F465698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 342 | 577 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300005406|Ga0070703_10000746|Ga0070703_100007463 |
| Length | 373 |
| Sequence | MAAHLVYKEILGDSEMRQAQVLGQWPAPRGGGDGEDWTMLISRHARRTAAILFGLGVALTSTAAIGQKREFSFAYDQPKNSGYGVGADIFSKKLVELSKGTLSINQYPSAQLGTEAQTMQKVQTGDIDFVMLSTANASTAQPESGVFSLHFIFRDEAHAIKVLGDPSVIAAMKDLYAAKIKGAHMLALGSQGLRHMYGKKAVQKLADIKGAKMRVQATVTEDTLFPAYGAQVVHMPFGEVYTSLQTGVVDMAENGINNYLINKHYEPAPVLSLTEHEANNAALFVSDKVWQSLSAEQKGWVQAAADEISRNEPAAAFMLEHEALAKLQKIGVKIVRDVDKSGFQSVSKPIQDKLAKDLGPNAVKVLGLVRNVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 10 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 107 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 229 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 232 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 233 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 336 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 92.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214800760 | 2209111006 | Bacteria | 10890 |
| 2 | ARSoilYngRDRAFT_c00057 | 3300000042 | Bacteria | 18462 |
| 3 | ARcpr5yngRDRAFT_c000673 | 3300000043 | Bacteria | 4250 |
| 4 | ARSoilOldRDRAFT_c000044 | 3300000044 | Bacteria | 26451 |
| 5 | ARCol0yngRDRAFT_1000153 | 3300000652 | Bacteria | 12275 |
| 6 | JGI25406J46586_10000826 | 3300003203 | Bacteria | 14573 |
| 7 | JGI25405J52794_10001935 | 3300003911 | Bacteria | 3505 |
| 8 | Ga0065717_1002193 | 3300005276 | Bacteria | 2535 |
| 9 | Ga0065716_1001695 | 3300005277 | Bacteria | 4115 |
| 10 | Ga0065704_10084341 | 3300005289 | Bacteria | 3345 |
| 11 | Ga0065712_10071542 | 3300005290 | Bacteria | 5192 |
| 12 | Ga0065715_10001318 | 3300005293 | Bacteria | 10293 |
| 13 | Ga0065715_10144991 | 3300005293 | Bacteria | 1800 |
| 14 | Ga0070658_10035834 | 3300005327 | Bacteria | 3997 |
| 15 | Ga0070658_10123637 | 3300005327 | Bacteria | 2152 |
| 16 | Ga0070676_10113303 | 3300005328 | Bacteria | 1692 |
| 17 | Ga0070683_100078518 | 3300005329 | Bacteria | 3088 |
| 18 | Ga0070683_100115860 | 3300005329 | Bacteria | 2530 |
| 19 | Ga0070690_100022947 | 3300005330 | Bacteria | 3823 |
| 20 | Ga0070670_100070304 | 3300005331 | Bacteria | 3005 |
| 21 | Ga0070670_100309827 | 3300005331 | Bacteria | 1382 |
| 22 | Ga0070677_10020348 | 3300005333 | Bacteria | 2417 |
| 23 | Ga0070677_10098690 | 3300005333 | Bacteria | 1284 |
| 24 | Ga0068869_100000039 | 3300005334 | Bacteria | 54386 |
| 25 | Ga0068869_100144735 | 3300005334 | Bacteria | 1838 |
| 26 | Ga0070680_100000933 | 3300005336 | Bacteria | 20696 |
| 27 | Ga0070680_100003206 | 3300005336 | Bacteria | 12165 |
| 28 | Ga0070680_100169296 | 3300005336 | Bacteria | 1838 |
| 29 | Ga0070682_100035457 | 3300005337 | Bacteria | 3046 |
| 30 | Ga0070660_100014143 | 3300005339 | Bacteria | 5745 |
| 31 | Ga0070660_100027333 | 3300005339 | Bacteria | 4257 |
| 32 | Ga0070660_100267836 | 3300005339 | Bacteria | 1396 |
| 33 | Ga0070689_100017381 | 3300005340 | Bacteria | 5281 |
| 34 | Ga0070689_100150147 | 3300005340 | Bacteria | 1879 |
| 35 | Ga0070691_10009000 | 3300005341 | Bacteria | 4567 |
| 36 | Ga0070691_10025475 | 3300005341 | Bacteria | 2754 |
| 37 | Ga0070687_100049318 | 3300005343 | Bacteria | 2169 |
| 38 | Ga0070687_100166548 | 3300005343 | Bacteria | 1308 |
| 39 | Ga0070687_100194776 | 3300005343 | Bacteria | 1224 |
| 40 | Ga0070661_100055552 | 3300005344 | Bacteria | 2899 |
| 41 | Ga0070661_100128324 | 3300005344 | Bacteria | 1903 |
| 42 | Ga0070692_10030076 | 3300005345 | Bacteria | 2713 |
| 43 | Ga0070668_100017292 | 3300005347 | Bacteria | 5399 |
| 44 | Ga0070668_100042788 | 3300005347 | Bacteria | 3472 |
| 45 | Ga0070668_100136857 | 3300005347 | Bacteria | 1971 |
| 46 | Ga0070668_100150793 | 3300005347 | Bacteria | 1880 |
| 47 | Ga0070669_100059437 | 3300005353 | Bacteria | 2807 |
| 48 | Ga0070675_100296524 | 3300005354 | Bacteria | 1424 |
| 49 | Ga0070673_100481900 | 3300005364 | Bacteria | 1120 |
| 50 | Ga0070688_100001879 | 3300005365 | Bacteria | 10522 |
| 51 | Ga0070659_100009187 | 3300005366 | Bacteria | 7254 |
| 52 | Ga0070659_100023236 | 3300005366 | Bacteria | 4742 |
| 53 | Ga0070667_100000488 | 3300005367 | Bacteria | 40240 |
| 54 | Ga0070667_100102127 | 3300005367 | Bacteria | 2477 |
| 55 | Ga0070703_10000746 | 3300005406 | Bacteria | 10858 |
| 56 | Ga0070709_10017300 | 3300005434 | Bacteria | 4133 |
| 57 | Ga0070709_10188712 | 3300005434 | Bacteria | 1452 |
| 58 | Ga0070709_10258273 | 3300005434 | Bacteria | 1258 |
| 59 | Ga0070714_100018028 | 3300005435 | Bacteria | 5727 |
| 60 | Ga0070714_100076575 | 3300005435 | Bacteria | 2904 |
| 61 | Ga0070714_100110567 | 3300005435 | Bacteria | 2433 |
| 62 | Ga0070713_100075891 | 3300005436 | Bacteria | 2852 |
| 63 | Ga0070711_100058899 | 3300005439 | Bacteria | 2665 |
| 64 | Ga0070705_100000029 | 3300005440 | Bacteria | 74892 |
| 65 | Ga0070705_100038253 | 3300005440 | Bacteria | 2713 |
| 66 | Ga0070705_100113402 | 3300005440 | Bacteria | 1737 |
| 67 | Ga0070700_100001497 | 3300005441 | Bacteria | 11629 |
| 68 | Ga0070700_100015163 | 3300005441 | Bacteria | 4364 |
| 69 | Ga0070694_100000652 | 3300005444 | Bacteria | 19181 |
| 70 | Ga0070708_100002320 | 3300005445 | Bacteria | 14723 |
| 71 | Ga0070663_100008847 | 3300005455 | Bacteria | 6213 |
| 72 | Ga0070663_100023132 | 3300005455 | Bacteria | 4162 |
| 73 | Ga0070678_100006921 | 3300005456 | Bacteria | 6689 |
| 74 | Ga0070678_100092721 | 3300005456 | Bacteria | 2321 |
| 75 | Ga0070662_100003081 | 3300005457 | Bacteria | 10344 |
| 76 | Ga0070662_100013722 | 3300005457 | Bacteria | 5395 |
| 77 | Ga0070681_10038482 | 3300005458 | Bacteria | 4796 |
| 78 | Ga0070681_10115718 | 3300005458 | Bacteria | 2619 |
| 79 | Ga0070681_10157011 | 3300005458 | Bacteria | 2199 |
| 80 | Ga0070681_10192388 | 3300005458 | Bacteria | 1960 |
| 81 | Ga0070681_10219770 | 3300005458 | Bacteria | 1815 |
| 82 | Ga0068867_100002184 | 3300005459 | Bacteria | 13734 |
| 83 | Ga0068867_100017486 | 3300005459 | Bacteria | 5093 |
| 84 | Ga0068867_100117012 | 3300005459 | Bacteria | 2055 |
| 85 | Ga0070706_100021874 | 3300005467 | Bacteria | 5889 |
| 86 | Ga0070707_100135285 | 3300005468 | Bacteria | 2398 |
| 87 | Ga0070698_100002091 | 3300005471 | Bacteria | 22152 |
| 88 | Ga0070698_100177985 | 3300005471 | Bacteria | 2065 |
| 89 | Ga0070698_100182302 | 3300005471 | Bacteria | 2038 |
| 90 | Ga0074259_11019792 | 3300005507 | Bacteria | 3086 |
| 91 | Ga0070699_100000947 | 3300005518 | Bacteria | 27076 |
| 92 | Ga0070699_100013134 | 3300005518 | Bacteria | 7140 |
| 93 | Ga0070699_100207974 | 3300005518 | Bacteria | 1741 |
| 94 | Ga0070679_100009132 | 3300005530 | Bacteria | 9359 |
| 95 | Ga0070679_100022933 | 3300005530 | Bacteria | 6105 |
| 96 | Ga0070679_100057578 | 3300005530 | Bacteria | 3874 |
| 97 | Ga0070679_100122680 | 3300005530 | Bacteria | 2582 |
| 98 | Ga0070684_100010266 | 3300005535 | Bacteria | 7412 |
| 99 | Ga0070697_100187495 | 3300005536 | Bacteria | 1755 |
| 100 | Ga0068853_100015534 | 3300005539 | Bacteria | 6254 |
| 101 | Ga0068853_100083026 | 3300005539 | Bacteria | 2807 |
| 102 | Ga0070672_100101954 | 3300005543 | Bacteria | 2329 |
| 103 | Ga0070686_100053084 | 3300005544 | Bacteria | 2586 |
| 104 | Ga0070695_100006175 | 3300005545 | Bacteria | 7080 |
| 105 | Ga0070696_100001966 | 3300005546 | Bacteria | 13495 |
| 106 | Ga0070696_100004759 | 3300005546 | Bacteria | 9065 |
| 107 | Ga0070696_100016707 | 3300005546 | Bacteria | 4949 |
| 108 | Ga0070696_100081234 | 3300005546 | Bacteria | 2296 |
| 109 | Ga0070693_100097099 | 3300005547 | Bacteria | 1788 |
| 110 | Ga0070704_100000624 | 3300005549 | Bacteria | 17082 |
| 111 | Ga0070704_100005471 | 3300005549 | Bacteria | 7401 |
| 112 | Ga0068855_100219987 | 3300005563 | Bacteria | 2130 |
| 113 | Ga0068855_100295627 | 3300005563 | Bacteria | 1794 |
| 114 | Ga0070664_100015069 | 3300005564 | Bacteria | 6312 |
| 115 | Ga0070664_100023513 | 3300005564 | Bacteria | 5092 |
| 116 | Ga0070664_100041115 | 3300005564 | Bacteria | 3900 |
| 117 | Ga0068857_100025254 | 3300005577 | Bacteria | 5232 |
| 118 | Ga0068854_100241517 | 3300005578 | Bacteria | 1438 |
