867_100002184 3300005459 Bacteria 13734
83 Ga0068867_100017486 3300005459 Bacteria 5093
84 Ga0068867_100117012 3300005459 Bacteria 2055
85 Ga0070706_100021874 3300005467 Bacteria 5889
86 Ga0070707_100135285 3300005468 Bacteria 2398
87 Ga0070698_100002091 3300005471 Bacteria 22152
88 Ga0070698_100177985 3300005471 Bacteria 2065
89 Ga0070698_100182302 3300005471 Bacteria 2038
90 Ga0074259_11019792 3300005507 Bacteria 3086
91 Ga0070699_100000947 3300005518 Bacteria 27076
92 Ga0070699_100013134 3300005518 Bacteria 7140
93 Ga0070699_100207974 3300005518 Bacteria 1741
94 Ga0070679_100009132 3300005530 Bacteria 9359
95 Ga0070679_100022933 3300005530 Bacteria 6105
96 Ga0070679_100057578 3300005530 Bacteria 3874
97 Ga0070679_100122680 3300005530 Bacteria 2582
98 Ga0070684_100010266 3300005535 Bacteria 7412
99 Ga0070697_100187495 3300005536 Bacteria 1755
100 Ga0068853_100015534 3300005539 Bacteria 6254
101 Ga0068853_100083026 3300005539 Bacteria 2807
102 Ga0070672_100101954 3300005543 Bacteria 2329
103 Ga0070686_100053084 3300005544 Bacteria 2586
104 Ga0070695_100006175 3300005545 Bacteria 7080
105 Ga0070696_100001966 3300005546 Bacteria 13495
106 Ga0070696_100004759 3300005546 Bacteria 9065
107 Ga0070696_100016707 3300005546 Bacteria 4949
108 Ga0070696_100081234 3300005546 Bacteria 2296
109 Ga0070693_100097099 3300005547 Bacteria 1788
110 Ga0070704_100000624 3300005549 Bacteria 17082
111 Ga0070704_100005471 3300005549 Bacteria 7401
112 Ga0068855_100219987 3300005563 Bacteria 2130
113 Ga0068855_100295627 3300005563 Bacteria 1794
114 Ga0070664_100015069 3300005564 Bacteria 6312
115 Ga0070664_100023513 3300005564 Bacteria 5092
116 Ga0070664_100041115 3300005564 Bacteria 3900
117 Ga0068857_100025254 3300005577 Bacteria 5232
118 Ga0068854_100241517 3300005578 Bacteria 1438
119 Ga0068856_100033873 3300005614 Bacteria 5002
120 Ga0068856_100309998 3300005614 Bacteria 1596
121 Ga0068856_100587956 3300005614 Bacteria 1134
122 Ga0070702_100046999 3300005615 Bacteria 2449
123 Ga0068852_100414326 3300005616 Bacteria 1328
124 Ga0068859_100000189 3300005617 Bacteria 59789
125 Ga0068859_100032215 3300005617 Bacteria 5266
126 Ga0068859_100134543 3300005617 Bacteria 2544
127 Ga0068864_100000192 3300005618 Bacteria 55904
128 Ga0068861_100011083 3300005719 Bacteria 6263
129 Ga0068861_100107550 3300005719 Bacteria 2230
130 Ga0068851_10002769 3300005834 Bacteria 7726
131 Ga0068863_100012588 3300005841 Bacteria 8160
132 Ga0068863_100181101 3300005841 Bacteria 2022
133 Ga0068863_100204759 3300005841 Bacteria 1899
134 Ga0068863_100328025 3300005841 Bacteria 1488
135 Ga0068858_100022002 3300005842 Bacteria 5955
136 Ga0068858_100114748 3300005842 Bacteria 2517
137 Ga0068860_100000350 3300005843 Bacteria 62017
138 Ga0068860_100009593 3300005843 Bacteria 9619
139 Ga0068862_100000691 3300005844 Bacteria 34469
140 Ga0068862_100048145 3300005844 Bacteria 3639
141 Ga0068862_100057387 3300005844 Bacteria 3339
142 Ga0068862_100066585 3300005844 Bacteria 3104
143 Ga0081455_10000012 3300005937 Bacteria 201668
144 Ga0081455_10034958 3300005937 Bacteria 4497
145 Ga0081455_10097858 3300005937 Bacteria 2363
146 Ga0081455_10135784 3300005937 Bacteria 1917
147 Ga0081540_1001830 3300005983 Bacteria 17860
148 Ga0081539_10002294 3300005985 Bacteria 27712
149 Ga0070717_10275687 3300006028 Bacteria 1490
150 Ga0075364_10028110 3300006051 Bacteria 3598
151 Ga0070716_100079022 3300006173 Bacteria 1958
152 Ga0075366_10083127 3300006195 Bacteria 1913
153 Ga0097621_100001440 3300006237 Bacteria 16328
154 Ga0075370_10013741 3300006353 Bacteria 4309
155 Ga0068871_100002792 3300006358 Bacteria 11935
156 Ga0068871_100310511 3300006358 Bacteria 1386
157 Ga0075434_100152364 3300006871 Bacteria 2332
158 Ga0068865_100148051 3300006881 Bacteria 1778
159 Ga0075436_100057054 3300006914 Bacteria 2697
160 Ga0075436_100125947 3300006914 Bacteria 1795
161 Ga0097620_100000189 3300006931 Bacteria 59789
162 Ga0097620_100032216 3300006931 Bacteria 5266
163 Ga0097620_100134544 3300006931 Bacteria 2544
164 Ga0075435_100002930 3300007076 Bacteria 11463
165 Ga0105251_10065994 3300009011 Bacteria 1693
166 Ga0105240_10004752 3300009093 Bacteria 20518
167 Ga0105240_10025445 3300009093 Bacteria 7776
168 Ga0105240_10079097 3300009093 Bacteria 4047
169 Ga0111539_10000114 3300009094 Bacteria 88757
170 Ga0111539_10011997 3300009094 Bacteria 10864
171 Ga0111539_10416843 3300009094 Bacteria 1564
172 Ga0105247_10017646 3300009101 Bacteria 4280
173 Ga0114129_10733661 3300009147 Bacteria 1266
174 Ga0105243_10026263 3300009148 Bacteria 4457
175 Ga0105242_10455801 3300009176 Bacteria 1207
176 Ga0105248_10013370 3300009177 Bacteria 9034
177 Ga0105248_10131270 3300009177 Bacteria 2826
178 Ga0105238_10021202 3300009551 Bacteria 6623
179 Ga0105249_10001774 3300009553 Bacteria 18804
180 Ga0105249_10170477 3300009553 Bacteria 2110
181 Ga0105239_10053091 3300010375 Bacteria 4446
182 Ga0105239_10180994 3300010375 Bacteria 2358
183 Ga0157320_1000654 3300012481 Bacteria 1502
184 Ga0157342_1000297 3300012507 Bacteria 2801
185 Ga0157338_1000224 3300012515 Bacteria 2975
186 Ga0157371_10008859 3300013102 Bacteria 7969
187 Ga0157370_10010239 3300013104 Bacteria 9901
188 Ga0157369_10051616 3300013105 Bacteria 4450
189 Ga0157369_10117912 3300013105 Bacteria 2818
190 Ga0157378_10242284 3300013297 Bacteria 1723
191 Ga0157372_10043914 3300013307 Bacteria 4951
192 Ga0157372_10086413 3300013307 Bacteria 3558
193 Ga0157372_10222015 3300013307 Bacteria 2190
194 Ga0157372_10266014 3300013307 Bacteria 1991
195 Ga0157375_10022576 3300013308 Bacteria 5793
196 Ga0163163_10005846 3300014325 Bacteria 10702
197 Ga0157380_10061308 3300014326 Bacteria 3009
198 Ga0157377_10085370 3300014745 Bacteria 1853
199 Ga0157379_10000028 3300014968 Bacteria 86433
200 Ga0157379_10011943 3300014968 Bacteria 7588
201 Ga0157376_10020495 3300014969 Bacteria 5115
202 Ga0163161_10003601 3300017792 Bacteria 10864
203 Ga0213872_10069800 3300021361 Bacteria 1585
204 Ga0213875_10048223 3300021388 Bacteria 1998
205 Ga0207666_1000497 3300025271 Bacteria 4888
206 Ga0209758_1001507 3300025297 Bacteria 27061
207 Ga0207697_10021107 3300025315 Bacteria 2667
208 Ga0207692_10013091 3300025898 Bacteria 3589
209 Ga0207688_10046379 3300025901 Bacteria 2426
210 Ga0207688_10078506 3300025901 Bacteria 1882
211 Ga0207647_10008867 3300025904 Bacteria 7175
212 Ga0207699_10015906 3300025906 Bacteria 3922
213 Ga0207699_10025985 3300025906 Bacteria 3222
214 Ga0207699_10054214 3300025906 Bacteria 2381
215 Ga0207645_10058475 3300025907 Bacteria 2461
216 Ga0207645_10087504 3300025907 Bacteria 2002
217 Ga0207705_10019721 3300025909 Bacteria 4822
218 Ga0207705_10110771 3300025909 Bacteria 2028
219 Ga0207684_10025016 3300025910 Bacteria 5088
220 Ga0207684_10063778 3300025910 Bacteria 3128
221 Ga0207684_10141231 3300025910 Bacteria 2070
222 Ga0207707_10007786 3300025912 Bacteria 9326
223 Ga0207695_10009523 3300025913 Bacteria 12011
224 Ga0207695_10018499 3300025913 Bacteria 8053
225 Ga0207693_10072881 3300025915 Bacteria 2689
226 Ga0207663_10003419 3300025916 Bacteria 7766
227 Ga0207663_10127849 3300025916 Bacteria 1751
228 Ga0207660_10009390 3300025917 Bacteria 6332
229 Ga0207660_10020459 3300025917 Bacteria 4441
230 Ga0207660_10069481 3300025917 Bacteria 2558
231 Ga0207662_10026368 3300025918 Bacteria 3352
232 Ga0207662_10091333 3300025918 Bacteria 1873
233 Ga0207662_10126359 3300025918 Bacteria 1608
234 Ga0207662_10195291 3300025918 Bacteria 1307
235 Ga0207657_10000213 3300025919 Bacteria 60310
236 Ga0207657_10015476 3300025919 Bacteria 7389
237 Ga0207657_10058340 3300025919 Bacteria 3322
238 Ga0207657_10177378 3300025919 Bacteria 1724