| 119 | Ga0068856_100033873 | 3300005614 | Bacteria | 5002 |
| 120 | Ga0068856_100309998 | 3300005614 | Bacteria | 1596 |
| 121 | Ga0068856_100587956 | 3300005614 | Bacteria | 1134 |
| 122 | Ga0070702_100046999 | 3300005615 | Bacteria | 2449 |
| 123 | Ga0068852_100414326 | 3300005616 | Bacteria | 1328 |
| 124 | Ga0068859_100000189 | 3300005617 | Bacteria | 59789 |
| 125 | Ga0068859_100032215 | 3300005617 | Bacteria | 5266 |
| 126 | Ga0068859_100134543 | 3300005617 | Bacteria | 2544 |
| 127 | Ga0068864_100000192 | 3300005618 | Bacteria | 55904 |
| 128 | Ga0068861_100011083 | 3300005719 | Bacteria | 6263 |
| 129 | Ga0068861_100107550 | 3300005719 | Bacteria | 2230 |
| 130 | Ga0068851_10002769 | 3300005834 | Bacteria | 7726 |
| 131 | Ga0068863_100012588 | 3300005841 | Bacteria | 8160 |
| 132 | Ga0068863_100181101 | 3300005841 | Bacteria | 2022 |
| 133 | Ga0068863_100204759 | 3300005841 | Bacteria | 1899 |
| 134 | Ga0068863_100328025 | 3300005841 | Bacteria | 1488 |
| 135 | Ga0068858_100022002 | 3300005842 | Bacteria | 5955 |
| 136 | Ga0068858_100114748 | 3300005842 | Bacteria | 2517 |
| 137 | Ga0068860_100000350 | 3300005843 | Bacteria | 62017 |
| 138 | Ga0068860_100009593 | 3300005843 | Bacteria | 9619 |
| 139 | Ga0068862_100000691 | 3300005844 | Bacteria | 34469 |
| 140 | Ga0068862_100048145 | 3300005844 | Bacteria | 3639 |
| 141 | Ga0068862_100057387 | 3300005844 | Bacteria | 3339 |
| 142 | Ga0068862_100066585 | 3300005844 | Bacteria | 3104 |
| 143 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 144 | Ga0081455_10034958 | 3300005937 | Bacteria | 4497 |
| 145 | Ga0081455_10097858 | 3300005937 | Bacteria | 2363 |
| 146 | Ga0081455_10135784 | 3300005937 | Bacteria | 1917 |
| 147 | Ga0081540_1001830 | 3300005983 | Bacteria | 17860 |
| 148 | Ga0081539_10002294 | 3300005985 | Bacteria | 27712 |
| 149 | Ga0070717_10275687 | 3300006028 | Bacteria | 1490 |
| 150 | Ga0075364_10028110 | 3300006051 | Bacteria | 3598 |
| 151 | Ga0070716_100079022 | 3300006173 | Bacteria | 1958 |
| 152 | Ga0075366_10083127 | 3300006195 | Bacteria | 1913 |
| 153 | Ga0097621_100001440 | 3300006237 | Bacteria | 16328 |
| 154 | Ga0075370_10013741 | 3300006353 | Bacteria | 4309 |
| 155 | Ga0068871_100002792 | 3300006358 | Bacteria | 11935 |
| 156 | Ga0068871_100310511 | 3300006358 | Bacteria | 1386 |
| 157 | Ga0075434_100152364 | 3300006871 | Bacteria | 2332 |
| 158 | Ga0068865_100148051 | 3300006881 | Bacteria | 1778 |
| 159 | Ga0075436_100057054 | 3300006914 | Bacteria | 2697 |
| 160 | Ga0075436_100125947 | 3300006914 | Bacteria | 1795 |
| 161 | Ga0097620_100000189 | 3300006931 | Bacteria | 59789 |
| 162 | Ga0097620_100032216 | 3300006931 | Bacteria | 5266 |
| 163 | Ga0097620_100134544 | 3300006931 | Bacteria | 2544 |
| 164 | Ga0075435_100002930 | 3300007076 | Bacteria | 11463 |
| 165 | Ga0105251_10065994 | 3300009011 | Bacteria | 1693 |
| 166 | Ga0105240_10004752 | 3300009093 | Bacteria | 20518 |
| 167 | Ga0105240_10025445 | 3300009093 | Bacteria | 7776 |
| 168 | Ga0105240_10079097 | 3300009093 | Bacteria | 4047 |
| 169 | Ga0111539_10000114 | 3300009094 | Bacteria | 88757 |
| 170 | Ga0111539_10011997 | 3300009094 | Bacteria | 10864 |
| 171 | Ga0111539_10416843 | 3300009094 | Bacteria | 1564 |
| 172 | Ga0105247_10017646 | 3300009101 | Bacteria | 4280 |
| 173 | Ga0114129_10733661 | 3300009147 | Bacteria | 1266 |
| 174 | Ga0105243_10026263 | 3300009148 | Bacteria | 4457 |
| 175 | Ga0105242_10455801 | 3300009176 | Bacteria | 1207 |
| 176 | Ga0105248_10013370 | 3300009177 | Bacteria | 9034 |
| 177 | Ga0105248_10131270 | 3300009177 | Bacteria | 2826 |
| 178 | Ga0105238_10021202 | 3300009551 | Bacteria | 6623 |
| 179 | Ga0105249_10001774 | 3300009553 | Bacteria | 18804 |
| 180 | Ga0105249_10170477 | 3300009553 | Bacteria | 2110 |
| 181 | Ga0105239_10053091 | 3300010375 | Bacteria | 4446 |
| 182 | Ga0105239_10180994 | 3300010375 | Bacteria | 2358 |
| 183 | Ga0157320_1000654 | 3300012481 | Bacteria | 1502 |
| 184 | Ga0157342_1000297 | 3300012507 | Bacteria | 2801 |
| 185 | Ga0157338_1000224 | 3300012515 | Bacteria | 2975 |
| 186 | Ga0157371_10008859 | 3300013102 | Bacteria | 7969 |
| 187 | Ga0157370_10010239 | 3300013104 | Bacteria | 9901 |
| 188 | Ga0157369_10051616 | 3300013105 | Bacteria | 4450 |
| 189 | Ga0157369_10117912 | 3300013105 | Bacteria | 2818 |
| 190 | Ga0157378_10242284 | 3300013297 | Bacteria | 1723 |
| 191 | Ga0157372_10043914 | 3300013307 | Bacteria | 4951 |
| 192 | Ga0157372_10086413 | 3300013307 | Bacteria | 3558 |
| 193 | Ga0157372_10222015 | 3300013307 | Bacteria | 2190 |
| 194 | Ga0157372_10266014 | 3300013307 | Bacteria | 1991 |
| 195 | Ga0157375_10022576 | 3300013308 | Bacteria | 5793 |
| 196 | Ga0163163_10005846 | 3300014325 | Bacteria | 10702 |
| 197 | Ga0157380_10061308 | 3300014326 | Bacteria | 3009 |
| 198 | Ga0157377_10085370 | 3300014745 | Bacteria | 1853 |
| 199 | Ga0157379_10000028 | 3300014968 | Bacteria | 86433 |
| 200 | Ga0157379_10011943 | 3300014968 | Bacteria | 7588 |
| 201 | Ga0157376_10020495 | 3300014969 | Bacteria | 5115 |
| 202 | Ga0163161_10003601 | 3300017792 | Bacteria | 10864 |
| 203 | Ga0213872_10069800 | 3300021361 | Bacteria | 1585 |
| 204 | Ga0213875_10048223 | 3300021388 | Bacteria | 1998 |
| 205 | Ga0207666_1000497 | 3300025271 | Bacteria | 4888 |
| 206 | Ga0209758_1001507 | 3300025297 | Bacteria | 27061 |
| 207 | Ga0207697_10021107 | 3300025315 | Bacteria | 2667 |
| 208 | Ga0207692_10013091 | 3300025898 | Bacteria | 3589 |
| 209 | Ga0207688_10046379 | 3300025901 | Bacteria | 2426 |
| 210 | Ga0207688_10078506 | 3300025901 | Bacteria | 1882 |
| 211 | Ga0207647_10008867 | 3300025904 | Bacteria | 7175 |
| 212 | Ga0207699_10015906 | 3300025906 | Bacteria | 3922 |
| 213 | Ga0207699_10025985 | 3300025906 | Bacteria | 3222 |
| 214 | Ga0207699_10054214 | 3300025906 | Bacteria | 2381 |
| 215 | Ga0207645_10058475 | 3300025907 | Bacteria | 2461 |
| 216 | Ga0207645_10087504 | 3300025907 | Bacteria | 2002 |
| 217 | Ga0207705_10019721 | 3300025909 | Bacteria | 4822 |
| 218 | Ga0207705_10110771 | 3300025909 | Bacteria | 2028 |
| 219 | Ga0207684_10025016 | 3300025910 | Bacteria | 5088 |
| 220 | Ga0207684_10063778 | 3300025910 | Bacteria | 3128 |
| 221 | Ga0207684_10141231 | 3300025910 | Bacteria | 2070 |
| 222 | Ga0207707_10007786 | 3300025912 | Bacteria | 9326 |
| 223 | Ga0207695_10009523 | 3300025913 | Bacteria | 12011 |
| 224 | Ga0207695_10018499 | 3300025913 | Bacteria | 8053 |
| 225 | Ga0207693_10072881 | 3300025915 | Bacteria | 2689 |
| 226 | Ga0207663_10003419 | 3300025916 | Bacteria | 7766 |
| 227 | Ga0207663_10127849 | 3300025916 | Bacteria | 1751 |
| 228 | Ga0207660_10009390 | 3300025917 | Bacteria | 6332 |
| 229 | Ga0207660_10020459 | 3300025917 | Bacteria | 4441 |
| 230 | Ga0207660_10069481 | 3300025917 | Bacteria | 2558 |
| 231 | Ga0207662_10026368 | 3300025918 | Bacteria | 3352 |
| 232 | Ga0207662_10091333 | 3300025918 | Bacteria | 1873 |
| 233 | Ga0207662_10126359 | 3300025918 | Bacteria | 1608 |
| 234 | Ga0207662_10195291 | 3300025918 | Bacteria | 1307 |
| 235 | Ga0207657_10000213 | 3300025919 | Bacteria | 60310 |
| 236 | Ga0207657_10015476 | 3300025919 | Bacteria | 7389 |
| 237 | Ga0207657_10058340 | 3300025919 | Bacteria | 3322 |
| 238 | Ga0207657_10177378 | 3300025919 | Bacteria | 1724 |
| 239 | Ga0207649_10025487 | 3300025920 | Bacteria | 3447 |
| 240 | Ga0207649_10070306 | 3300025920 | Bacteria | 2232 |
| 241 | Ga0207652_10006590 | 3300025921 | Bacteria | 9362 |
| 242 | Ga0207652_10039490 | 3300025921 | Bacteria | 4005 |
| 243 | Ga0207652_10041610 | 3300025921 | Bacteria | 3907 |
| 244 | Ga0207652_10096003 | 3300025921 | Bacteria | 2611 |
| 245 | Ga0207652_10115192 | 3300025921 | Unclassified | 2388 |
| 246 | Ga0207681_10015114 | 3300025923 | Bacteria | 4813 |
| 247 | Ga0207681_10229423 | 3300025923 | Bacteria | 1440 |
| 248 | Ga0207694_10024491 | 3300025924 | Bacteria | 4584 |
| 249 | Ga0207694_10059169 | 3300025924 | Bacteria | 2980 |
| 250 | Ga0207650_10030156 | 3300025925 | Bacteria | 3904 |
| 251 | Ga0207659_10303805 | 3300025926 | Bacteria | 1311 |
| 252 | Ga0207700_10013374 | 3300025928 | Bacteria | 5337 |
| 253 | Ga0207700_10264924 | 3300025928 | Bacteria | 1473 |
| 254 | Ga0207664_10030851 | 3300025929 | Bacteria | 4096 |
| 255 | Ga0207664_10051388 | 3300025929 | Bacteria | 3254 |
| 256 | Ga0207664_10066992 | 3300025929 | Bacteria | 2880 |
| 257 | Ga0207664_10084441 | 3300025929 | Bacteria | 2590 |
| 258 | Ga0207644_10135404 | 3300025931 | Bacteria | 1891 |
| 259 | Ga0207690_10008048 | 3300025932 | Bacteria | 6260 |
| 260 | Ga0207690_10050009 | 3300025932 | Bacteria | 2788 |
| 261 | Ga0207706_10009628 | 3300025933 | Bacteria | 8869 |
| 262 | Ga0207706_10026463 | 3300025933 | Bacteria | 5192 |
| 263 | Ga0207686_10072241 | 3300025934 | Bacteria | 2223 |
| 264 | Ga0207709_10164511 | 3300025935 | Bacteria | 1550 |
| 265 | Ga0207670_10023433 | 3300025936 | Bacteria | 3843 |
| 266 | Ga0207670_10108058 | 3300025936 | Bacteria | 1999 |
| 267 | Ga0207669_10027702 | 3300025937 | Bacteria | 3107 |
| 268 | Ga0207704_10069375 | 3300025938 | Bacteria | 2227 |
| 269 | Ga0207691_10088334 | 3300025940 | Bacteria | 2780 |
| 270 | Ga0207711_10012235 | 3300025941 | Bacteria | 7137 |
| 271 | Ga0207689_10000151 | 3300025942 | Bacteria | 59965 |
| 272 | Ga0207689_10061712 | 3300025942 | Bacteria | 3083 |
| 273 | Ga0207661_10117452 | 3300025944 | Bacteria | 2259 |
| 274 | Ga0207661_10125311 | 3300025944 | Bacteria | 2193 |
| 275 | Ga0207679_10007601 | 3300025945 | Bacteria | 6884 |
| 276 | Ga0207679_10014124 | 3300025945 | Bacteria | 5243 |
| 277 | Ga0207679_10079320 | 3300025945 | Bacteria | 2503 |
| 278 | Ga0207667_10007731 | 3300025949 | Bacteria | 12852 |
| 279 | Ga0207667_10023539 | 3300025949 | Bacteria | 6780 |
| 280 | Ga0207667_10157811 | 3300025949 | Bacteria | 2334 |
| 281 | Ga0207712_10025372 | 3300025961 | Bacteria | 3937 |
| 282 | Ga0207712_10134992 | 3300025961 | Bacteria | 1885 |
| 283 | Ga0207668_10018538 | 3300025972 | Bacteria | 4383 |
| 284 | Ga0207668_10311279 | 3300025972 | Bacteria | 1303 |
| 285 | Ga0207703_10000300 | 3300026035 | Bacteria | 54568 |
| 286 | Ga0207703_10048191 | 3300026035 | Bacteria | 3438 |
| 287 | Ga0207703_10378494 | 3300026035 | Bacteria | 1309 |
| 288 | Ga0207639_10045997 | 3300026041 | Bacteria | 3291 |
| 289 | Ga0207678_10003426 | 3300026067 | Bacteria | 14285 |
| 290 | Ga0207678_10009871 | 3300026067 | Bacteria | 8382 |
| 291 | Ga0207678_10021702 | 3300026067 | Bacteria | 5631 |
| 292 | Ga0207678_10186960 | 3300026067 | Bacteria | 1770 |
| 293 | Ga0207708_10005456 | 3300026075 | Bacteria | 9381 |
| 294 | Ga0207708_10005844 | 3300026075 | Bacteria | 9104 |
| 295 | Ga0207708_10007962 | 3300026075 | Bacteria | 7853 |
| 296 | Ga0207702_10052580 | 3300026078 | Bacteria | 3447 |
| 297 | Ga0207641_10017758 | 3300026088 | Bacteria | 5829 |
| 298 | Ga0207641_10018900 | 3300026088 | Bacteria | 5653 |
| 299 | Ga0207641_10174243 | 3300026088 | Bacteria | 1966 |
| 300 | Ga0207641_10218059 | 3300026088 | Bacteria | 1768 |
| 301 | Ga0207648_10004613 | 3300026089 | Bacteria | 14128 |
| 302 | Ga0207648_10052305 | 3300026089 | Bacteria | 3571 |
| 303 | Ga0207676_10001288 | 3300026095 | Bacteria | 18648 |
| 304 | Ga0207676_10189192 | 3300026095 | Bacteria | 1810 |
| 305 | Ga0207676_10292850 | 3300026095 | Bacteria | 1483 |
| 306 | Ga0207674_10000045 | 3300026116 | Bacteria | 122251 |
| 307 | Ga0207674_10009358 | 3300026116 | Bacteria | 11207 |
| 308 | Ga0207674_10051123 | 3300026116 | Bacteria | 4218 |
| 309 | Ga0207674_10082438 | 3300026116 | Bacteria | 3217 |
| 310 | Ga0207674_10235200 | 3300026116 | Bacteria | 1780 |
| 311 | Ga0207675_100001119 | 3300026118 | Bacteria | 26560 |
| 312 | Ga0207675_100056667 | 3300026118 | Bacteria | 3655 |
| 313 | Ga0207675_100066051 | 3300026118 | Bacteria | 3380 |
| 314 | Ga0207675_100458862 | 3300026118 | Bacteria | 1263 |
| 315 | Ga0207683_10009436 | 3300026121 | Bacteria | 8315 |
| 316 | Ga0207683_10021746 | 3300026121 | Bacteria | 5498 |
| 317 | Ga0207683_10179745 | 3300026121 | Bacteria | 1918 |
| 318 | Ga0207698_10014647 | 3300026142 | Bacteria | 5221 |
| 319 | Ga0207698_10049585 | 3300026142 | Bacteria | 3197 |
| 320 | Ga0209966_1001307 | 3300027695 | Bacteria | 4406 |
| 321 | Ga0209998_10001451 | 3300027717 | Bacteria | 5728 |
| 322 | Ga0209998_10003218 | 3300027717 | Bacteria | 3606 |
| 323 | Ga0209974_10018298 | 3300027876 | Bacteria | 2325 |
| 324 | Ga0209974_10021058 | 3300027876 | Bacteria | 2161 |
| 325 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 326 | Ga0207428_10050828 | 3300027907 | Bacteria | 3314 |
| 327 | Ga0268265_10003089 | 3300028380 | Bacteria | 12151 |
| 328 | Ga0268264_10000451 | 3300028381 | Bacteria | 56097 |
| 329 | Ga0268264_10003127 | 3300028381 | Bacteria | 14348 |
| 330 | Ga0265332_10025356 | 3300031238 | Bacteria | 2605 |
| 331 | Ga0265325_10000708 | 3300031241 | Bacteria | 24173 |
| 332 | Ga0265313_10009620 | 3300031595 | Bacteria | 6252 |
| 333 | Ga0307413_10306885 | 3300031824 | Bacteria | 1206 |
| 334 | Ga0307407_10110147 | 3300031903 | Bacteria | 1727 |
| 335 | Ga0307412_10175021 | 3300031911 | Bacteria | 1608 |
| 336 | Ga0307412_10223124 | 3300031911 | Bacteria | 1446 |
| 337 | Ga0307409_100263115 | 3300031995 | Bacteria | 1584 |
| 338 | Ga0307409_100523351 | 3300031995 | Bacteria | 1159 |
| 339 | Ga0307414_10319916 | 3300032004 | Bacteria | 1320 |
| 340 | Ga0307411_10314804 | 3300032005 | Bacteria | 1261 |
| 341 | Ga0373930_0001628 | 3300034816 | Bacteria | 3387 |
| 342 | Ga0373948_0000403 | 3300034817 | Bacteria | 5344 |
| 343 | Ga0373950_0000200 | 3300034818 | Bacteria | 8183 |
| 344 | Ga0373959_0001588 | 3300034820 | Bacteria | 3614 |
| 345 | Ga0373938_0000844 | 3300034957 | Bacteria | 4942 |
| 346 | Ga0373928_0000443 | 3300035084 | Bacteria | 8179 |
| 347 | Ga0373929_0000756 | 3300035085 | Bacteria | 6285 |
| 348 | Ga0373940_0000018 | 3300035088 | Bacteria | 19361 |
| 349 | Ga0373949_0003205 | 3300035090 | Bacteria | 3964 |
| 350 | Ga0373952_0000228 | 3300035092 | Bacteria | 9021 |
| 351 | Ga0373923_0010688 | 3300035111 | Bacteria | 3348 |
| 352 | Ga0373932_0000155 | 3300035112 | Bacteria | 19871 |
| 353 | Ga0373936_0001591 | 3300035113 | Bacteria | 8288 |
| 354 | Ga0373936_0004284 | 3300035113 | Bacteria | 5390 |
| 355 | Ga0373936_0009238 | 3300035113 | Bacteria | 3716 |
| 356 | Ga0373941_0001756 | 3300035115 | Bacteria | 4656 |
| 357 | Ga0373945_0004589 | 3300035116 | Bacteria | 4392 |
| 358 | Ga0373953_0022944 | 3300035117 | Bacteria | 2359 |
| 359 | Ga0373954_0020778 | 3300035118 | Bacteria | 2971 |
| 360 | Ga0373954_0044028 | 3300035118 | Bacteria | 2082 |
| 361 | Ga0373960_0000061 | 3300035121 | Bacteria | 14957 |
| 362 | Ga0373943_0001108 | 3300035170 | Bacteria | 12022 |
| 363 | Ga0373946_0001186 | 3300035171 | Bacteria | 9031 |
| 364 | Ga0373946_0008129 | 3300035171 | Bacteria | 3851 |
| 365 | Ga0373955_0008613 | 3300035172 | Bacteria | 4744 |
| 366 | Ga0373942_0002062 | 3300035207 | Bacteria | 4998 |
| 367 | Ga0373961_0000451 | 3300035241 | Bacteria | 16466 |
| 368 | Ga0373961_0006208 | 3300035241 | Bacteria | 2872 |
| 369 | Ga0373962_0000409 | 3300035242 | Bacteria | 9394 |
| 370 | Ga0373924_0014055 | 3300035410 | Bacteria | 3019 |
| 371 | Ga0373931_0020850 | 3300035691 | Bacteria | 3282 |
| 372 | Ga0373935_0003508 | 3300035692 | Bacteria | 9123 |
| 373 | Ga0373935_0028092 | 3300035692 | Bacteria | 3476 |
| 374 | Ga0373935_0033212 | 3300035692 | Bacteria | 3210 |
| 375 | Ga0373927_0002017 | 3300035695 | Bacteria | 14958 |
| 376 | Ga0373927_0004258 | 3300035695 | Bacteria | 10045 |
| 377 | Ga0373933_0022312 | 3300035724 | Bacteria | 3603 |
| 378 | Ga0373933_0096356 | 3300035724 | Bacteria | 1831 |
| 379 | Ga0373933_0160317 | 3300035724 | Bacteria | 1428 |
| 380 | Ga0373947_0002042 | 3300035725 | Bacteria | 12318 |
| 381 | Ga0373947_0016168 | 3300035725 | Bacteria | 4288 |
| 382 | Ga0373937_0009662 | 3300036401 | Bacteria | 8401 |
| 383 | Ga0373937_0051194 | 3300036401 | Bacteria | 3785 |
| 384 | Ga0373937_0215916 | 3300036401 | Bacteria | 1805 |
| 385 | Ga0373937_0455248 | 3300036401 | Bacteria | 1215 |
| 386 | Ga0373925_0004980 | 3300037068 | Bacteria | 9973 |
| 387 | Ga0395905_0049971 | 3300037471 | Bacteria | 3919 |
| 388 | Ga0436364_0663275 | 3300037853 | Bacteria | 97909 |