239 Ga0207649_10025487 3300025920 Bacteria 3447
240 Ga0207649_10070306 3300025920 Bacteria 2232
241 Ga0207652_10006590 3300025921 Bacteria 9362
242 Ga0207652_10039490 3300025921 Bacteria 4005
243 Ga0207652_10041610 3300025921 Bacteria 3907
244 Ga0207652_10096003 3300025921 Bacteria 2611
245 Ga0207652_10115192 3300025921 Unclassified 2388
246 Ga0207681_10015114 3300025923 Bacteria 4813
247 Ga0207681_10229423 3300025923 Bacteria 1440
248 Ga0207694_10024491 3300025924 Bacteria 4584
249 Ga0207694_10059169 3300025924 Bacteria 2980
250 Ga0207650_10030156 3300025925 Bacteria 3904
251 Ga0207659_10303805 3300025926 Bacteria 1311
252 Ga0207700_10013374 3300025928 Bacteria 5337
253 Ga0207700_10264924 3300025928 Bacteria 1473
254 Ga0207664_10030851 3300025929 Bacteria 4096
255 Ga0207664_10051388 3300025929 Bacteria 3254
256 Ga0207664_10066992 3300025929 Bacteria 2880
257 Ga0207664_10084441 3300025929 Bacteria 2590
258 Ga0207644_10135404 3300025931 Bacteria 1891
259 Ga0207690_10008048 3300025932 Bacteria 6260
260 Ga0207690_10050009 3300025932 Bacteria 2788
261 Ga0207706_10009628 3300025933 Bacteria 8869
262 Ga0207706_10026463 3300025933 Bacteria 5192
263 Ga0207686_10072241 3300025934 Bacteria 2223
264 Ga0207709_10164511 3300025935 Bacteria 1550
265 Ga0207670_10023433 3300025936 Bacteria 3843
266 Ga0207670_10108058 3300025936 Bacteria 1999
267 Ga0207669_10027702 3300025937 Bacteria 3107
268 Ga0207704_10069375 3300025938 Bacteria 2227
269 Ga0207691_10088334 3300025940 Bacteria 2780
270 Ga0207711_10012235 3300025941 Bacteria 7137
271 Ga0207689_10000151 3300025942 Bacteria 59965
272 Ga0207689_10061712 3300025942 Bacteria 3083
273 Ga0207661_10117452 3300025944 Bacteria 2259
274 Ga0207661_10125311 3300025944 Bacteria 2193
275 Ga0207679_10007601 3300025945 Bacteria 6884
276 Ga0207679_10014124 3300025945 Bacteria 5243
277 Ga0207679_10079320 3300025945 Bacteria 2503
278 Ga0207667_10007731 3300025949 Bacteria 12852
279 Ga0207667_10023539 3300025949 Bacteria 6780
280 Ga0207667_10157811 3300025949 Bacteria 2334
281 Ga0207712_10025372 3300025961 Bacteria 3937
282 Ga0207712_10134992 3300025961 Bacteria 1885
283 Ga0207668_10018538 3300025972 Bacteria 4383
284 Ga0207668_10311279 3300025972 Bacteria 1303
285 Ga0207703_10000300 3300026035 Bacteria 54568
286 Ga0207703_10048191 3300026035 Bacteria 3438
287 Ga0207703_10378494 3300026035 Bacteria 1309
288 Ga0207639_10045997 3300026041 Bacteria 3291
289 Ga0207678_10003426 3300026067 Bacteria 14285
290 Ga0207678_10009871 3300026067 Bacteria 8382
291 Ga0207678_10021702 3300026067 Bacteria 5631
292 Ga0207678_10186960 3300026067 Bacteria 1770
293 Ga0207708_10005456 3300026075 Bacteria 9381
294 Ga0207708_10005844 3300026075 Bacteria 9104
295 Ga0207708_10007962 3300026075 Bacteria 7853
296 Ga0207702_10052580 3300026078 Bacteria 3447
297 Ga0207641_10017758 3300026088 Bacteria 5829
298 Ga0207641_10018900 3300026088 Bacteria 5653
299 Ga0207641_10174243 3300026088 Bacteria 1966
300 Ga0207641_10218059 3300026088 Bacteria 1768
301 Ga0207648_10004613 3300026089 Bacteria 14128
302 Ga0207648_10052305 3300026089 Bacteria 3571
303 Ga0207676_10001288 3300026095 Bacteria 18648
304 Ga0207676_10189192 3300026095 Bacteria 1810
305 Ga0207676_10292850 3300026095 Bacteria 1483
306 Ga0207674_10000045 3300026116 Bacteria 122251
307 Ga0207674_10009358 3300026116 Bacteria 11207
308 Ga0207674_10051123 3300026116 Bacteria 4218
309 Ga0207674_10082438 3300026116 Bacteria 3217
310 Ga0207674_10235200 3300026116 Bacteria 1780
311 Ga0207675_100001119 3300026118 Bacteria 26560
312 Ga0207675_100056667 3300026118 Bacteria 3655
313 Ga0207675_100066051 3300026118 Bacteria 3380
314 Ga0207675_100458862 3300026118 Bacteria 1263
315 Ga0207683_10009436 3300026121 Bacteria 8315
316 Ga0207683_10021746 3300026121 Bacteria 5498
317 Ga0207683_10179745 3300026121 Bacteria 1918
318 Ga0207698_10014647 3300026142 Bacteria 5221
319 Ga0207698_10049585 3300026142 Bacteria 3197
320 Ga0209966_1001307 3300027695 Bacteria 4406
321 Ga0209998_10001451 3300027717 Bacteria 5728
322 Ga0209998_10003218 3300027717 Bacteria 3606
323 Ga0209974_10018298 3300027876 Bacteria 2325
324 Ga0209974_10021058 3300027876 Bacteria 2161
325 Ga0207428_10000255 3300027907 Bacteria 72962
326 Ga0207428_10050828 3300027907 Bacteria 3314
327 Ga0268265_10003089 3300028380 Bacteria 12151
328 Ga0268264_10000451 3300028381 Bacteria 56097
329 Ga0268264_10003127 3300028381 Bacteria 14348
330 Ga0265332_10025356 3300031238 Bacteria 2605
331 Ga0265325_10000708 3300031241 Bacteria 24173
332 Ga0265313_10009620 3300031595 Bacteria 6252
333 Ga0307413_10306885 3300031824 Bacteria 1206
334 Ga0307407_10110147 3300031903 Bacteria 1727
335 Ga0307412_10175021 3300031911 Bacteria 1608
336 Ga0307412_10223124 3300031911 Bacteria 1446
337 Ga0307409_100263115 3300031995 Bacteria 1584
338 Ga0307409_100523351 3300031995 Bacteria 1159
339 Ga0307414_10319916 3300032004 Bacteria 1320
340 Ga0307411_10314804 3300032005 Bacteria 1261
341 Ga0373930_0001628 3300034816 Bacteria 3387
342 Ga0373948_0000403 3300034817 Bacteria 5344
343 Ga0373950_0000200 3300034818 Bacteria 8183
344 Ga0373959_0001588 3300034820 Bacteria 3614
345 Ga0373938_0000844 3300034957 Bacteria 4942
346 Ga0373928_0000443 3300035084 Bacteria 8179
347 Ga0373929_0000756 3300035085 Bacteria 6285
348 Ga0373940_0000018 3300035088 Bacteria 19361
349 Ga0373949_0003205 3300035090 Bacteria 3964
350 Ga0373952_0000228 3300035092 Bacteria 9021
351 Ga0373923_0010688 3300035111 Bacteria 3348
352 Ga0373932_0000155 3300035112 Bacteria 19871
353 Ga0373936_0001591 3300035113 Bacteria 8288
354 Ga0373936_0004284 3300035113 Bacteria 5390
355 Ga0373936_0009238 3300035113 Bacteria 3716
356 Ga0373941_0001756 3300035115 Bacteria 4656
357 Ga0373945_0004589 3300035116 Bacteria 4392
358 Ga0373953_0022944 3300035117 Bacteria 2359
359 Ga0373954_0020778 3300035118 Bacteria 2971
360 Ga0373954_0044028 3300035118 Bacteria 2082
361 Ga0373960_0000061 3300035121 Bacteria 14957
362 Ga0373943_0001108 3300035170 Bacteria 12022
363 Ga0373946_0001186 3300035171 Bacteria 9031
364 Ga0373946_0008129 3300035171 Bacteria 3851
365 Ga0373955_0008613 3300035172 Bacteria 4744
366 Ga0373942_0002062 3300035207 Bacteria 4998
367 Ga0373961_0000451 3300035241 Bacteria 16466
368 Ga0373961_0006208 3300035241 Bacteria 2872
369 Ga0373962_0000409 3300035242 Bacteria 9394
370 Ga0373924_0014055 3300035410 Bacteria 3019
371 Ga0373931_0020850 3300035691 Bacteria 3282
372 Ga0373935_0003508 3300035692 Bacteria 9123
373 Ga0373935_0028092 3300035692 Bacteria 3476
374 Ga0373935_0033212 3300035692 Bacteria 3210
375 Ga0373927_0002017 3300035695 Bacteria 14958
376 Ga0373927_0004258 3300035695 Bacteria 10045
377 Ga0373933_0022312 3300035724 Bacteria 3603
378 Ga0373933_0096356 3300035724 Bacteria 1831
379 Ga0373933_0160317 3300035724 Bacteria 1428
380 Ga0373947_0002042 3300035725 Bacteria 12318
381 Ga0373947_0016168 3300035725 Bacteria 4288
382 Ga0373937_0009662 3300036401 Bacteria 8401
383 Ga0373937_0051194 3300036401 Bacteria 3785
384 Ga0373937_0215916 3300036401 Bacteria 1805
385 Ga0373937_0455248 3300036401 Bacteria 1215
386 Ga0373925_0004980 3300037068 Bacteria 9973
387 Ga0395905_0049971 3300037471 Bacteria 3919
388 Ga0436364_0663275 3300037853 Bacteria 97909
389 Ga0436365_1342486 3300039437 Bacteria 2466
390 Ga0436361_0886998 3300039447 Bacteria 5611
391 Ga0436363_1654980 3300039450 Bacteria 10573
392 Ga0451833_0091326 3300041491 Bacteria 985
393 Ga0451843_0100024 3300041509 Bacteria 1723
394 Ga0439448_0025513 3300042005 Bacteria 1854
395 Ga0439450_005017 3300042008 Bacteria 2300
396 Ga0439463_028313 3300042016 Bacteria 1411
397 Ga0439464_0014054 3300042439 Bacteria 2149