| 389 | Ga0436365_1342486 | 3300039437 | Bacteria | 2466 |
| 390 | Ga0436361_0886998 | 3300039447 | Bacteria | 5611 |
| 391 | Ga0436363_1654980 | 3300039450 | Bacteria | 10573 |
| 392 | Ga0451833_0091326 | 3300041491 | Bacteria | 985 |
| 393 | Ga0451843_0100024 | 3300041509 | Bacteria | 1723 |
| 394 | Ga0439448_0025513 | 3300042005 | Bacteria | 1854 |
| 395 | Ga0439450_005017 | 3300042008 | Bacteria | 2300 |
| 396 | Ga0439463_028313 | 3300042016 | Bacteria | 1411 |
| 397 | Ga0439464_0014054 | 3300042439 | Bacteria | 2149 |
| 398 | Ga0451576_0058905 | 3300045051 | Bacteria | 4011 |
| 399 | Ga0495592_0001157 | 3300046454 | Bacteria | 18304 |
| 400 | Ga0495592_0006155 | 3300046454 | Bacteria | 8922 |
| 401 | Ga0495603_0065858 | 3300046455 | Bacteria | 2135 |
| 402 | Ga0495629_0005121 | 3300046459 | Bacteria | 9800 |
| 403 | Ga0495641_0003638 | 3300046461 | Bacteria | 11412 |
| 404 | Ga0495641_0089976 | 3300046461 | Bacteria | 1371 |
| 405 | Ga0495651_0002175 | 3300046462 | Bacteria | 15159 |
| 406 | Ga0495653_0002883 | 3300046463 | Bacteria | 13751 |
| 407 | Ga0495653_0045259 | 3300046463 | Bacteria | 3412 |
| 408 | Ga0495580_0012164 | 3300046472 | Bacteria | 6616 |
| 409 | Ga0495580_0025286 | 3300046472 | Bacteria | 4340 |
| 410 | Ga0495582_0002391 | 3300046473 | Bacteria | 10488 |
| 411 | Ga0495639_0000713 | 3300046475 | Bacteria | 15217 |
| 412 | Ga0495639_0064779 | 3300046475 | Bacteria | 1680 |
| 413 | Ga0495662_0000084 | 3300046476 | Bacteria | 33781 |
| 414 | Ga0495662_0053207 | 3300046476 | Bacteria | 1955 |
| 415 | Ga0495662_0058494 | 3300046476 | Bacteria | 1862 |
| 416 | Ga0495664_0000482 | 3300046477 | Bacteria | 19803 |
| 417 | Ga0495664_0059591 | 3300046477 | Bacteria | 2272 |
| 418 | Ga0495585_0032653 | 3300046492 | Bacteria | 2948 |
| 419 | Ga0495594_0008249 | 3300046499 | Bacteria | 5361 |
| 420 | Ga0495608_0005556 | 3300046511 | Bacteria | 9006 |
| 421 | Ga0495618_0004433 | 3300046514 | Bacteria | 8635 |
| 422 | Ga0495628_0007423 | 3300046516 | Bacteria | 9490 |
| 423 | Ga0495628_0018284 | 3300046516 | Bacteria | 5810 |
| 424 | Ga0495628_0020031 | 3300046516 | Bacteria | 5523 |
| 425 | Ga0495630_0001951 | 3300046517 | Bacteria | 14336 |
| 426 | Ga0495630_0006736 | 3300046517 | Bacteria | 8188 |
| 427 | Ga0495630_0129648 | 3300046517 | Bacteria | 1915 |
| 428 | Ga0495632_0056324 | 3300046519 | Bacteria | 1922 |
| 429 | Ga0495666_0004463 | 3300046526 | Bacteria | 7069 |
| 430 | Ga0495666_0014684 | 3300046526 | Bacteria | 3898 |
| 431 | Ga0495652_0007683 | 3300046529 | Bacteria | 9928 |
| 432 | Ga0495665_0002359 | 3300046531 | Bacteria | 10190 |
| 433 | Ga0495665_0024936 | 3300046531 | Bacteria | 3213 |
| 434 | Ga0495665_0055338 | 3300046531 | Bacteria | 2095 |
| 435 | Ga0495640_0002890 | 3300046533 | Bacteria | 13841 |
| 436 | Ga0495640_0007345 | 3300046533 | Bacteria | 8671 |
| 437 | Ga0495640_0043685 | 3300046533 | Bacteria | 3119 |
| 438 | Ga0495586_0001095 | 3300046535 | Bacteria | 15316 |
| 439 | Ga0495586_0044159 | 3300046535 | Bacteria | 2400 |
| 440 | Ga0495587_0010083 | 3300046536 | Bacteria | 6029 |
| 441 | Ga0495645_0046268 | 3300046543 | Bacteria | 3171 |
| 442 | Ga0495622_0069760 | 3300046557 | Bacteria | 1623 |
| 443 | Ga0495633_0035702 | 3300046558 | Bacteria | 2386 |
| 444 | Ga0495667_0000202 | 3300046559 | Bacteria | 40046 |
| 445 | Ga0495667_0035082 | 3300046559 | Bacteria | 3354 |
| 446 | Ga0495667_0086742 | 3300046559 | Bacteria | 2029 |
| 447 | Ga0495656_0105891 | 3300046615 | Bacteria | 1308 |
| 448 | Ga0495634_0005317 | 3300046642 | Bacteria | 9928 |
| 449 | Ga0495634_0014760 | 3300046642 | Bacteria | 5620 |
| 450 | Ga0495625_0035683 | 3300046660 | Bacteria | 3663 |
| 451 | Ga0495625_0037749 | 3300046660 | Bacteria | 3540 |
| 452 | Ga0495635_0000399 | 3300046663 | Bacteria | 27531 |
| 453 | Ga0495588_0062754 | 3300046674 | Bacteria | 1926 |
| 454 | Ga0495657_0001733 | 3300046675 | Bacteria | 18667 |
| 455 | Ga0495599_0004717 | 3300046678 | Bacteria | 8096 |
| 456 | Ga0495599_0077697 | 3300046678 | Bacteria | 2072 |
| 457 | Ga0495646_0003722 | 3300046680 | Bacteria | 9525 |
| 458 | Ga0495647_0004315 | 3300046681 | Bacteria | 4608 |
| 459 | Ga0495647_0013214 | 3300046681 | Bacteria | 2857 |
| 460 | Ga0495658_0001713 | 3300046683 | Bacteria | 11388 |
| 461 | Ga0495658_0007999 | 3300046683 | Bacteria | 5239 |
| 462 | Ga0495658_0008581 | 3300046683 | Bacteria | 5069 |
| 463 | Ga0495613_0001462 | 3300046689 | Bacteria | 17997 |
| 464 | Ga0495613_0008236 | 3300046689 | Bacteria | 7739 |
| 465 | Ga0495613_0009305 | 3300046689 | Bacteria | 7290 |
| 466 | Ga0495624_0000222 | 3300046690 | Bacteria | 44293 |
| 467 | Ga0495624_0041636 | 3300046690 | Bacteria | 2937 |
| 468 | Ga0495624_0072273 | 3300046690 | Bacteria | 2146 |
| 469 | Ga0495670_0000837 | 3300046691 | Bacteria | 14887 |
| 470 | Ga0495600_0002124 | 3300046809 | Bacteria | 11221 |
| 471 | Ga0495600_0003235 | 3300046809 | Bacteria | 9529 |
| 472 | Ga0495581_0000145 | 3300047315 | Bacteria | 31255 |
| 473 | Ga0495604_0005816 | 3300047317 | Bacteria | 9782 |
| 474 | Ga0495604_0086560 | 3300047317 | Bacteria | 2335 |
| 475 | Ga0495636_0038403 | 3300047318 | Unclassified | 1981 |
| 476 | Ga0495674_0007404 | 3300047319 | Bacteria | 10489 |
| 477 | Ga0495674_0015727 | 3300047319 | Bacteria | 7063 |
| 478 | Ga0495676_0020974 | 3300047321 | Bacteria | 5718 |
| 479 | Ga0495676_0059995 | 3300047321 | Bacteria | 2984 |
| 480 | Ga0495680_0001864 | 3300047322 | Bacteria | 22174 |
| 481 | Ga0495680_0002897 | 3300047322 | Bacteria | 17243 |
| 482 | Ga0495684_0000075 | 3300047471 | Bacteria | 67922 |
| 483 | Ga0495593_0000228 | 3300047673 | Bacteria | 30037 |
| 484 | Ga0496101_0118117 | 3300048904 | Bacteria | 2003 |
| 485 | Ga0496102_0004792 | 3300048905 | Bacteria | 11439 |
| 486 | Ga0496102_0110070 | 3300048905 | Bacteria | 2567 |
| 487 | Ga0496102_0117308 | 3300048905 | Bacteria | 2484 |
| 488 | Ga0496103_0010350 | 3300048906 | Bacteria | 5519 |
| 489 | Ga0496103_0092071 | 3300048906 | Bacteria | 1914 |
| 490 | Ga0496104_0000061 | 3300048907 | Bacteria | 117394 |
| 491 | Ga0496104_0065899 | 3300048907 | Bacteria | 3438 |
| 492 | Ga0496106_0000300 | 3300048909 | Bacteria | 34880 |
| 493 | Ga0496106_0046270 | 3300048909 | Bacteria | 3270 |
| 494 | Ga0496107_0002193 | 3300048910 | Bacteria | 12549 |
| 495 | Ga0496107_0018653 | 3300048910 | Bacteria | 4888 |
| 496 | Ga0496107_0249197 | 3300048910 | Bacteria | 1321 |
| 497 | Ga0496108_0004930 | 3300048911 | Bacteria | 10782 |
| 498 | Ga0496109_0001819 | 3300048912 | Bacteria | 17742 |
| 499 | Ga0496109_0257661 | 3300048912 | Bacteria | 1643 |
| 500 | Ga0496110_0037046 | 3300048913 | Bacteria | 4238 |
| 501 | Ga0496112_0004718 | 3300048915 | Bacteria | 11614 |
| 502 | Ga0496113_0036894 | 3300048916 | Bacteria | 3583 |
| 503 | Ga0496115_0051521 | 3300048918 | Bacteria | 3301 |
| 504 | Ga0501032_0008708 | 3300049569 | Bacteria | 7389 |
| 505 | Ga0501033_0020592 | 3300049570 | Bacteria | 4984 |
| 506 | Ga0501034_0000439 | 3300049571 | Bacteria | 68932 |
| 507 | Ga0501034_0019423 | 3300049571 | Bacteria | 6951 |
| 508 | Ga0501036_0000689 | 3300049572 | Bacteria | 24929 |
| 509 | Ga0501036_0013749 | 3300049572 | Bacteria | 6730 |
| 510 | Ga0501037_0007499 | 3300049573 | Bacteria | 7985 |
| 511 | Ga0501037_0126837 | 3300049573 | Bacteria | 1831 |
| 512 | Ga0501038_0004102 | 3300049574 | Bacteria | 13549 |
| 513 | Ga0501038_0236569 | 3300049574 | Bacteria | 1451 |
| 514 | Ga0501039_0059755 | 3300049575 | Bacteria | 2952 |
| 515 | Ga0501043_0002343 | 3300049579 | Bacteria | 16061 |
| 516 | Ga0501043_0032695 | 3300049579 | Bacteria | 4090 |
| 517 | Ga0501046_0115613 | 3300049580 | Bacteria | 2045 |
| 518 | Ga0501047_0000204 | 3300049581 | Bacteria | 71976 |
| 519 | Ga0501047_0006456 | 3300049581 | Bacteria | 11031 |
| 520 | Ga0501047_0011147 | 3300049581 | Bacteria | 8507 |
| 521 | Ga0501047_0268488 | 3300049581 | Bacteria | 1552 |
| 522 | Ga0501048_0000065 | 3300049582 | Bacteria | 53623 |
| 523 | Ga0501048_0083602 | 3300049582 | Bacteria | 2251 |
| 524 | Ga0501048_0115983 | 3300049582 | Bacteria | 1892 |
| 525 | Ga0501067_0082272 | 3300049583 | Bacteria | 1785 |