398 Ga0451576_0058905 3300045051 Bacteria 4011
399 Ga0495592_0001157 3300046454 Bacteria 18304
400 Ga0495592_0006155 3300046454 Bacteria 8922
401 Ga0495603_0065858 3300046455 Bacteria 2135
402 Ga0495629_0005121 3300046459 Bacteria 9800
403 Ga0495641_0003638 3300046461 Bacteria 11412
404 Ga0495641_0089976 3300046461 Bacteria 1371
405 Ga0495651_0002175 3300046462 Bacteria 15159
406 Ga0495653_0002883 3300046463 Bacteria 13751
407 Ga0495653_0045259 3300046463 Bacteria 3412
408 Ga0495580_0012164 3300046472 Bacteria 6616
409 Ga0495580_0025286 3300046472 Bacteria 4340
410 Ga0495582_0002391 3300046473 Bacteria 10488
411 Ga0495639_0000713 3300046475 Bacteria 15217
412 Ga0495639_0064779 3300046475 Bacteria 1680
413 Ga0495662_0000084 3300046476 Bacteria 33781
414 Ga0495662_0053207 3300046476 Bacteria 1955
415 Ga0495662_0058494 3300046476 Bacteria 1862
416 Ga0495664_0000482 3300046477 Bacteria 19803
417 Ga0495664_0059591 3300046477 Bacteria 2272
418 Ga0495585_0032653 3300046492 Bacteria 2948
419 Ga0495594_0008249 3300046499 Bacteria 5361
420 Ga0495608_0005556 3300046511 Bacteria 9006
421 Ga0495618_0004433 3300046514 Bacteria 8635
422 Ga0495628_0007423 3300046516 Bacteria 9490
423 Ga0495628_0018284 3300046516 Bacteria 5810
424 Ga0495628_0020031 3300046516 Bacteria 5523
425 Ga0495630_0001951 3300046517 Bacteria 14336
426 Ga0495630_0006736 3300046517 Bacteria 8188
427 Ga0495630_0129648 3300046517 Bacteria 1915
428 Ga0495632_0056324 3300046519 Bacteria 1922
429 Ga0495666_0004463 3300046526 Bacteria 7069
430 Ga0495666_0014684 3300046526 Bacteria 3898
431 Ga0495652_0007683 3300046529 Bacteria 9928
432 Ga0495665_0002359 3300046531 Bacteria 10190
433 Ga0495665_0024936 3300046531 Bacteria 3213
434 Ga0495665_0055338 3300046531 Bacteria 2095
435 Ga0495640_0002890 3300046533 Bacteria 13841
436 Ga0495640_0007345 3300046533 Bacteria 8671
437 Ga0495640_0043685 3300046533 Bacteria 3119
438 Ga0495586_0001095 3300046535 Bacteria 15316
439 Ga0495586_0044159 3300046535 Bacteria 2400
440 Ga0495587_0010083 3300046536 Bacteria 6029
441 Ga0495645_0046268 3300046543 Bacteria 3171
442 Ga0495622_0069760 3300046557 Bacteria 1623
443 Ga0495633_0035702 3300046558 Bacteria 2386
444 Ga0495667_0000202 3300046559 Bacteria 40046
445 Ga0495667_0035082 3300046559 Bacteria 3354
446 Ga0495667_0086742 3300046559 Bacteria 2029
447 Ga0495656_0105891 3300046615 Bacteria 1308
448 Ga0495634_0005317 3300046642 Bacteria 9928
449 Ga0495634_0014760 3300046642 Bacteria 5620
450 Ga0495625_0035683 3300046660 Bacteria 3663
451 Ga0495625_0037749 3300046660 Bacteria 3540
452 Ga0495635_0000399 3300046663 Bacteria 27531
453 Ga0495588_0062754 3300046674 Bacteria 1926
454 Ga0495657_0001733 3300046675 Bacteria 18667
455 Ga0495599_0004717 3300046678 Bacteria 8096
456 Ga0495599_0077697 3300046678 Bacteria 2072
457 Ga0495646_0003722 3300046680 Bacteria 9525
458 Ga0495647_0004315 3300046681 Bacteria 4608
459 Ga0495647_0013214 3300046681 Bacteria 2857
460 Ga0495658_0001713 3300046683 Bacteria 11388
461 Ga0495658_0007999 3300046683 Bacteria 5239
462 Ga0495658_0008581 3300046683 Bacteria 5069
463 Ga0495613_0001462 3300046689 Bacteria 17997
464 Ga0495613_0008236 3300046689 Bacteria 7739
465 Ga0495613_0009305 3300046689 Bacteria 7290
466 Ga0495624_0000222 3300046690 Bacteria 44293
467 Ga0495624_0041636 3300046690 Bacteria 2937
468 Ga0495624_0072273 3300046690 Bacteria 2146
469 Ga0495670_0000837 3300046691 Bacteria 14887
470 Ga0495600_0002124 3300046809 Bacteria 11221
471 Ga0495600_0003235 3300046809 Bacteria 9529
472 Ga0495581_0000145 3300047315 Bacteria 31255
473 Ga0495604_0005816 3300047317 Bacteria 9782
474 Ga0495604_0086560 3300047317 Bacteria 2335
475 Ga0495636_0038403 3300047318 Unclassified 1981
476 Ga0495674_0007404 3300047319 Bacteria 10489
477 Ga0495674_0015727 3300047319 Bacteria 7063
478 Ga0495676_0020974 3300047321 Bacteria 5718
479 Ga0495676_0059995 3300047321 Bacteria 2984
480 Ga0495680_0001864 3300047322 Bacteria 22174
481 Ga0495680_0002897 3300047322 Bacteria 17243
482 Ga0495684_0000075 3300047471 Bacteria 67922
483 Ga0495593_0000228 3300047673 Bacteria 30037
484 Ga0496101_0118117 3300048904 Bacteria 2003
485 Ga0496102_0004792 3300048905 Bacteria 11439
486 Ga0496102_0110070 3300048905 Bacteria 2567
487 Ga0496102_0117308 3300048905 Bacteria 2484
488 Ga0496103_0010350 3300048906 Bacteria 5519
489 Ga0496103_0092071 3300048906 Bacteria 1914
490 Ga0496104_0000061 3300048907 Bacteria 117394
491 Ga0496104_0065899 3300048907 Bacteria 3438
492 Ga0496106_0000300 3300048909 Bacteria 34880
493 Ga0496106_0046270 3300048909 Bacteria 3270
494 Ga0496107_0002193 3300048910 Bacteria 12549
495 Ga0496107_0018653 3300048910 Bacteria 4888
496 Ga0496107_0249197 3300048910 Bacteria 1321
497 Ga0496108_0004930 3300048911 Bacteria 10782
498 Ga0496109_0001819 3300048912 Bacteria 17742
499 Ga0496109_0257661 3300048912 Bacteria 1643
500 Ga0496110_0037046 3300048913 Bacteria 4238
501 Ga0496112_0004718 3300048915 Bacteria 11614
502 Ga0496113_0036894 3300048916 Bacteria 3583
503 Ga0496115_0051521 3300048918 Bacteria 3301
504 Ga0501032_0008708 3300049569 Bacteria 7389
505 Ga0501033_0020592 3300049570 Bacteria 4984
506 Ga0501034_0000439 3300049571 Bacteria 68932
507 Ga0501034_0019423 3300049571 Bacteria 6951
508 Ga0501036_0000689 3300049572 Bacteria 24929
509 Ga0501036_0013749 3300049572 Bacteria 6730
510 Ga0501037_0007499 3300049573 Bacteria 7985
511 Ga0501037_0126837 3300049573 Bacteria 1831
512 Ga0501038_0004102 3300049574 Bacteria 13549
513 Ga0501038_0236569 3300049574 Bacteria 1451
514 Ga0501039_0059755 3300049575 Bacteria 2952
515 Ga0501043_0002343 3300049579 Bacteria 16061
516 Ga0501043_0032695 3300049579 Bacteria 4090
517 Ga0501046_0115613 3300049580 Bacteria 2045
518 Ga0501047_0000204 3300049581 Bacteria 71976
519 Ga0501047_0006456 3300049581 Bacteria 11031
520 Ga0501047_0011147 3300049581 Bacteria 8507
521 Ga0501047_0268488 3300049581 Bacteria 1552
522 Ga0501048_0000065 3300049582 Bacteria 53623
523 Ga0501048_0083602 3300049582 Bacteria 2251
524 Ga0501048_0115983 3300049582 Bacteria 1892
525 Ga0501067_0082272 3300049583 Bacteria 1785
526 Ga0501068_0005601 3300049584 Bacteria 6878
527 Ga0501068_0014257 3300049584 Bacteria 4541
528 Ga0501069_0088964 3300049585 Bacteria 1745
529 Ga0501070_0002291 3300049586 Bacteria 16823
530 Ga0501070_0012101 3300049586 Bacteria 7282
531 Ga0501070_0031140 3300049586 Bacteria 4468
532 Ga0501072_0115487 3300049588 Bacteria 2137
533 Ga0501073_0054599 3300049589 Bacteria 2796
534 Ga0501074_0008526 3300049590 Bacteria 7427
535 Ga0501074_0036552 3300049590 Bacteria 3557
536 Ga0501076_0218921 3300049592 Bacteria 1556
537 Ga0501080_0000815 3300049742 Bacteria 25419
538 Ga0501080_0062194 3300049742 Bacteria 3474
539 Ga0501080_0186629 3300049742 Bacteria 1906
540 Ga0501080_0485200 3300049742 Bacteria 1105
541 Ga0501083_0001712 3300049744 Bacteria 14955
542 Ga0501083_0031399 3300049744 Bacteria 3646
543 Ga0501035_0025991 3300049822 Bacteria 5363
544 Ga0501035_0091494 3300049822 Bacteria 2677
545 Ga0501044_0001827 3300049823 Bacteria 24776
546 Ga0501044_0016948 3300049823 Bacteria 7816
547 Ga0501045_0125873 3300049824 Bacteria 1904
548 nmdc:mga03683_33286_c1 3300050489 Bacteria 2078
549 nmdc:mga0yw44_56388_c1 3300050492 Bacteria 2393
550 nmdc:mga0k408_267671_c1 3300050493 Bacteria 1020
551 nmdc:mga0k408_39815_c1 3300050493 Bacteria 2703
552 nmdc:mga0k408_78503_c1 3300050493 Bacteria 1443
553 nmdc:mga06z11_30677_c1 3300050494 Bacteria 2604
554 nmdc:mga05p37_208054_c1 3300050507 Bacteria 2366
555 nmdc:mga08y16_28547_c1 3300050511 Bacteria 5882
556 nmdc:mga08y16_8011_c1 3300050511 Bacteria 11053