| 526 | Ga0501068_0005601 | 3300049584 | Bacteria | 6878 |
| 527 | Ga0501068_0014257 | 3300049584 | Bacteria | 4541 |
| 528 | Ga0501069_0088964 | 3300049585 | Bacteria | 1745 |
| 529 | Ga0501070_0002291 | 3300049586 | Bacteria | 16823 |
| 530 | Ga0501070_0012101 | 3300049586 | Bacteria | 7282 |
| 531 | Ga0501070_0031140 | 3300049586 | Bacteria | 4468 |
| 532 | Ga0501072_0115487 | 3300049588 | Bacteria | 2137 |
| 533 | Ga0501073_0054599 | 3300049589 | Bacteria | 2796 |
| 534 | Ga0501074_0008526 | 3300049590 | Bacteria | 7427 |
| 535 | Ga0501074_0036552 | 3300049590 | Bacteria | 3557 |
| 536 | Ga0501076_0218921 | 3300049592 | Bacteria | 1556 |
| 537 | Ga0501080_0000815 | 3300049742 | Bacteria | 25419 |
| 538 | Ga0501080_0062194 | 3300049742 | Bacteria | 3474 |
| 539 | Ga0501080_0186629 | 3300049742 | Bacteria | 1906 |
| 540 | Ga0501080_0485200 | 3300049742 | Bacteria | 1105 |
| 541 | Ga0501083_0001712 | 3300049744 | Bacteria | 14955 |
| 542 | Ga0501083_0031399 | 3300049744 | Bacteria | 3646 |
| 543 | Ga0501035_0025991 | 3300049822 | Bacteria | 5363 |
| 544 | Ga0501035_0091494 | 3300049822 | Bacteria | 2677 |
| 545 | Ga0501044_0001827 | 3300049823 | Bacteria | 24776 |
| 546 | Ga0501044_0016948 | 3300049823 | Bacteria | 7816 |
| 547 | Ga0501045_0125873 | 3300049824 | Bacteria | 1904 |
| 548 | nmdc:mga03683_33286_c1 | 3300050489 | Bacteria | 2078 |
| 549 | nmdc:mga0yw44_56388_c1 | 3300050492 | Bacteria | 2393 |
| 550 | nmdc:mga0k408_267671_c1 | 3300050493 | Bacteria | 1020 |
| 551 | nmdc:mga0k408_39815_c1 | 3300050493 | Bacteria | 2703 |
| 552 | nmdc:mga0k408_78503_c1 | 3300050493 | Bacteria | 1443 |
| 553 | nmdc:mga06z11_30677_c1 | 3300050494 | Bacteria | 2604 |
| 554 | nmdc:mga05p37_208054_c1 | 3300050507 | Bacteria | 2366 |
| 555 | nmdc:mga08y16_28547_c1 | 3300050511 | Bacteria | 5882 |
| 556 | nmdc:mga08y16_8011_c1 | 3300050511 | Bacteria | 11053 |
| 557 | nmdc:mga0n895_157457_c1 | 3300050512 | Bacteria | 2302 |
| 558 | nmdc:mga0rr50_125787_c1 | 3300050513 | Bacteria | 2047 |
| 559 | nmdc:mga0a205_18403_c1 | 3300050515 | Bacteria | 6568 |
| 560 | Ga0495601_0010704 | 3300053077 | Bacteria | 5470 |
| 561 | Ga0495601_0014582 | 3300053077 | Bacteria | 4737 |
| 562 | Ga0495612_0001242 | 3300053078 | Bacteria | 10512 |
| 563 | Ga0495612_0063252 | 3300053078 | Bacteria | 1535 |
| 564 | Ga0495595_0000988 | 3300053084 | Bacteria | 10960 |
| 565 | Ga0495595_0013080 | 3300053084 | Bacteria | 3501 |
| 566 | Ga0495619_0001117 | 3300053085 | Bacteria | 17612 |
| 567 | Ga0495619_0043241 | 3300053085 | Bacteria | 2952 |
| 568 | Ga0500643_000795 | 3300053087 | Bacteria | 20468 |
| 569 | Ga0500651_0014672 | 3300053093 | Bacteria | 4797 |
| 570 | Ga0500566_0127711 | 3300053094 | Bacteria | 1364 |
| 571 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 572 | Ga0500604_0043800 | 3300053151 | Bacteria | 1361 |
| 573 | Ga0500637_0030651 | 3300053178 | Bacteria | 2995 |
| 574 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 575 | Ga0501084_0215386 | 3300054114 | Bacteria | 1620 |
| 576 | Ga0501082_0145737 | 3300060353 | Bacteria | 2055 |
| 577 | Ga0501082_0271351 | 3300060353 | Bacteria | 1476 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100144735 | Ga0068869_1001447352 | 282 |
| 2 | 3300026095 | Ga0207676_10189192 | Ga0207676_101891922 | 290 |
| 3 | 3300009177 | Ga0105248_10131270 | Ga0105248_101312702 | 306 |
| 4 | 3300014325 | Ga0163163_10005846 | Ga0163163_100058467 | 306 |
| 5 | 3300014968 | Ga0157379_10011943 | Ga0157379_100119438 | 306 |
| 6 | 3300048907 | Ga0496104_0065899 | Ga0496104_0065899_2338_3396 | 306 |
| 7 | 3300048911 | Ga0496108_0004930 | Ga0496108_0004930_7159_8217 | 306 |
| 8 | 3300048912 | Ga0496109_0001819 | Ga0496109_0001819_2567_3625 | 306 |
| 9 | 3300048913 | Ga0496110_0037046 | Ga0496110_0037046_503_1561 | 306 |
| 10 | 3300048915 | Ga0496112_0004718 | Ga0496112_0004718_8075_9133 | 306 |
| 11 | 3300048916 | Ga0496113_0036894 | Ga0496113_0036894_1105_2163 | 306 |
| 12 | 3300005564 | Ga0070664_100023513 | Ga0070664_1000235133 | 307 |
| 13 | 3300005614 | Ga0068856_100309998 | Ga0068856_1003099981 | 307 |
| 14 | 3300025945 | Ga0207679_10014124 | Ga0207679_100141243 | 307 |
| 15 | 3300005615 | Ga0070702_100046999 | Ga0070702_1000469992 | 308 |
| 16 | 3300009011 | Ga0105251_10065994 | Ga0105251_100659941 | 308 |
| 17 | 3300025918 | Ga0207662_10091333 | Ga0207662_100913332 | 308 |
| 18 | 3300025942 | Ga0207689_10061712 | Ga0207689_100617123 | 309 |
| 19 | 3300035724 | Ga0373933_0096356 | Ga0373933_0096356_254_1258 | 309 |
| 20 | 3300046476 | Ga0495662_0058494 | Ga0495662_0058494_122_1108 | 309 |
| 21 | 3300046690 | Ga0495624_0072273 | Ga0495624_0072273_578_1564 | 309 |
| 22 | 3300005290 | Ga0065712_10071542 | Ga0065712_100715422 | 310 |
| 23 | 3300005293 | Ga0065715_10144991 | Ga0065715_101449912 | 310 |
| 24 | 3300005330 | Ga0070690_100022947 | Ga0070690_1000229472 | 310 |
| 25 | 3300005331 | Ga0070670_100070304 | Ga0070670_1000703042 | 310 |
| 26 | 3300005367 | Ga0070667_100102127 | Ga0070667_1001021272 | 310 |
| 27 | 3300005842 | Ga0068858_100022002 | Ga0068858_1000220024 | 310 |
| 28 | 3300025925 | Ga0207650_10030156 | Ga0207650_100301564 | 310 |
| 29 | 3300026035 | Ga0207703_10048191 | Ga0207703_100481912 | 310 |
| 30 | 3300036401 | Ga0373937_0009662 | Ga0373937_0009662_6895_7881 | 310 |
| 31 | 3300046476 | Ga0495662_0053207 | Ga0495662_0053207_602_1588 | 310 |
| 32 | 3300046511 | Ga0495608_0005556 | Ga0495608_0005556_151_1137 | 310 |
| 33 | 3300046516 | Ga0495628_0020031 | Ga0495628_0020031_2655_3641 | 310 |
| 34 | 3300046535 | Ga0495586_0001095 | Ga0495586_0001095_1213_2199 | 310 |
| 35 | 3300046642 | Ga0495634_0014760 | Ga0495634_0014760_12_998 | 310 |
| 36 | 3300046683 | Ga0495658_0007999 | Ga0495658_0007999_4171_5157 | 310 |
| 37 | 3300046689 | Ga0495613_0009305 | Ga0495613_0009305_1112_2098 | 310 |
| 38 | 3300047318 | Ga0495636_0038403 | Ga0495636_0038403_291_1277 | 310 |
| 39 | 3300047322 | Ga0495680_0002897 | Ga0495680_0002897_1793_2779 | 310 |
| 40 | 3300053077 | Ga0495601_0014582 | Ga0495601_0014582_2416_3402 | 310 |
| 41 | 3300005435 | Ga0070714_100076575 | Ga0070714_1000765753 | 311 |
| 42 | 3300005439 | Ga0070711_100058899 | Ga0070711_1000588991 | 311 |
| 43 | 3300025916 | Ga0207663_10127849 | Ga0207663_101278492 | 311 |
| 44 | 3300025929 | Ga0207664_10066992 | Ga0207664_100669922 | 311 |
| 45 | 3300025915 | Ga0207693_10072881 | Ga0207693_100728813 | 312 |
| 46 | 3300046454 | Ga0495592_0001157 | Ga0495592_0001157_4104_5090 | 312 |
| 47 | 3300046533 | Ga0495640_0002890 | Ga0495640_0002890_736_1722 | 312 |
| 48 | 3300005327 | Ga0070658_10123637 | Ga0070658_101236371 | 314 |
| 49 | 3300005339 | Ga0070660_100027333 | Ga0070660_1000273333 | 314 |
| 50 | 3300005343 | Ga0070687_100049318 | Ga0070687_1000493181 | 314 |
| 51 | 3300005435 | Ga0070714_100110567 | Ga0070714_1001105672 | 314 |
| 52 | 3300005458 | Ga0070681_10219770 | Ga0070681_102197702 | 314 |
| 53 | 3300005530 | Ga0070679_100022933 | Ga0070679_1000229335 | 314 |
| 54 | 3300009093 | Ga0105240_10025445 | Ga0105240_100254456 | 314 |
| 55 | 3300009551 | Ga0105238_10021202 | Ga0105238_100212023 | 314 |
| 56 | 3300025909 | Ga0207705_10019721 | Ga0207705_100197213 | 314 |
| 57 | 3300025919 | Ga0207657_10015476 | Ga0207657_100154765 | 314 |
| 58 | 3300025921 | Ga0207652_10039490 | Ga0207652_100394901 | 314 |
| 59 | 3300025924 | Ga0207694_10059169 | Ga0207694_100591693 | 314 |
| 60 | 3300025929 | Ga0207664_10084441 | Ga0207664_100844413 | 314 |
| 61 | 3300005456 | Ga0070678_100006921 | Ga0070678_1000069213 | 315 |
| 62 | 3300009101 | Ga0105247_10017646 | Ga0105247_100176461 | 315 |
| 63 | 3300009176 | Ga0105242_10455801 | Ga0105242_104558012 | 315 |
| 64 | 3300013297 | Ga0157378_10242284 | Ga0157378_102422842 | 315 |
| 65 | 3300014745 | Ga0157377_10085370 | Ga0157377_100853701 | 315 |
| 66 | 3300025937 | Ga0207669_10027702 | Ga0207669_100277022 | 315 |
| 67 | 3300026121 | Ga0207683_10009436 | Ga0207683_100094365 | 315 |
| 68 | 3300041491 | Ga0451833_0091326 | Ga0451833_0091326_16_963 | 315 |
| 69 | 3300048905 | Ga0496102_0117308 | Ga0496102_0117308_29_976 | 315 |
| 70 | 3300048912 | Ga0496109_0257661 | Ga0496109_0257661_683_1630 | 315 |