557 nmdc:mga0n895_157457_c1 3300050512 Bacteria 2302
558 nmdc:mga0rr50_125787_c1 3300050513 Bacteria 2047
559 nmdc:mga0a205_18403_c1 3300050515 Bacteria 6568
560 Ga0495601_0010704 3300053077 Bacteria 5470
561 Ga0495601_0014582 3300053077 Bacteria 4737
562 Ga0495612_0001242 3300053078 Bacteria 10512
563 Ga0495612_0063252 3300053078 Bacteria 1535
564 Ga0495595_0000988 3300053084 Bacteria 10960
565 Ga0495595_0013080 3300053084 Bacteria 3501
566 Ga0495619_0001117 3300053085 Bacteria 17612
567 Ga0495619_0043241 3300053085 Bacteria 2952
568 Ga0500643_000795 3300053087 Bacteria 20468
569 Ga0500651_0014672 3300053093 Bacteria 4797
570 Ga0500566_0127711 3300053094 Bacteria 1364
571 Ga0500595_000001 3300053119 Bacteria 1088438
572 Ga0500604_0043800 3300053151 Bacteria 1361
573 Ga0500637_0030651 3300053178 Bacteria 2995
574 Ga0500645_000015 3300053730 Bacteria 150140
575 Ga0501084_0215386 3300054114 Bacteria 1620
576 Ga0501082_0145737 3300060353 Bacteria 2055
577 Ga0501082_0271351 3300060353 Bacteria 1476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100144735 Ga0068869_1001447352 282
2 3300026095 Ga0207676_10189192 Ga0207676_101891922 290
3 3300009177 Ga0105248_10131270 Ga0105248_101312702 306
4 3300014325 Ga0163163_10005846 Ga0163163_100058467 306
5 3300014968 Ga0157379_10011943 Ga0157379_100119438 306
6 3300048907 Ga0496104_0065899 Ga0496104_0065899_2338_3396 306
7 3300048911 Ga0496108_0004930 Ga0496108_0004930_7159_8217 306
8 3300048912 Ga0496109_0001819 Ga0496109_0001819_2567_3625 306
9 3300048913 Ga0496110_0037046 Ga0496110_0037046_503_1561 306
10 3300048915 Ga0496112_0004718 Ga0496112_0004718_8075_9133 306
11 3300048916 Ga0496113_0036894 Ga0496113_0036894_1105_2163 306
12 3300005564 Ga0070664_100023513 Ga0070664_1000235133 307
13 3300005614 Ga0068856_100309998 Ga0068856_1003099981 307
14 3300025945 Ga0207679_10014124 Ga0207679_100141243 307
15 3300005615 Ga0070702_100046999 Ga0070702_1000469992 308
16 3300009011 Ga0105251_10065994 Ga0105251_100659941 308
17 3300025918 Ga0207662_10091333 Ga0207662_100913332 308
18 3300025942 Ga0207689_10061712 Ga0207689_100617123 309
19 3300035724 Ga0373933_0096356 Ga0373933_0096356_254_1258 309
20 3300046476 Ga0495662_0058494 Ga0495662_0058494_122_1108 309
21 3300046690 Ga0495624_0072273 Ga0495624_0072273_578_1564 309
22 3300005290 Ga0065712_10071542 Ga0065712_100715422 310
23 3300005293 Ga0065715_10144991 Ga0065715_101449912 310
24 3300005330 Ga0070690_100022947 Ga0070690_1000229472 310
25 3300005331 Ga0070670_100070304 Ga0070670_1000703042 310
26 3300005367 Ga0070667_100102127 Ga0070667_1001021272 310
27 3300005842 Ga0068858_100022002 Ga0068858_1000220024 310
28 3300025925 Ga0207650_10030156 Ga0207650_100301564 310
29 3300026035 Ga0207703_10048191 Ga0207703_100481912 310
30 3300036401 Ga0373937_0009662 Ga0373937_0009662_6895_7881 310
31 3300046476 Ga0495662_0053207 Ga0495662_0053207_602_1588 310
32 3300046511 Ga0495608_0005556 Ga0495608_0005556_151_1137 310
33 3300046516 Ga0495628_0020031 Ga0495628_0020031_2655_3641 310
34 3300046535 Ga0495586_0001095 Ga0495586_0001095_1213_2199 310
35 3300046642 Ga0495634_0014760 Ga0495634_0014760_12_998 310
36 3300046683 Ga0495658_0007999 Ga0495658_0007999_4171_5157 310
37 3300046689 Ga0495613_0009305 Ga0495613_0009305_1112_2098 310
38 3300047318 Ga0495636_0038403 Ga0495636_0038403_291_1277 310
39 3300047322 Ga0495680_0002897 Ga0495680_0002897_1793_2779 310
40 3300053077 Ga0495601_0014582 Ga0495601_0014582_2416_3402 310
41 3300005435 Ga0070714_100076575 Ga0070714_1000765753 311
42 3300005439 Ga0070711_100058899 Ga0070711_1000588991 311
43 3300025916 Ga0207663_10127849 Ga0207663_101278492 311
44 3300025929 Ga0207664_10066992 Ga0207664_100669922 311
45 3300025915 Ga0207693_10072881 Ga0207693_100728813 312
46 3300046454 Ga0495592_0001157 Ga0495592_0001157_4104_5090 312
47 3300046533 Ga0495640_0002890 Ga0495640_0002890_736_1722 312
48 3300005327 Ga0070658_10123637 Ga0070658_101236371 314
49 3300005339 Ga0070660_100027333 Ga0070660_1000273333 314
50 3300005343 Ga0070687_100049318 Ga0070687_1000493181 314
51 3300005435 Ga0070714_100110567 Ga0070714_1001105672 314
52 3300005458 Ga0070681_10219770 Ga0070681_102197702 314
53 3300005530 Ga0070679_100022933 Ga0070679_1000229335 314
54 3300009093 Ga0105240_10025445 Ga0105240_100254456 314
55 3300009551 Ga0105238_10021202 Ga0105238_100212023 314
56 3300025909 Ga0207705_10019721 Ga0207705_100197213 314
57 3300025919 Ga0207657_10015476 Ga0207657_100154765 314
58 3300025921 Ga0207652_10039490 Ga0207652_100394901 314
59 3300025924 Ga0207694_10059169 Ga0207694_100591693 314
60 3300025929 Ga0207664_10084441 Ga0207664_100844413 314
61 3300005456 Ga0070678_100006921 Ga0070678_1000069213 315
62 3300009101 Ga0105247_10017646 Ga0105247_100176461 315
63 3300009176 Ga0105242_10455801 Ga0105242_104558012 315
64 3300013297 Ga0157378_10242284 Ga0157378_102422842 315
65 3300014745 Ga0157377_10085370 Ga0157377_100853701 315
66 3300025937 Ga0207669_10027702 Ga0207669_100277022 315
67 3300026121 Ga0207683_10009436 Ga0207683_100094365 315
68 3300041491 Ga0451833_0091326 Ga0451833_0091326_16_963 315
69 3300048905 Ga0496102_0117308 Ga0496102_0117308_29_976 315
70 3300048912 Ga0496109_0257661 Ga0496109_0257661_683_1630 315
71 3300003911 JGI25405J52794_10001935 JGI25405J52794_100019353 316
72 3300005937 Ga0081455_10000012 Ga0081455_10000012102 316
73 3300025934 Ga0207686_10072241 Ga0207686_100722413 316
74 3300035113 Ga0373936_0009238 Ga0373936_0009238_1193_2179 316
75 3300035116 Ga0373945_0004589 Ga0373945_0004589_2193_3179 316
76 3300035171 Ga0373946_0008129 Ga0373946_0008129_1830_2816 316
77 3300035692 Ga0373935_0028092 Ga0373935_0028092_1214_2200 316
78 3300035695 Ga0373927_0004258 Ga0373927_0004258_2344_3330 316
79 3300035725 Ga0373947_0002042 Ga0373947_0002042_2987_3973 316
80 3300046472 Ga0495580_0025286 Ga0495580_0025286_1808_2794 316
81 3300046475 Ga0495639_0064779 Ga0495639_0064779_144_1130 316
82 3300046526 Ga0495666_0014684 Ga0495666_0014684_1501_2487 316
83 3300046531 Ga0495665_0055338 Ga0495665_0055338_1036_2022 316
84 3300046535 Ga0495586_0044159 Ga0495586_0044159_88_1074 316
85 3300046674 Ga0495588_0062754 Ga0495588_0062754_914_1900 316
86 3300046681 Ga0495647_0013214 Ga0495647_0013214_1796_2782 316
87 3300046683 Ga0495658_0001713 Ga0495658_0001713_2035_3021 316
88 3300047321 Ga0495676_0059995 Ga0495676_0059995_1771_2757 316
89 3300005937 Ga0081455_10097858 Ga0081455_100978582 320
90 3300046678 Ga0495599_0077697 Ga0495599_0077697_413_1420 321
91 3300009094 Ga0111539_10416843 Ga0111539_104168432 322
92 3300035118 Ga0373954_0044028 Ga0373954_0044028_154_1161 323
93 3300035724 Ga0373933_0160317 Ga0373933_0160317_246_1274 323
94 3300036401 Ga0373937_0051194 Ga0373937_0051194_853_1881 323
95 3300046455 Ga0495603_0065858 Ga0495603_0065858_60_1073 323
96 iso_pu_bacteria 2643221547 2643758912 323
97 3300025912 Ga0207707_10007786 Ga0207707_100077865 324
98 3300048906 Ga0496103_0010350 Ga0496103_0010350_3380_4501 324
99 3300005471 Ga0070698_100177985 Ga0070698_1001779853 325
100 3300050493 nmdc:mga0k408_267671_c1 nmdc:mga0k408_267671_c1_21_1004 325
101 3300007076 Ga0075435_100002930 Ga0075435_10000293012 326
102 3300050513 nmdc:mga0rr50_125787_c1 nmdc:mga0rr50_125787_c1_707_1690 326
103 3300050515 nmdc:mga0a205_18403_c1 nmdc:mga0a205_18403_c1_4980_5963 326
104 3300042008 Ga0439450_005017 Ga0439450_005017_699_1682 327
105 3300049592 Ga0501076_0218921 Ga0501076_0218921_490_1491 327
106 3300060353 Ga0501082_0271351 Ga0501082_0271351_269_1270 327
107 3300005331 Ga0070670_100309827 Ga0070670_1003098272 328
108 3300005343 Ga0070687_100166548 Ga0070687_1001665481 328
109 3300005544 Ga0070686_100053084 Ga0070686_1000530843 328
110 3300005842 Ga0068858_100114748 Ga0068858_1001147483 328
111 3300006237 Ga0097621_100001440 Ga0097621_10000144014 328
112 3300006358 Ga0068871_100002792 Ga0068871_10000279210 328
113 3300014969 Ga0157376_10020495 Ga0157376_100204952 328
114 3300021361 Ga0213872_10069800 Ga0213872_100698002 328
115 3300025918 Ga0207662_10195291 Ga0207662_101952912 328
116 3300035241 Ga0373961_0006208 Ga0373961_0006208_912_1901 328
117 3300039447 Ga0436361_0886998 Ga0436361_0886998_3336_4334 328
118 3300039450 Ga0436363_1654980 Ga0436363_1654980_4705_5703 328
119 3300003203 JGI25406J46586_10000826 JGI25406J46586_1000082610 329
120 3300005327 Ga0070658_10035834 Ga0070658_100358343 329
121 3300005329 Ga0070683_100078518 Ga0070683_1000785182 329
122 3300005334 Ga0068869_100000039 Ga0068869_10000003910 329
123 3300005339 Ga0070660_100014143 Ga0070660_1000141432 329
124 3300005343 Ga0070687_100194776 Ga0070687_1001947761 329
125 3300005344 Ga0070661_100055552 Ga0070661_1000555522 329
126 3300005345 Ga0070692_10030076 Ga0070692_100300763 329
127 3300005347 Ga0070668_100042788 Ga0070668_1000427884 329
128 3300005366 Ga0070659_100009187 Ga0070659_1000091875 329
129 3300005367 Ga0070667_100000488 Ga0070667_1000004888 329
130 3300005434 Ga0070709_10017300 Ga0070709_100173003 329
131 3300005434 Ga0070709_10258273 Ga0070709_102582731 329
132 3300005435 Ga0070714_100018028 Ga0070714_1000180283 329
133 3300005440 Ga0070705_100038253 Ga0070705_1000382532 329
134 3300005458 Ga0070681_10115718 Ga0070681_101157182 329
135 3300005459 Ga0068867_100002184 Ga0068867_10000218410 329
136 3300005471 Ga0070698_100182302 Ga0070698_1001823021 329
137 3300005530 Ga0070679_100122680 Ga0070679_1001226802 329
138 3300005535 Ga0070684_100010266 Ga0070684_1000102665 329
139 3300005539 Ga0068853_100015534 Ga0068853_1000155342 329
140 3300005546 Ga0070696_100004759 Ga0070696_1000047595 329
141 3300005563 Ga0068855_100219987 Ga0068855_1002199871 329
142 3300005614 Ga0068856_100033873 Ga0068856_1000338733 329
143 3300005617 Ga0068859_100000189 Ga0068859_10000018929 329
144 3300005618 Ga0068864_100000192 Ga0068864_10000019224 329
145 3300005719 Ga0068861_100011083 Ga0068861_1000110835 329
146 3300005834 Ga0068851_10002769 Ga0068851_100027695 329
147 3300005841 Ga0068863_100181101 Ga0068863_1001811012 329
148 3300005841 Ga0068863_100328025 Ga0068863_1003280251 329
149 3300005843 Ga0068860_100000350 Ga0068860_10000035053 329
150 3300005937 Ga0081455_10034958 Ga0081455_100349582 329
151 3300005937 Ga0081455_10135784 Ga0081455_101357842 329
152 3300005985 Ga0081539_10002294 Ga0081539_100022949 329
153 3300006914 Ga0075436_100057054 Ga0075436_1000570543 329
154 3300006931 Ga0097620_100000189 Ga0097620_10000018929 329
155 3300009093 Ga0105240_10079097 Ga0105240_100790972 329
156 3300009177 Ga0105248_10013370 Ga0105248_1001337011 329
157 3300009553 Ga0105249_10170477 Ga0105249_101704771 329
158 3300010375 Ga0105239_10180994 Ga0105239_101809942 329
159 3300013102 Ga0157371_10008859 Ga0157371_100088593 329
160 3300013104 Ga0157370_10010239 Ga0157370_100102398 329
161 3300013105 Ga0157369_10117912 Ga0157369_101179123 329
162 3300013307 Ga0157372_10086413 Ga0157372_100864132 329
163 3300013307 Ga0157372_10266014 Ga0157372_102660142 329
164 3300014968 Ga0157379_10000028 Ga0157379_1000002827 329
165 3300021388 Ga0213875_10048223 Ga0213875_100482233 329
166 3300025898 Ga0207692_10013091 Ga0207692_100130911 329
167 3300025906 Ga0207699_10015906 Ga0207699_100159063 329
168 3300025906 Ga0207699_10025985 Ga0207699_100259852 329
169 3300025906 Ga0207699_10054214 Ga0207699_100542142 329
170 3300025907 Ga0207645_10087504 Ga0207645_100875041 329
171 3300025909 Ga0207705_10110771 Ga0207705_101107712 329
172 3300025913 Ga0207695_10018499 Ga0207695_100184997 329
173 3300025916 Ga0207663_10003419 Ga0207663_100034197 329
174 3300025917 Ga0207660_10020459 Ga0207660_100204592 329
175 3300025918 Ga0207662_10126359 Ga0207662_101263592 329
176 3300025919 Ga0207657_10000213 Ga0207657_1000021336 329
177 3300025920 Ga0207649_10025487 Ga0207649_100254873 329
178 3300025921 Ga0207652_10096003 Ga0207652_100960032 329
179 3300025924 Ga0207694_10024491 Ga0207694_100244914 329
180 3300025928 Ga0207700_10013374 Ga0207700_100133742 329
181 3300025929 Ga0207664_10030851 Ga0207664_100308514 329
182 3300025929 Ga0207664_10051388 Ga0207664_100513883 329
183 3300025932 Ga0207690_10050009 Ga0207690_100500091 329
184 3300025941 Ga0207711_10012235 Ga0207711_100122351 329
185 3300025942 Ga0207689_10000151 Ga0207689_1000015110 329
186 3300025944 Ga0207661_10117452 Ga0207661_101174522 329
187 3300025945 Ga0207679_10079320 Ga0207679_100793202 329
188 3300025949 Ga0207667_10023539 Ga0207667_100235393 329
189 3300025949 Ga0207667_10157811 Ga0207667_101578111 329
190 3300025961 Ga0207712_10134992 Ga0207712_101349923 329
191 3300026035 Ga0207703_10000300 Ga0207703_1000030044 329
192 3300026067 Ga0207678_10009871 Ga0207678_100098714 329
193 3300026078 Ga0207702_10052580 Ga0207702_100525803 329
194 3300026088 Ga0207641_10017758 Ga0207641_100177582 329
195 3300026089 Ga0207648_10004613 Ga0207648_1000461310 329
196 3300026095 Ga0207676_10001288 Ga0207676_1000128819 329
197 3300026116 Ga0207674_10000045 Ga0207674_1000004521 329
198 3300026116 Ga0207674_10051123 Ga0207674_100511233 329
199 3300026118 Ga0207675_100001119 Ga0207675_10000111911 329
200 3300026142 Ga0207698_10014647 Ga0207698_100146473 329
201 3300028381 Ga0268264_10000451 Ga0268264_100004512 329
202 3300037471 Ga0395905_0049971 Ga0395905_0049971_2244_3251 329
203 3300037853 Ga0436364_0663275 Ga0436364_0663275_30558_31550 329
204 3300049569 Ga0501032_0008708 Ga0501032_0008708_4037_5041 329
205 3300049571 Ga0501034_0000439 Ga0501034_0000439_7558_8562 329
206 3300049571 Ga0501034_0019423 Ga0501034_0019423_49_1053 329
207 3300049572 Ga0501036_0000689 Ga0501036_0000689_14477_15529 329
208 3300049572 Ga0501036_0013749 Ga0501036_0013749_2043_3047 329
209 3300049573 Ga0501037_0007499 Ga0501037_0007499_3232_4236 329
210 3300049573 Ga0501037_0126837 Ga0501037_0126837_136_1140 329
211 3300049574 Ga0501038_0004102 Ga0501038_0004102_9653_10657 329
212 3300049574 Ga0501038_0236569 Ga0501038_0236569_355_1359 329
213 3300049575 Ga0501039_0059755 Ga0501039_0059755_767_1771 329
214 3300049579 Ga0501043_0002343 Ga0501043_0002343_8217_9269 329
215 3300049579 Ga0501043_0032695 Ga0501043_0032695_2119_3123 329
216 3300049580 Ga0501046_0115613 Ga0501046_0115613_971_1975 329
217 3300049581 Ga0501047_0000204 Ga0501047_0000204_38342_39394 329
218 3300049581 Ga0501047_0006456 Ga0501047_0006456_9590_10594 329
219 3300049581 Ga0501047_0011147 Ga0501047_0011147_7413_8417 329
220 3300049581 Ga0501047_0268488 Ga0501047_0268488_291_1295 329
221 3300049582 Ga0501048_0000065 Ga0501048_0000065_4663_5715 329
222 3300049582 Ga0501048_0083602 Ga0501048_0083602_926_1930 329
223 3300049582 Ga0501048_0115983 Ga0501048_0115983_10_1014 329
224 3300049583 Ga0501067_0082272 Ga0501067_0082272_743_1747 329
225 3300049584 Ga0501068_0014257 Ga0501068_0014257_851_1855 329
226 3300049585 Ga0501069_0088964 Ga0501069_0088964_649_1653 329
227 3300049586 Ga0501070_0002291 Ga0501070_0002291_3378_4430 329
228 3300049586 Ga0501070_0012101 Ga0501070_0012101_5877_6881 329
229 3300049588 Ga0501072_0115487 Ga0501072_0115487_92_1096 329
230 3300049589 Ga0501073_0054599 Ga0501073_0054599_247_1251 329
231 3300049590 Ga0501074_0008526 Ga0501074_0008526_1989_3041 329
232 3300049590 Ga0501074_0036552 Ga0501074_0036552_645_1649 329
233 3300049742 Ga0501080_0000815 Ga0501080_0000815_23212_24264 329
234 3300049742 Ga0501080_0062194 Ga0501080_0062194_1905_2909 329