| 71 | 3300003911 | JGI25405J52794_10001935 | JGI25405J52794_100019353 | 316 |
| 72 | 3300005937 | Ga0081455_10000012 | Ga0081455_10000012102 | 316 |
| 73 | 3300025934 | Ga0207686_10072241 | Ga0207686_100722413 | 316 |
| 74 | 3300035113 | Ga0373936_0009238 | Ga0373936_0009238_1193_2179 | 316 |
| 75 | 3300035116 | Ga0373945_0004589 | Ga0373945_0004589_2193_3179 | 316 |
| 76 | 3300035171 | Ga0373946_0008129 | Ga0373946_0008129_1830_2816 | 316 |
| 77 | 3300035692 | Ga0373935_0028092 | Ga0373935_0028092_1214_2200 | 316 |
| 78 | 3300035695 | Ga0373927_0004258 | Ga0373927_0004258_2344_3330 | 316 |
| 79 | 3300035725 | Ga0373947_0002042 | Ga0373947_0002042_2987_3973 | 316 |
| 80 | 3300046472 | Ga0495580_0025286 | Ga0495580_0025286_1808_2794 | 316 |
| 81 | 3300046475 | Ga0495639_0064779 | Ga0495639_0064779_144_1130 | 316 |
| 82 | 3300046526 | Ga0495666_0014684 | Ga0495666_0014684_1501_2487 | 316 |
| 83 | 3300046531 | Ga0495665_0055338 | Ga0495665_0055338_1036_2022 | 316 |
| 84 | 3300046535 | Ga0495586_0044159 | Ga0495586_0044159_88_1074 | 316 |
| 85 | 3300046674 | Ga0495588_0062754 | Ga0495588_0062754_914_1900 | 316 |
| 86 | 3300046681 | Ga0495647_0013214 | Ga0495647_0013214_1796_2782 | 316 |
| 87 | 3300046683 | Ga0495658_0001713 | Ga0495658_0001713_2035_3021 | 316 |
| 88 | 3300047321 | Ga0495676_0059995 | Ga0495676_0059995_1771_2757 | 316 |
| 89 | 3300005937 | Ga0081455_10097858 | Ga0081455_100978582 | 320 |
| 90 | 3300046678 | Ga0495599_0077697 | Ga0495599_0077697_413_1420 | 321 |
| 91 | 3300009094 | Ga0111539_10416843 | Ga0111539_104168432 | 322 |
| 92 | 3300035118 | Ga0373954_0044028 | Ga0373954_0044028_154_1161 | 323 |
| 93 | 3300035724 | Ga0373933_0160317 | Ga0373933_0160317_246_1274 | 323 |
| 94 | 3300036401 | Ga0373937_0051194 | Ga0373937_0051194_853_1881 | 323 |
| 95 | 3300046455 | Ga0495603_0065858 | Ga0495603_0065858_60_1073 | 323 |
| 96 | iso_pu_bacteria | 2643221547 | 2643758912 | 323 |
| 97 | 3300025912 | Ga0207707_10007786 | Ga0207707_100077865 | 324 |
| 98 | 3300048906 | Ga0496103_0010350 | Ga0496103_0010350_3380_4501 | 324 |
| 99 | 3300005471 | Ga0070698_100177985 | Ga0070698_1001779853 | 325 |
| 100 | 3300050493 | nmdc:mga0k408_267671_c1 | nmdc:mga0k408_267671_c1_21_1004 | 325 |
| 101 | 3300007076 | Ga0075435_100002930 | Ga0075435_10000293012 | 326 |
| 102 | 3300050513 | nmdc:mga0rr50_125787_c1 | nmdc:mga0rr50_125787_c1_707_1690 | 326 |
| 103 | 3300050515 | nmdc:mga0a205_18403_c1 | nmdc:mga0a205_18403_c1_4980_5963 | 326 |
| 104 | 3300042008 | Ga0439450_005017 | Ga0439450_005017_699_1682 | 327 |
| 105 | 3300049592 | Ga0501076_0218921 | Ga0501076_0218921_490_1491 | 327 |
| 106 | 3300060353 | Ga0501082_0271351 | Ga0501082_0271351_269_1270 | 327 |
| 107 | 3300005331 | Ga0070670_100309827 | Ga0070670_1003098272 | 328 |
| 108 | 3300005343 | Ga0070687_100166548 | Ga0070687_1001665481 | 328 |
| 109 | 3300005544 | Ga0070686_100053084 | Ga0070686_1000530843 | 328 |
| 110 | 3300005842 | Ga0068858_100114748 | Ga0068858_1001147483 | 328 |
| 111 | 3300006237 | Ga0097621_100001440 | Ga0097621_10000144014 | 328 |
| 112 | 3300006358 | Ga0068871_100002792 | Ga0068871_10000279210 | 328 |
| 113 | 3300014969 | Ga0157376_10020495 | Ga0157376_100204952 | 328 |
| 114 | 3300021361 | Ga0213872_10069800 | Ga0213872_100698002 | 328 |
| 115 | 3300025918 | Ga0207662_10195291 | Ga0207662_101952912 | 328 |
| 116 | 3300035241 | Ga0373961_0006208 | Ga0373961_0006208_912_1901 | 328 |
| 117 | 3300039447 | Ga0436361_0886998 | Ga0436361_0886998_3336_4334 | 328 |
| 118 | 3300039450 | Ga0436363_1654980 | Ga0436363_1654980_4705_5703 | 328 |
| 119 | 3300003203 | JGI25406J46586_10000826 | JGI25406J46586_1000082610 | 329 |
| 120 | 3300005327 | Ga0070658_10035834 | Ga0070658_100358343 | 329 |
| 121 | 3300005329 | Ga0070683_100078518 | Ga0070683_1000785182 | 329 |
| 122 | 3300005334 | Ga0068869_100000039 | Ga0068869_10000003910 | 329 |
| 123 | 3300005339 | Ga0070660_100014143 | Ga0070660_1000141432 | 329 |
| 124 | 3300005343 | Ga0070687_100194776 | Ga0070687_1001947761 | 329 |
| 125 | 3300005344 | Ga0070661_100055552 | Ga0070661_1000555522 | 329 |
| 126 | 3300005345 | Ga0070692_10030076 | Ga0070692_100300763 | 329 |
| 127 | 3300005347 | Ga0070668_100042788 | Ga0070668_1000427884 | 329 |
| 128 | 3300005366 | Ga0070659_100009187 | Ga0070659_1000091875 | 329 |
| 129 | 3300005367 | Ga0070667_100000488 | Ga0070667_1000004888 | 329 |
| 130 | 3300005434 | Ga0070709_10017300 | Ga0070709_100173003 | 329 |
| 131 | 3300005434 | Ga0070709_10258273 | Ga0070709_102582731 | 329 |
| 132 | 3300005435 | Ga0070714_100018028 | Ga0070714_1000180283 | 329 |
| 133 | 3300005440 | Ga0070705_100038253 | Ga0070705_1000382532 | 329 |
| 134 | 3300005458 | Ga0070681_10115718 | Ga0070681_101157182 | 329 |
| 135 | 3300005459 | Ga0068867_100002184 | Ga0068867_10000218410 | 329 |
| 136 | 3300005471 | Ga0070698_100182302 | Ga0070698_1001823021 | 329 |
| 137 | 3300005530 | Ga0070679_100122680 | Ga0070679_1001226802 | 329 |
| 138 | 3300005535 | Ga0070684_100010266 | Ga0070684_1000102665 | 329 |
| 139 | 3300005539 | Ga0068853_100015534 | Ga0068853_1000155342 | 329 |
| 140 | 3300005546 | Ga0070696_100004759 | Ga0070696_1000047595 | 329 |
| 141 | 3300005563 | Ga0068855_100219987 | Ga0068855_1002199871 | 329 |
| 142 | 3300005614 | Ga0068856_100033873 | Ga0068856_1000338733 | 329 |
| 143 | 3300005617 | Ga0068859_100000189 | Ga0068859_10000018929 | 329 |
| 144 | 3300005618 | Ga0068864_100000192 | Ga0068864_10000019224 | 329 |
| 145 | 3300005719 | Ga0068861_100011083 | Ga0068861_1000110835 | 329 |
| 146 | 3300005834 | Ga0068851_10002769 | Ga0068851_100027695 | 329 |
| 147 | 3300005841 | Ga0068863_100181101 | Ga0068863_1001811012 | 329 |
| 148 | 3300005841 | Ga0068863_100328025 | Ga0068863_1003280251 | 329 |
| 149 | 3300005843 | Ga0068860_100000350 | Ga0068860_10000035053 | 329 |
| 150 | 3300005937 | Ga0081455_10034958 | Ga0081455_100349582 | 329 |
| 151 | 3300005937 | Ga0081455_10135784 | Ga0081455_101357842 | 329 |
| 152 | 3300005985 | Ga0081539_10002294 | Ga0081539_100022949 | 329 |
| 153 | 3300006914 | Ga0075436_100057054 | Ga0075436_1000570543 | 329 |
| 154 | 3300006931 | Ga0097620_100000189 | Ga0097620_10000018929 | 329 |
| 155 | 3300009093 | Ga0105240_10079097 | Ga0105240_100790972 | 329 |
| 156 | 3300009177 | Ga0105248_10013370 | Ga0105248_1001337011 | 329 |
| 157 | 3300009553 | Ga0105249_10170477 | Ga0105249_101704771 | 329 |
| 158 | 3300010375 | Ga0105239_10180994 | Ga0105239_101809942 | 329 |
| 159 | 3300013102 | Ga0157371_10008859 | Ga0157371_100088593 | 329 |
| 160 | 3300013104 | Ga0157370_10010239 | Ga0157370_100102398 | 329 |
| 161 | 3300013105 | Ga0157369_10117912 | Ga0157369_101179123 | 329 |
| 162 | 3300013307 | Ga0157372_10086413 | Ga0157372_100864132 | 329 |
| 163 | 3300013307 | Ga0157372_10266014 | Ga0157372_102660142 | 329 |
| 164 | 3300014968 | Ga0157379_10000028 | Ga0157379_1000002827 | 329 |
| 165 | 3300021388 | Ga0213875_10048223 | Ga0213875_100482233 | 329 |
| 166 | 3300025898 | Ga0207692_10013091 | Ga0207692_100130911 | 329 |
| 167 | 3300025906 | Ga0207699_10015906 | Ga0207699_100159063 | 329 |
| 168 | 3300025906 | Ga0207699_10025985 | Ga0207699_100259852 | 329 |
| 169 | 3300025906 | Ga0207699_10054214 | Ga0207699_100542142 | 329 |
| 170 | 3300025907 | Ga0207645_10087504 | Ga0207645_100875041 | 329 |
| 171 | 3300025909 | Ga0207705_10110771 | Ga0207705_101107712 | 329 |
| 172 | 3300025913 | Ga0207695_10018499 | Ga0207695_100184997 | 329 |
| 173 | 3300025916 | Ga0207663_10003419 | Ga0207663_100034197 | 329 |
| 174 | 3300025917 | Ga0207660_10020459 | Ga0207660_100204592 | 329 |
| 175 | 3300025918 | Ga0207662_10126359 | Ga0207662_101263592 | 329 |
| 176 | 3300025919 | Ga0207657_10000213 | Ga0207657_1000021336 | 329 |
| 177 | 3300025920 | Ga0207649_10025487 | Ga0207649_100254873 | 329 |
| 178 | 3300025921 | Ga0207652_10096003 | Ga0207652_100960032 | 329 |
| 179 | 3300025924 | Ga0207694_10024491 | Ga0207694_100244914 | 329 |
| 180 | 3300025928 | Ga0207700_10013374 | Ga0207700_100133742 | 329 |
| 181 | 3300025929 | Ga0207664_10030851 | Ga0207664_100308514 | 329 |