235 3300049742 Ga0501080_0186629 Ga0501080_0186629_24_1028 329
236 3300049742 Ga0501080_0485200 Ga0501080_0485200_35_1039 329
237 3300049744 Ga0501083_0001712 Ga0501083_0001712_7819_8871 329
238 3300049744 Ga0501083_0031399 Ga0501083_0031399_1798_2802 329
239 3300049822 Ga0501035_0025991 Ga0501035_0025991_4079_5083 329
240 3300049822 Ga0501035_0091494 Ga0501035_0091494_379_1383 329
241 3300049823 Ga0501044_0001827 Ga0501044_0001827_14404_15456 329
242 3300049823 Ga0501044_0016948 Ga0501044_0016948_2724_3728 329
243 3300049824 Ga0501045_0125873 Ga0501045_0125873_72_1076 329
244 3300054114 Ga0501084_0215386 Ga0501084_0215386_48_1052 329
245 3300060353 Ga0501082_0145737 Ga0501082_0145737_732_1736 329
246 3300006051 Ga0075364_10028110 Ga0075364_100281102 330
247 3300006195 Ga0075366_10083127 Ga0075366_100831272 330
248 3300006353 Ga0075370_10013741 Ga0075370_100137412 330
249 3300039437 Ga0436365_1342486 Ga0436365_1342486_47_1042 330
250 3300050494 nmdc:mga06z11_30677_c1 nmdc:mga06z11_30677_c1_1527_2528 330
251 3300005340 Ga0070689_100150147 Ga0070689_1001501472 331
252 3300005841 Ga0068863_100012588 Ga0068863_1000125885 331
253 3300005844 Ga0068862_100048145 Ga0068862_1000481453 331
254 3300005844 Ga0068862_100057387 Ga0068862_1000573873 331
255 3300009094 Ga0111539_10000114 Ga0111539_1000011422 331
256 3300009094 Ga0111539_10011997 Ga0111539_1001199712 331
257 3300009147 Ga0114129_10733661 Ga0114129_107336611 331
258 3300009148 Ga0105243_10026263 Ga0105243_100262634 331
259 3300010375 Ga0105239_10053091 Ga0105239_100530914 331
260 3300013307 Ga0157372_10222015 Ga0157372_102220153 331
261 3300014326 Ga0157380_10061308 Ga0157380_100613083 331
262 3300025926 Ga0207659_10303805 Ga0207659_103038051 331
263 3300025931 Ga0207644_10135404 Ga0207644_101354042 331
264 3300025936 Ga0207670_10108058 Ga0207670_101080582 331
265 3300026088 Ga0207641_10018900 Ga0207641_100189005 331
266 3300026088 Ga0207641_10218059 Ga0207641_102180592 331
267 3300026095 Ga0207676_10292850 Ga0207676_102928502 331
268 3300026118 Ga0207675_100458862 Ga0207675_1004588622 331
269 3300031824 Ga0307413_10306885 Ga0307413_103068851 331
270 3300031903 Ga0307407_10110147 Ga0307407_101101471 331
271 3300031911 Ga0307412_10223124 Ga0307412_102231241 331
272 3300031995 Ga0307409_100523351 Ga0307409_1005233511 331
273 3300032004 Ga0307414_10319916 Ga0307414_103199161 331
274 3300034816 Ga0373930_0001628 Ga0373930_0001628_2102_3097 331
275 3300034817 Ga0373948_0000403 Ga0373948_0000403_1036_2031 331
276 3300034818 Ga0373950_0000200 Ga0373950_0000200_6411_7406 331
277 3300034820 Ga0373959_0001588 Ga0373959_0001588_2213_3208 331
278 3300034957 Ga0373938_0000844 Ga0373938_0000844_79_1074 331
279 3300035084 Ga0373928_0000443 Ga0373928_0000443_2673_3668 331
280 3300035085 Ga0373929_0000756 Ga0373929_0000756_4512_5507 331
281 3300035088 Ga0373940_0000018 Ga0373940_0000018_15600_16595 331
282 3300035090 Ga0373949_0003205 Ga0373949_0003205_2768_3763 331
283 3300035092 Ga0373952_0000228 Ga0373952_0000228_4341_5336 331
284 3300035112 Ga0373932_0000155 Ga0373932_0000155_2473_3468 331
285 3300035115 Ga0373941_0001756 Ga0373941_0001756_3268_4263 331
286 3300035121 Ga0373960_0000061 Ga0373960_0000061_369_1364 331
287 3300035207 Ga0373942_0002062 Ga0373942_0002062_1504_2499 331
288 3300035241 Ga0373961_0000451 Ga0373961_0000451_4226_5221 331
289 3300035242 Ga0373962_0000409 Ga0373962_0000409_6649_7644 331
290 3300035691 Ga0373931_0020850 Ga0373931_0020850_407_1402 331
291 3300042005 Ga0439448_0025513 Ga0439448_0025513_28_1023 331
292 3300042016 Ga0439463_028313 Ga0439463_028313_387_1382 331
293 3300042439 Ga0439464_0014054 Ga0439464_0014054_958_1953 331
294 3300045051 Ga0451576_0058905 Ga0451576_0058905_1383_2378 331
295 3300048904 Ga0496101_0118117 Ga0496101_0118117_295_1290 331
296 3300048905 Ga0496102_0110070 Ga0496102_0110070_965_1960 331
297 3300048906 Ga0496103_0092071 Ga0496103_0092071_205_1200 331
298 3300048909 Ga0496106_0046270 Ga0496106_0046270_342_1337 331
299 3300048910 Ga0496107_0018653 Ga0496107_0018653_3158_4153 331
300 3300048910 Ga0496107_0249197 Ga0496107_0249197_226_1221 331
301 3300049570 Ga0501033_0020592 Ga0501033_0020592_3214_4293 331
302 3300049584 Ga0501068_0005601 Ga0501068_0005601_3677_4756 331
303 3300049586 Ga0501070_0031140 Ga0501070_0031140_546_1625 331
304 3300050489 nmdc:mga03683_33286_c1 nmdc:mga03683_33286_c1_517_1515 331
305 3300050492 nmdc:mga0yw44_56388_c1 nmdc:mga0yw44_56388_c1_415_1413 331
306 3300050493 nmdc:mga0k408_39815_c1 nmdc:mga0k408_39815_c1_122_1120 331
307 3300050493 nmdc:mga0k408_78503_c1 nmdc:mga0k408_78503_c1_268_1266 331
308 3300050511 nmdc:mga08y16_28547_c1 nmdc:mga08y16_28547_c1_2400_3395 331
309 3300050511 nmdc:mga08y16_8011_c1 nmdc:mga08y16_8011_c1_708_1703 331
310 3300050512 nmdc:mga0n895_157457_c1 nmdc:mga0n895_157457_c1_44_1039 331
311 3300005337 Ga0070682_100035457 Ga0070682_1000354573 332
312 3300005564 Ga0070664_100041115 Ga0070664_1000411152 332
313 3300005614 Ga0068856_100587956 Ga0068856_1005879561 332
314 3300005336 Ga0070680_100000933 Ga0070680_1000009338 333
315 3300005341 Ga0070691_10009000 Ga0070691_100090003 333
316 3300005458 Ga0070681_10157011 Ga0070681_101570112 333
317 3300005530 Ga0070679_100009132 Ga0070679_1000091327 333
318 3300005563 Ga0068855_100295627 Ga0068855_1002956272 333
319 3300009093 Ga0105240_10004752 Ga0105240_1000475212 333
320 3300025913 Ga0207695_10009523 Ga0207695_100095233 333
321 3300025921 Ga0207652_10006590 Ga0207652_100065903 333
322 3300025949 Ga0207667_10007731 Ga0207667_100077318 333
323 3300026116 Ga0207674_10235200 Ga0207674_102352002 333
324 3300035692 Ga0373935_0033212 Ga0373935_0033212_1780_2784 333
325 2209111006 2214800760 2213830111 334
326 3300000042 ARSoilYngRDRAFT_c00057 ARSoilYngRDRAFT_000574 334
327 3300000043 ARcpr5yngRDRAFT_c000673 ARcpr5yngRDRAFT_0006732 334
328 3300000044 ARSoilOldRDRAFT_c000044 ARSoilOldRDRAFT_00004418 334
329 3300000652 ARCol0yngRDRAFT_1000153 ARCol0yngRDRAFT_10001534 334
330 3300005276 Ga0065717_1002193 Ga0065717_10021932 334
331 3300005277 Ga0065716_1001695 Ga0065716_10016952 334
332 3300005289 Ga0065704_10084341 Ga0065704_100843412 334
333 3300005293 Ga0065715_10001318 Ga0065715_100013183 334
334 3300005328 Ga0070676_10113303 Ga0070676_101133031 334
335 3300005329 Ga0070683_100115860 Ga0070683_1001158602 334
336 3300005333 Ga0070677_10020348 Ga0070677_100203482 334
337 3300005333 Ga0070677_10098690 Ga0070677_100986901 334
338 3300005336 Ga0070680_100003206 Ga0070680_1000032066 334
339 3300005336 Ga0070680_100169296 Ga0070680_1001692963 334
340 3300005339 Ga0070660_100267836 Ga0070660_1002678361 334
341 3300005340 Ga0070689_100017381 Ga0070689_1000173813 334
342 3300005341 Ga0070691_10025475 Ga0070691_100254753 334
343 3300005344 Ga0070661_100128324 Ga0070661_1001283242 334
344 3300005347 Ga0070668_100017292 Ga0070668_1000172921 334
345 3300005347 Ga0070668_100136857 Ga0070668_1001368571 334
346 3300005347 Ga0070668_100150793 Ga0070668_1001507931 334
347 3300005353 Ga0070669_100059437 Ga0070669_1000594373 334
348 3300005354 Ga0070675_100296524 Ga0070675_1002965242 334
349 3300005364 Ga0070673_100481900 Ga0070673_1004819001 334
350 3300005365 Ga0070688_100001879 Ga0070688_1000018798 334
351 3300005366 Ga0070659_100023236 Ga0070659_1000232363 334
352 3300005406 Ga0070703_10000746 Ga0070703_100007463 334
353 3300005434 Ga0070709_10188712 Ga0070709_101887122 334
354 3300005436 Ga0070713_100075891 Ga0070713_1000758912 334
355 3300005440 Ga0070705_100000029 Ga0070705_10000002969 334
356 3300005440 Ga0070705_100113402 Ga0070705_1001134022 334
357 3300005441 Ga0070700_100001497 Ga0070700_10000149710 334
358 3300005441 Ga0070700_100015163 Ga0070700_1000151635 334
359 3300005444 Ga0070694_100000652 Ga0070694_10000065214 334
360 3300005445 Ga0070708_100002320 Ga0070708_1000023202 334
361 3300005455 Ga0070663_100008847 Ga0070663_1000088472 334
362 3300005455 Ga0070663_100023132 Ga0070663_1000231322 334
363 3300005456 Ga0070678_100092721 Ga0070678_1000927211 334
364 3300005457 Ga0070662_100003081 Ga0070662_10000308112 334
365 3300005457 Ga0070662_100013722 Ga0070662_1000137223 334
366 3300005458 Ga0070681_10038482 Ga0070681_100384824 334
367 3300005458 Ga0070681_10192388 Ga0070681_101923883 334
368 3300005459 Ga0068867_100017486 Ga0068867_1000174862 334
369 3300005459 Ga0068867_100117012 Ga0068867_1001170123 334
370 3300005467 Ga0070706_100021874 Ga0070706_1000218743 334
371 3300005468 Ga0070707_100135285 Ga0070707_1001352852 334
372 3300005471 Ga0070698_100002091 Ga0070698_10000209123 334
373 3300005507 Ga0074259_11019792 Ga0074259_110197922 334
374 3300005518 Ga0070699_100000947 Ga0070699_10000094724 334
375 3300005518 Ga0070699_100013134 Ga0070699_1000131343 334
376 3300005518 Ga0070699_100207974 Ga0070699_1002079741 334
377 3300005530 Ga0070679_100057578 Ga0070679_1000575782 334
378 3300005536 Ga0070697_100187495 Ga0070697_1001874952 334
379 3300005539 Ga0068853_100083026 Ga0068853_1000830263 334
380 3300005543 Ga0070672_100101954 Ga0070672_1001019543 334
381 3300005545 Ga0070695_100006175 Ga0070695_1000061755 334
382 3300005546 Ga0070696_100001966 Ga0070696_1000019663 334
383 3300005546 Ga0070696_100016707 Ga0070696_1000167075 334
384 3300005546 Ga0070696_100081234 Ga0070696_1000812342 334
385 3300005547 Ga0070693_100097099 Ga0070693_1000970992 334
386 3300005549 Ga0070704_100000624 Ga0070704_1000006247 334
387 3300005549 Ga0070704_100005471 Ga0070704_1000054712 334
388 3300005564 Ga0070664_100015069 Ga0070664_1000150697 334
389 3300005577 Ga0068857_100025254 Ga0068857_1000252543 334
390 3300005578 Ga0068854_100241517 Ga0068854_1002415172 334
391 3300005616 Ga0068852_100414326 Ga0068852_1004143262 334
392 3300005617 Ga0068859_100032215 Ga0068859_1000322154 334
393 3300005617 Ga0068859_100134543 Ga0068859_1001345431 334
394 3300005719 Ga0068861_100107550 Ga0068861_1001075503 334
395 3300005841 Ga0068863_100204759 Ga0068863_1002047592 334
396 3300005843 Ga0068860_100009593 Ga0068860_1000095936 334
397 3300005844 Ga0068862_100000691 Ga0068862_10000069126 334
398 3300005844 Ga0068862_100066585 Ga0068862_1000665851 334
399 3300005983 Ga0081540_1001830 Ga0081540_100183011 334
400 3300006028 Ga0070717_10275687 Ga0070717_102756872 334
401 3300006173 Ga0070716_100079022 Ga0070716_1000790222 334
402 3300006358 Ga0068871_100310511 Ga0068871_1003105112 334
403 3300006871 Ga0075434_100152364 Ga0075434_1001523643 334
404 3300006881 Ga0068865_100148051 Ga0068865_1001480511 334
405 3300006914 Ga0075436_100125947 Ga0075436_1001259472 334
406 3300006931 Ga0097620_100032216 Ga0097620_1000322164 334
407 3300006931 Ga0097620_100134544 Ga0097620_1001345441 334
408 3300009553 Ga0105249_10001774 Ga0105249_100017748 334
409 3300012481 Ga0157320_1000654 Ga0157320_10006541 334
410 3300012507 Ga0157342_1000297 Ga0157342_10002972 334
411 3300012515 Ga0157338_1000224 Ga0157338_10002242 334
412 3300013105 Ga0157369_10051616 Ga0157369_100516165 334
413 3300013307 Ga0157372_10043914 Ga0157372_100439143 334
414 3300013308 Ga0157375_10022576 Ga0157375_100225762 334
415 3300017792 Ga0163161_10003601 Ga0163161_1000360112 334
416 3300025271 Ga0207666_1000497 Ga0207666_10004972 334
417 3300025297 Ga0209758_1001507 Ga0209758_100150716 334
418 3300025315 Ga0207697_10021107 Ga0207697_100211073 334
419 3300025901 Ga0207688_10046379 Ga0207688_100463792 334
420 3300025901 Ga0207688_10078506 Ga0207688_100785062 334
421 3300025904 Ga0207647_10008867 Ga0207647_100088677 334
422 3300025907 Ga0207645_10058475 Ga0207645_100584751 334
423 3300025910 Ga0207684_10025016 Ga0207684_100250163 334
424 3300025910 Ga0207684_10063778 Ga0207684_100637782 334
425 3300025910 Ga0207684_10141231 Ga0207684_101412313 334
426 3300025917 Ga0207660_10009390 Ga0207660_100093904 334
427 3300025917 Ga0207660_10069481 Ga0207660_100694813 334
428 3300025918 Ga0207662_10026368 Ga0207662_100263682 334
429 3300025919 Ga0207657_10058340 Ga0207657_100583402 334
430 3300025919 Ga0207657_10177378 Ga0207657_101773782 334
431 3300025920 Ga0207649_10070306 Ga0207649_100703062 334
432 3300025921 Ga0207652_10041610 Ga0207652_100416103 334
433 3300025921 Ga0207652_10115192 Ga0207652_101151922 334
434 3300025923 Ga0207681_10015114 Ga0207681_100151142 334
435 3300025923 Ga0207681_10229423 Ga0207681_102294232 334
436 3300025928 Ga0207700_10264924 Ga0207700_102649242 334
437 3300025932 Ga0207690_10008048 Ga0207690_100080481 334
438 3300025933 Ga0207706_10009628 Ga0207706_100096286 334
439 3300025933 Ga0207706_10026463 Ga0207706_100264632 334
440 3300025935 Ga0207709_10164511 Ga0207709_101645111 334
441 3300025936 Ga0207670_10023433 Ga0207670_100234333 334
442 3300025938 Ga0207704_10069375 Ga0207704_100693753 334
443 3300025940 Ga0207691_10088334 Ga0207691_100883343 334
444 3300025944 Ga0207661_10125311 Ga0207661_101253112 334
445 3300025945 Ga0207679_10007601 Ga0207679_100076012 334
446 3300025961 Ga0207712_10025372 Ga0207712_100253723 334
447 3300025972 Ga0207668_10018538 Ga0207668_100185382 334
448 3300025972 Ga0207668_10311279 Ga0207668_103112791 334
449 3300026035 Ga0207703_10378494 Ga0207703_103784941 334
450 3300026041 Ga0207639_10045997 Ga0207639_100459972 334
451 3300026067 Ga0207678_10003426 Ga0207678_1000342610 334
452 3300026067 Ga0207678_10021702 Ga0207678_100217022 334
453 3300026067 Ga0207678_10186960 Ga0207678_101869602 334
454 3300026075 Ga0207708_10005456 Ga0207708_100054563 334
455 3300026075 Ga0207708_10005844 Ga0207708_100058449 334
456 3300026075 Ga0207708_10007962 Ga0207708_100079628 334
457 3300026088 Ga0207641_10174243 Ga0207641_101742432 334
458 3300026089 Ga0207648_10052305 Ga0207648_100523052 334
459 3300026116 Ga0207674_10009358 Ga0207674_100093583 334
460 3300026116 Ga0207674_10082438 Ga0207674_100824382 334
461 3300026118 Ga0207675_100056667 Ga0207675_1000566673 334
462 3300026118 Ga0207675_100066051 Ga0207675_1000660512 334
463 3300026121 Ga0207683_10021746 Ga0207683_100217462 334
464 3300026121 Ga0207683_10179745 Ga0207683_101797452 334
465 3300026142 Ga0207698_10049585 Ga0207698_100495852 334
466 3300027695 Ga0209966_1001307 Ga0209966_10013072 334
467 3300027717 Ga0209998_10001451 Ga0209998_100014517 334
468 3300027717 Ga0209998_10003218 Ga0209998_100032183 334
469 3300027876 Ga0209974_10018298 Ga0209974_100182982 334
470 3300027876 Ga0209974_10021058 Ga0209974_100210582 334
471 3300027907 Ga0207428_10000255 Ga0207428_1000025559 334
472 3300027907 Ga0207428_10050828 Ga0207428_100508282 334
473 3300028380 Ga0268265_10003089 Ga0268265_100030897 334
474 3300028381 Ga0268264_10003127 Ga0268264_100031274 334
475 3300031238 Ga0265332_10025356 Ga0265332_100253562 334
476 3300031241 Ga0265325_10000708 Ga0265325_1000070811 334
477 3300031595 Ga0265313_10009620 Ga0265313_100096203 334
478 3300031911 Ga0307412_10175021 Ga0307412_101750211 334
479 3300031995 Ga0307409_100263115 Ga0307409_1002631151 334
480 3300032005 Ga0307411_10314804 Ga0307411_103148041 334
481 3300035111 Ga0373923_0010688 Ga0373923_0010688_606_1613 334
482 3300035113 Ga0373936_0001591 Ga0373936_0001591_1922_2929 334
483 3300035113 Ga0373936_0004284 Ga0373936_0004284_3290_4297 334
484 3300035117 Ga0373953_0022944 Ga0373953_0022944_1330_2337 334
485 3300035118 Ga0373954_0020778 Ga0373954_0020778_1588_2595 334