| 182 | 3300025929 | Ga0207664_10051388 | Ga0207664_100513883 | 329 |
| 183 | 3300025932 | Ga0207690_10050009 | Ga0207690_100500091 | 329 |
| 184 | 3300025941 | Ga0207711_10012235 | Ga0207711_100122351 | 329 |
| 185 | 3300025942 | Ga0207689_10000151 | Ga0207689_1000015110 | 329 |
| 186 | 3300025944 | Ga0207661_10117452 | Ga0207661_101174522 | 329 |
| 187 | 3300025945 | Ga0207679_10079320 | Ga0207679_100793202 | 329 |
| 188 | 3300025949 | Ga0207667_10023539 | Ga0207667_100235393 | 329 |
| 189 | 3300025949 | Ga0207667_10157811 | Ga0207667_101578111 | 329 |
| 190 | 3300025961 | Ga0207712_10134992 | Ga0207712_101349923 | 329 |
| 191 | 3300026035 | Ga0207703_10000300 | Ga0207703_1000030044 | 329 |
| 192 | 3300026067 | Ga0207678_10009871 | Ga0207678_100098714 | 329 |
| 193 | 3300026078 | Ga0207702_10052580 | Ga0207702_100525803 | 329 |
| 194 | 3300026088 | Ga0207641_10017758 | Ga0207641_100177582 | 329 |
| 195 | 3300026089 | Ga0207648_10004613 | Ga0207648_1000461310 | 329 |
| 196 | 3300026095 | Ga0207676_10001288 | Ga0207676_1000128819 | 329 |
| 197 | 3300026116 | Ga0207674_10000045 | Ga0207674_1000004521 | 329 |
| 198 | 3300026116 | Ga0207674_10051123 | Ga0207674_100511233 | 329 |
| 199 | 3300026118 | Ga0207675_100001119 | Ga0207675_10000111911 | 329 |
| 200 | 3300026142 | Ga0207698_10014647 | Ga0207698_100146473 | 329 |
| 201 | 3300028381 | Ga0268264_10000451 | Ga0268264_100004512 | 329 |
| 202 | 3300037471 | Ga0395905_0049971 | Ga0395905_0049971_2244_3251 | 329 |
| 203 | 3300037853 | Ga0436364_0663275 | Ga0436364_0663275_30558_31550 | 329 |
| 204 | 3300049569 | Ga0501032_0008708 | Ga0501032_0008708_4037_5041 | 329 |
| 205 | 3300049571 | Ga0501034_0000439 | Ga0501034_0000439_7558_8562 | 329 |
| 206 | 3300049571 | Ga0501034_0019423 | Ga0501034_0019423_49_1053 | 329 |
| 207 | 3300049572 | Ga0501036_0000689 | Ga0501036_0000689_14477_15529 | 329 |
| 208 | 3300049572 | Ga0501036_0013749 | Ga0501036_0013749_2043_3047 | 329 |
| 209 | 3300049573 | Ga0501037_0007499 | Ga0501037_0007499_3232_4236 | 329 |
| 210 | 3300049573 | Ga0501037_0126837 | Ga0501037_0126837_136_1140 | 329 |
| 211 | 3300049574 | Ga0501038_0004102 | Ga0501038_0004102_9653_10657 | 329 |
| 212 | 3300049574 | Ga0501038_0236569 | Ga0501038_0236569_355_1359 | 329 |
| 213 | 3300049575 | Ga0501039_0059755 | Ga0501039_0059755_767_1771 | 329 |
| 214 | 3300049579 | Ga0501043_0002343 | Ga0501043_0002343_8217_9269 | 329 |
| 215 | 3300049579 | Ga0501043_0032695 | Ga0501043_0032695_2119_3123 | 329 |
| 216 | 3300049580 | Ga0501046_0115613 | Ga0501046_0115613_971_1975 | 329 |
| 217 | 3300049581 | Ga0501047_0000204 | Ga0501047_0000204_38342_39394 | 329 |
| 218 | 3300049581 | Ga0501047_0006456 | Ga0501047_0006456_9590_10594 | 329 |
| 219 | 3300049581 | Ga0501047_0011147 | Ga0501047_0011147_7413_8417 | 329 |
| 220 | 3300049581 | Ga0501047_0268488 | Ga0501047_0268488_291_1295 | 329 |
| 221 | 3300049582 | Ga0501048_0000065 | Ga0501048_0000065_4663_5715 | 329 |
| 222 | 3300049582 | Ga0501048_0083602 | Ga0501048_0083602_926_1930 | 329 |
| 223 | 3300049582 | Ga0501048_0115983 | Ga0501048_0115983_10_1014 | 329 |
| 224 | 3300049583 | Ga0501067_0082272 | Ga0501067_0082272_743_1747 | 329 |
| 225 | 3300049584 | Ga0501068_0014257 | Ga0501068_0014257_851_1855 | 329 |
| 226 | 3300049585 | Ga0501069_0088964 | Ga0501069_0088964_649_1653 | 329 |
| 227 | 3300049586 | Ga0501070_0002291 | Ga0501070_0002291_3378_4430 | 329 |
| 228 | 3300049586 | Ga0501070_0012101 | Ga0501070_0012101_5877_6881 | 329 |
| 229 | 3300049588 | Ga0501072_0115487 | Ga0501072_0115487_92_1096 | 329 |
| 230 | 3300049589 | Ga0501073_0054599 | Ga0501073_0054599_247_1251 | 329 |
| 231 | 3300049590 | Ga0501074_0008526 | Ga0501074_0008526_1989_3041 | 329 |
| 232 | 3300049590 | Ga0501074_0036552 | Ga0501074_0036552_645_1649 | 329 |
| 233 | 3300049742 | Ga0501080_0000815 | Ga0501080_0000815_23212_24264 | 329 |
| 234 | 3300049742 | Ga0501080_0062194 | Ga0501080_0062194_1905_2909 | 329 |
| 235 | 3300049742 | Ga0501080_0186629 | Ga0501080_0186629_24_1028 | 329 |
| 236 | 3300049742 | Ga0501080_0485200 | Ga0501080_0485200_35_1039 | 329 |
| 237 | 3300049744 | Ga0501083_0001712 | Ga0501083_0001712_7819_8871 | 329 |
| 238 | 3300049744 | Ga0501083_0031399 | Ga0501083_0031399_1798_2802 | 329 |
| 239 | 3300049822 | Ga0501035_0025991 | Ga0501035_0025991_4079_5083 | 329 |
| 240 | 3300049822 | Ga0501035_0091494 | Ga0501035_0091494_379_1383 | 329 |
| 241 | 3300049823 | Ga0501044_0001827 | Ga0501044_0001827_14404_15456 | 329 |
| 242 | 3300049823 | Ga0501044_0016948 | Ga0501044_0016948_2724_3728 | 329 |
| 243 | 3300049824 | Ga0501045_0125873 | Ga0501045_0125873_72_1076 | 329 |
| 244 | 3300054114 | Ga0501084_0215386 | Ga0501084_0215386_48_1052 | 329 |
| 245 | 3300060353 | Ga0501082_0145737 | Ga0501082_0145737_732_1736 | 329 |
| 246 | 3300006051 | Ga0075364_10028110 | Ga0075364_100281102 | 330 |
| 247 | 3300006195 | Ga0075366_10083127 | Ga0075366_100831272 | 330 |
| 248 | 3300006353 | Ga0075370_10013741 | Ga0075370_100137412 | 330 |
| 249 | 3300039437 | Ga0436365_1342486 | Ga0436365_1342486_47_1042 | 330 |
| 250 | 3300050494 | nmdc:mga06z11_30677_c1 | nmdc:mga06z11_30677_c1_1527_2528 | 330 |
| 251 | 3300005340 | Ga0070689_100150147 | Ga0070689_1001501472 | 331 |
| 252 | 3300005841 | Ga0068863_100012588 | Ga0068863_1000125885 | 331 |
| 253 | 3300005844 | Ga0068862_100048145 | Ga0068862_1000481453 | 331 |
| 254 | 3300005844 | Ga0068862_100057387 | Ga0068862_1000573873 | 331 |
| 255 | 3300009094 | Ga0111539_10000114 | Ga0111539_1000011422 | 331 |
| 256 | 3300009094 | Ga0111539_10011997 | Ga0111539_1001199712 | 331 |
| 257 | 3300009147 | Ga0114129_10733661 | Ga0114129_107336611 | 331 |
| 258 | 3300009148 | Ga0105243_10026263 | Ga0105243_100262634 | 331 |
| 259 | 3300010375 | Ga0105239_10053091 | Ga0105239_100530914 | 331 |
| 260 | 3300013307 | Ga0157372_10222015 | Ga0157372_102220153 | 331 |
| 261 | 3300014326 | Ga0157380_10061308 | Ga0157380_100613083 | 331 |
| 262 | 3300025926 | Ga0207659_10303805 | Ga0207659_103038051 | 331 |
| 263 | 3300025931 | Ga0207644_10135404 | Ga0207644_101354042 | 331 |
| 264 | 3300025936 | Ga0207670_10108058 | Ga0207670_101080582 | 331 |
| 265 | 3300026088 | Ga0207641_10018900 | Ga0207641_100189005 | 331 |
| 266 | 3300026088 | Ga0207641_10218059 | Ga0207641_102180592 | 331 |
| 267 | 3300026095 | Ga0207676_10292850 | Ga0207676_102928502 | 331 |
| 268 | 3300026118 | Ga0207675_100458862 | Ga0207675_1004588622 | 331 |
| 269 | 3300031824 | Ga0307413_10306885 | Ga0307413_103068851 | 331 |
| 270 | 3300031903 | Ga0307407_10110147 | Ga0307407_101101471 | 331 |
| 271 | 3300031911 | Ga0307412_10223124 | Ga0307412_102231241 | 331 |
| 272 | 3300031995 | Ga0307409_100523351 | Ga0307409_1005233511 | 331 |
| 273 | 3300032004 | Ga0307414_10319916 | Ga0307414_103199161 | 331 |
| 274 | 3300034816 | Ga0373930_0001628 | Ga0373930_0001628_2102_3097 | 331 |
| 275 | 3300034817 | Ga0373948_0000403 | Ga0373948_0000403_1036_2031 | 331 |
| 276 | 3300034818 | Ga0373950_0000200 | Ga0373950_0000200_6411_7406 | 331 |
| 277 | 3300034820 | Ga0373959_0001588 | Ga0373959_0001588_2213_3208 | 331 |
| 278 | 3300034957 | Ga0373938_0000844 | Ga0373938_0000844_79_1074 | 331 |
| 279 | 3300035084 | Ga0373928_0000443 | Ga0373928_0000443_2673_3668 | 331 |
| 280 | 3300035085 | Ga0373929_0000756 | Ga0373929_0000756_4512_5507 | 331 |
| 281 | 3300035088 | Ga0373940_0000018 | Ga0373940_0000018_15600_16595 | 331 |
| 282 | 3300035090 | Ga0373949_0003205 | Ga0373949_0003205_2768_3763 | 331 |
| 283 | 3300035092 | Ga0373952_0000228 | Ga0373952_0000228_4341_5336 | 331 |
| 284 | 3300035112 | Ga0373932_0000155 | Ga0373932_0000155_2473_3468 | 331 |
| 285 | 3300035115 | Ga0373941_0001756 | Ga0373941_0001756_3268_4263 | 331 |
| 286 | 3300035121 | Ga0373960_0000061 | Ga0373960_0000061_369_1364 | 331 |
| 287 | 3300035207 | Ga0373942_0002062 | Ga0373942_0002062_1504_2499 | 331 |
| 288 | 3300035241 | Ga0373961_0000451 | Ga0373961_0000451_4226_5221 | 331 |
| 289 | 3300035242 | Ga0373962_0000409 | Ga0373962_0000409_6649_7644 | 331 |
| 290 | 3300035691 | Ga0373931_0020850 | Ga0373931_0020850_407_1402 | 331 |
| 291 | 3300042005 | Ga0439448_0025513 | Ga0439448_0025513_28_1023 | 331 |