486 3300035170 Ga0373943_0001108 Ga0373943_0001108_3227_4234 334
487 3300035171 Ga0373946_0001186 Ga0373946_0001186_4162_5169 334
488 3300035172 Ga0373955_0008613 Ga0373955_0008613_2339_3346 334
489 3300035410 Ga0373924_0014055 Ga0373924_0014055_1266_2273 334
490 3300035692 Ga0373935_0003508 Ga0373935_0003508_3955_4962 334
491 3300035695 Ga0373927_0002017 Ga0373927_0002017_4162_5169 334
492 3300035724 Ga0373933_0022312 Ga0373933_0022312_460_1467 334
493 3300035725 Ga0373947_0016168 Ga0373947_0016168_2592_3599 334
494 3300036401 Ga0373937_0215916 Ga0373937_0215916_787_1794 334
495 3300036401 Ga0373937_0455248 Ga0373937_0455248_169_1179 334
496 3300037068 Ga0373925_0004980 Ga0373925_0004980_4805_5812 334
497 3300041509 Ga0451843_0100024 Ga0451843_0100024_305_1312 334
498 3300046454 Ga0495592_0006155 Ga0495592_0006155_1470_2477 334
499 3300046459 Ga0495629_0005121 Ga0495629_0005121_6393_7400 334
500 3300046461 Ga0495641_0003638 Ga0495641_0003638_8605_9612 334
501 3300046461 Ga0495641_0089976 Ga0495641_0089976_319_1326 334
502 3300046462 Ga0495651_0002175 Ga0495651_0002175_7404_8411 334
503 3300046463 Ga0495653_0002883 Ga0495653_0002883_4932_5939 334
504 3300046463 Ga0495653_0045259 Ga0495653_0045259_1363_2370 334
505 3300046472 Ga0495580_0012164 Ga0495580_0012164_990_1997 334
506 3300046473 Ga0495582_0002391 Ga0495582_0002391_5836_6843 334
507 3300046475 Ga0495639_0000713 Ga0495639_0000713_4230_5237 334
508 3300046476 Ga0495662_0000084 Ga0495662_0000084_4134_5141 334
509 3300046477 Ga0495664_0000482 Ga0495664_0000482_16721_17728 334
510 3300046477 Ga0495664_0059591 Ga0495664_0059591_189_1196 334
511 3300046492 Ga0495585_0032653 Ga0495585_0032653_424_1431 334
512 3300046499 Ga0495594_0008249 Ga0495594_0008249_1763_2770 334
513 3300046514 Ga0495618_0004433 Ga0495618_0004433_5037_6044 334
514 3300046516 Ga0495628_0007423 Ga0495628_0007423_6408_7415 334
515 3300046516 Ga0495628_0018284 Ga0495628_0018284_743_1750 334
516 3300046517 Ga0495630_0001951 Ga0495630_0001951_1979_2986 334
517 3300046517 Ga0495630_0006736 Ga0495630_0006736_2720_3727 334
518 3300046517 Ga0495630_0129648 Ga0495630_0129648_425_1432 334
519 3300046519 Ga0495632_0056324 Ga0495632_0056324_883_1890 334
520 3300046526 Ga0495666_0004463 Ga0495666_0004463_2617_3624 334
521 3300046529 Ga0495652_0007683 Ga0495652_0007683_6393_7400 334
522 3300046531 Ga0495665_0002359 Ga0495665_0002359_1608_2615 334
523 3300046531 Ga0495665_0024936 Ga0495665_0024936_1611_2618 334
524 3300046533 Ga0495640_0007345 Ga0495640_0007345_4945_5952 334
525 3300046533 Ga0495640_0043685 Ga0495640_0043685_1823_2830 334
526 3300046536 Ga0495587_0010083 Ga0495587_0010083_3941_4948 334
527 3300046543 Ga0495645_0046268 Ga0495645_0046268_220_1227 334
528 3300046557 Ga0495622_0069760 Ga0495622_0069760_543_1550 334
529 3300046558 Ga0495633_0035702 Ga0495633_0035702_83_1090 334
530 3300046559 Ga0495667_0000202 Ga0495667_0000202_9028_10035 334
531 3300046559 Ga0495667_0035082 Ga0495667_0035082_1020_2027 334
532 3300046559 Ga0495667_0086742 Ga0495667_0086742_541_1548 334
533 3300046615 Ga0495656_0105891 Ga0495656_0105891_196_1203 334
534 3300046642 Ga0495634_0005317 Ga0495634_0005317_6521_7528 334
535 3300046660 Ga0495625_0035683 Ga0495625_0035683_460_1467 334
536 3300046660 Ga0495625_0037749 Ga0495625_0037749_440_1447 334
537 3300046663 Ga0495635_0000399 Ga0495635_0000399_7449_8456 334
538 3300046675 Ga0495657_0001733 Ga0495657_0001733_2859_3866 334
539 3300046678 Ga0495599_0004717 Ga0495599_0004717_4049_5056 334
540 3300046680 Ga0495646_0003722 Ga0495646_0003722_8316_9323 334
541 3300046681 Ga0495647_0004315 Ga0495647_0004315_1534_2541 334
542 3300046683 Ga0495658_0008581 Ga0495658_0008581_1534_2541 334
543 3300046689 Ga0495613_0001462 Ga0495613_0001462_11262_12269 334
544 3300046689 Ga0495613_0008236 Ga0495613_0008236_6036_7043 334
545 3300046690 Ga0495624_0000222 Ga0495624_0000222_34274_35281 334
546 3300046690 Ga0495624_0041636 Ga0495624_0041636_1057_2064 334
547 3300046691 Ga0495670_0000837 Ga0495670_0000837_1614_2621 334
548 3300046809 Ga0495600_0002124 Ga0495600_0002124_1202_2209 334
549 3300046809 Ga0495600_0003235 Ga0495600_0003235_5938_6945 334
550 3300047315 Ga0495581_0000145 Ga0495581_0000145_21673_22680 334
551 3300047317 Ga0495604_0005816 Ga0495604_0005816_5589_6596 334
552 3300047317 Ga0495604_0086560 Ga0495604_0086560_509_1516 334
553 3300047319 Ga0495674_0007404 Ga0495674_0007404_4134_5141 334
554 3300047319 Ga0495674_0015727 Ga0495674_0015727_1915_2922 334
555 3300047321 Ga0495676_0020974 Ga0495676_0020974_550_1557 334
556 3300047322 Ga0495680_0001864 Ga0495680_0001864_11629_12636 334
557 3300047471 Ga0495684_0000075 Ga0495684_0000075_33247_34254 334
558 3300047673 Ga0495593_0000228 Ga0495593_0000228_25162_26169 334
559 3300048905 Ga0496102_0004792 Ga0496102_0004792_5533_6654 334
560 3300048907 Ga0496104_0000061 Ga0496104_0000061_106930_107934 334
561 3300048909 Ga0496106_0000300 Ga0496106_0000300_3055_4176 334
562 3300048910 Ga0496107_0002193 Ga0496107_0002193_9366_10487 334
563 3300048918 Ga0496115_0051521 Ga0496115_0051521_235_1239 334
564 3300050507 nmdc:mga05p37_208054_c1 nmdc:mga05p37_208054_c1_930_1937 334
565 3300053077 Ga0495601_0010704 Ga0495601_0010704_818_1825 334
566 3300053078 Ga0495612_0001242 Ga0495612_0001242_3931_4938 334
567 3300053078 Ga0495612_0063252 Ga0495612_0063252_324_1331 334
568 3300053084 Ga0495595_0000988 Ga0495595_0000988_4365_5372 334
569 3300053084 Ga0495595_0013080 Ga0495595_0013080_1413_2420 334
570 3300053085 Ga0495619_0001117 Ga0495619_0001117_8756_9763 334
571 3300053085 Ga0495619_0043241 Ga0495619_0043241_747_1754 334
572 3300053087 Ga0500643_000795 Ga0500643_000795_8481_9488 334
573 3300053093 Ga0500651_0014672 Ga0500651_0014672_1938_2945 334
574 3300053094 Ga0500566_0127711 Ga0500566_0127711_43_1050 334
575 3300053119 Ga0500595_000001 Ga0500595_000001_326650_327657 334
576 3300053151 Ga0500604_0043800 Ga0500604_0043800_274_1281 334
577 3300053178 Ga0500637_0030651 Ga0500637_0030651_1731_2741 334
578 3300053730 Ga0500645_000015 Ga0500645_000015_143213_144220 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

73

357

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pfr-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered 0.9115 88 334
4pfr-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered 0.9077 88 334
4pfi-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from marinobacter aquaeolei vt8 (maqu_2829, target efi-510133), apo open structure 0.9064 30 330
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.9014 27 333
4ng7-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899), target efi-510094, apo, open structure 0.9003 33 331
ID Description Score Start End Superfamily
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9013 27 333 3.40.190.170
4ng7A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9003 33 331 3.40.190.170
4pfiA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8999 30 330 3.40.190.170
4pfiA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8914 30 330 3.40.190.170
4pfrA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8913 31 334 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A416Z4W9-F1-model_v4 deleted 0.9458 29 334
AF-A0A373PRQ1-F1-model_v4 deleted 0.9201 110 331
AF-A0A841PW79-F1-model_v4 Tripartite ATP-independent transporter DctP family solute receptor 0.9108 28 331 GO:0030288
GO:0055085
AF-A0A6P5P1F9-F1-model_v4 deleted 0.91 72 331
AF-A0A101W8W5-F1-model_v4 C4-dicarboxylate ABC transporter 0.909 27 333 GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.27 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map