| 292 | 3300042016 | Ga0439463_028313 | Ga0439463_028313_387_1382 | 331 |
| 293 | 3300042439 | Ga0439464_0014054 | Ga0439464_0014054_958_1953 | 331 |
| 294 | 3300045051 | Ga0451576_0058905 | Ga0451576_0058905_1383_2378 | 331 |
| 295 | 3300048904 | Ga0496101_0118117 | Ga0496101_0118117_295_1290 | 331 |
| 296 | 3300048905 | Ga0496102_0110070 | Ga0496102_0110070_965_1960 | 331 |
| 297 | 3300048906 | Ga0496103_0092071 | Ga0496103_0092071_205_1200 | 331 |
| 298 | 3300048909 | Ga0496106_0046270 | Ga0496106_0046270_342_1337 | 331 |
| 299 | 3300048910 | Ga0496107_0018653 | Ga0496107_0018653_3158_4153 | 331 |
| 300 | 3300048910 | Ga0496107_0249197 | Ga0496107_0249197_226_1221 | 331 |
| 301 | 3300049570 | Ga0501033_0020592 | Ga0501033_0020592_3214_4293 | 331 |
| 302 | 3300049584 | Ga0501068_0005601 | Ga0501068_0005601_3677_4756 | 331 |
| 303 | 3300049586 | Ga0501070_0031140 | Ga0501070_0031140_546_1625 | 331 |
| 304 | 3300050489 | nmdc:mga03683_33286_c1 | nmdc:mga03683_33286_c1_517_1515 | 331 |
| 305 | 3300050492 | nmdc:mga0yw44_56388_c1 | nmdc:mga0yw44_56388_c1_415_1413 | 331 |
| 306 | 3300050493 | nmdc:mga0k408_39815_c1 | nmdc:mga0k408_39815_c1_122_1120 | 331 |
| 307 | 3300050493 | nmdc:mga0k408_78503_c1 | nmdc:mga0k408_78503_c1_268_1266 | 331 |
| 308 | 3300050511 | nmdc:mga08y16_28547_c1 | nmdc:mga08y16_28547_c1_2400_3395 | 331 |
| 309 | 3300050511 | nmdc:mga08y16_8011_c1 | nmdc:mga08y16_8011_c1_708_1703 | 331 |
| 310 | 3300050512 | nmdc:mga0n895_157457_c1 | nmdc:mga0n895_157457_c1_44_1039 | 331 |
| 311 | 3300005337 | Ga0070682_100035457 | Ga0070682_1000354573 | 332 |
| 312 | 3300005564 | Ga0070664_100041115 | Ga0070664_1000411152 | 332 |
| 313 | 3300005614 | Ga0068856_100587956 | Ga0068856_1005879561 | 332 |
| 314 | 3300005336 | Ga0070680_100000933 | Ga0070680_1000009338 | 333 |
| 315 | 3300005341 | Ga0070691_10009000 | Ga0070691_100090003 | 333 |
| 316 | 3300005458 | Ga0070681_10157011 | Ga0070681_101570112 | 333 |
| 317 | 3300005530 | Ga0070679_100009132 | Ga0070679_1000091327 | 333 |
| 318 | 3300005563 | Ga0068855_100295627 | Ga0068855_1002956272 | 333 |
| 319 | 3300009093 | Ga0105240_10004752 | Ga0105240_1000475212 | 333 |
| 320 | 3300025913 | Ga0207695_10009523 | Ga0207695_100095233 | 333 |
| 321 | 3300025921 | Ga0207652_10006590 | Ga0207652_100065903 | 333 |
| 322 | 3300025949 | Ga0207667_10007731 | Ga0207667_100077318 | 333 |
| 323 | 3300026116 | Ga0207674_10235200 | Ga0207674_102352002 | 333 |
| 324 | 3300035692 | Ga0373935_0033212 | Ga0373935_0033212_1780_2784 | 333 |
| 325 | 2209111006 | 2214800760 | 2213830111 | 334 |
| 326 | 3300000042 | ARSoilYngRDRAFT_c00057 | ARSoilYngRDRAFT_000574 | 334 |
| 327 | 3300000043 | ARcpr5yngRDRAFT_c000673 | ARcpr5yngRDRAFT_0006732 | 334 |
| 328 | 3300000044 | ARSoilOldRDRAFT_c000044 | ARSoilOldRDRAFT_00004418 | 334 |
| 329 | 3300000652 | ARCol0yngRDRAFT_1000153 | ARCol0yngRDRAFT_10001534 | 334 |
| 330 | 3300005276 | Ga0065717_1002193 | Ga0065717_10021932 | 334 |
| 331 | 3300005277 | Ga0065716_1001695 | Ga0065716_10016952 | 334 |
| 332 | 3300005289 | Ga0065704_10084341 | Ga0065704_100843412 | 334 |
| 333 | 3300005293 | Ga0065715_10001318 | Ga0065715_100013183 | 334 |
| 334 | 3300005328 | Ga0070676_10113303 | Ga0070676_101133031 | 334 |
| 335 | 3300005329 | Ga0070683_100115860 | Ga0070683_1001158602 | 334 |
| 336 | 3300005333 | Ga0070677_10020348 | Ga0070677_100203482 | 334 |
| 337 | 3300005333 | Ga0070677_10098690 | Ga0070677_100986901 | 334 |
| 338 | 3300005336 | Ga0070680_100003206 | Ga0070680_1000032066 | 334 |
| 339 | 3300005336 | Ga0070680_100169296 | Ga0070680_1001692963 | 334 |
| 340 | 3300005339 | Ga0070660_100267836 | Ga0070660_1002678361 | 334 |
| 341 | 3300005340 | Ga0070689_100017381 | Ga0070689_1000173813 | 334 |
| 342 | 3300005341 | Ga0070691_10025475 | Ga0070691_100254753 | 334 |
| 343 | 3300005344 | Ga0070661_100128324 | Ga0070661_1001283242 | 334 |
| 344 | 3300005347 | Ga0070668_100017292 | Ga0070668_1000172921 | 334 |
| 345 | 3300005347 | Ga0070668_100136857 | Ga0070668_1001368571 | 334 |
| 346 | 3300005347 | Ga0070668_100150793 | Ga0070668_1001507931 | 334 |
| 347 | 3300005353 | Ga0070669_100059437 | Ga0070669_1000594373 | 334 |
| 348 | 3300005354 | Ga0070675_100296524 | Ga0070675_1002965242 | 334 |
| 349 | 3300005364 | Ga0070673_100481900 | Ga0070673_1004819001 | 334 |
| 350 | 3300005365 | Ga0070688_100001879 | Ga0070688_1000018798 | 334 |
| 351 | 3300005366 | Ga0070659_100023236 | Ga0070659_1000232363 | 334 |
| 352 | 3300005406 | Ga0070703_10000746 | Ga0070703_100007463 | 334 |
| 353 | 3300005434 | Ga0070709_10188712 | Ga0070709_101887122 | 334 |
| 354 | 3300005436 | Ga0070713_100075891 | Ga0070713_1000758912 | 334 |
| 355 | 3300005440 | Ga0070705_100000029 | Ga0070705_10000002969 | 334 |
| 356 | 3300005440 | Ga0070705_100113402 | Ga0070705_1001134022 | 334 |
| 357 | 3300005441 | Ga0070700_100001497 | Ga0070700_10000149710 | 334 |
| 358 | 3300005441 | Ga0070700_100015163 | Ga0070700_1000151635 | 334 |
| 359 | 3300005444 | Ga0070694_100000652 | Ga0070694_10000065214 | 334 |
| 360 | 3300005445 | Ga0070708_100002320 | Ga0070708_1000023202 | 334 |
| 361 | 3300005455 | Ga0070663_100008847 | Ga0070663_1000088472 | 334 |
| 362 | 3300005455 | Ga0070663_100023132 | Ga0070663_1000231322 | 334 |
| 363 | 3300005456 | Ga0070678_100092721 | Ga0070678_1000927211 | 334 |
| 364 | 3300005457 | Ga0070662_100003081 | Ga0070662_10000308112 | 334 |
| 365 | 3300005457 | Ga0070662_100013722 | Ga0070662_1000137223 | 334 |
| 366 | 3300005458 | Ga0070681_10038482 | Ga0070681_100384824 | 334 |
| 367 | 3300005458 | Ga0070681_10192388 | Ga0070681_101923883 | 334 |
| 368 | 3300005459 | Ga0068867_100017486 | Ga0068867_1000174862 | 334 |
| 369 | 3300005459 | Ga0068867_100117012 | Ga0068867_1001170123 | 334 |
| 370 | 3300005467 | Ga0070706_100021874 | Ga0070706_1000218743 | 334 |
| 371 | 3300005468 | Ga0070707_100135285 | Ga0070707_1001352852 | 334 |
| 372 | 3300005471 | Ga0070698_100002091 | Ga0070698_10000209123 | 334 |
| 373 | 3300005507 | Ga0074259_11019792 | Ga0074259_110197922 | 334 |
| 374 | 3300005518 | Ga0070699_100000947 | Ga0070699_10000094724 | 334 |
| 375 | 3300005518 | Ga0070699_100013134 | Ga0070699_1000131343 | 334 |
| 376 | 3300005518 | Ga0070699_100207974 | Ga0070699_1002079741 | 334 |
| 377 | 3300005530 | Ga0070679_100057578 | Ga0070679_1000575782 | 334 |
| 378 | 3300005536 | Ga0070697_100187495 | Ga0070697_1001874952 | 334 |
| 379 | 3300005539 | Ga0068853_100083026 | Ga0068853_1000830263 | 334 |
| 380 | 3300005543 | Ga0070672_100101954 | Ga0070672_1001019543 | 334 |
| 381 | 3300005545 | Ga0070695_100006175 | Ga0070695_1000061755 | 334 |
| 382 | 3300005546 | Ga0070696_100001966 | Ga0070696_1000019663 | 334 |
| 383 | 3300005546 | Ga0070696_100016707 | Ga0070696_1000167075 | 334 |
| 384 | 3300005546 | Ga0070696_100081234 | Ga0070696_1000812342 | 334 |
| 385 | 3300005547 | Ga0070693_100097099 | Ga0070693_1000970992 | 334 |
| 386 | 3300005549 | Ga0070704_100000624 | Ga0070704_1000006247 | 334 |
| 387 | 3300005549 | Ga0070704_100005471 | Ga0070704_1000054712 | 334 |
| 388 | 3300005564 | Ga0070664_100015069 | Ga0070664_1000150697 | 334 |
| 389 | 3300005577 | Ga0068857_100025254 | Ga0068857_1000252543 | 334 |
| 390 | 3300005578 | Ga0068854_100241517 | Ga0068854_1002415172 | 334 |
| 391 | 3300005616 | Ga0068852_100414326 | Ga0068852_1004143262 | 334 |
| 392 | 3300005617 | Ga0068859_100032215 | Ga0068859_1000322154 | 334 |
| 393 | 3300005617 | Ga0068859_100134543 | Ga0068859_1001345431 | 334 |
| 394 | 3300005719 | Ga0068861_100107550 | Ga0068861_1001075503 | 334 |
| 395 | 3300005841 | Ga0068863_100204759 | Ga0068863_1002047592 | 334 |
| 396 | 3300005843 | Ga0068860_100009593 | Ga0068860_1000095936 | 334 |
| 397 | 3300005844 | Ga0068862_100000691 | Ga0068862_10000069126 | 334 |
| 398 | 3300005844 | Ga0068862_100066585 | Ga0068862_1000665851 | 334 |
| 399 | 3300005983 | Ga0081540_1001830 | Ga0081540_100183011 | 334 |
| 400 | 3300006028 | Ga0070717_10275687 | Ga0070717_102756872 | 334 |
| 401 | 3300006173 | Ga0070716_100079022 | Ga0070716_1000790222 | 334 |
| 402 | 3300006358 | Ga0068871_100310511 | Ga0068871_1003105112 | 334 |
| 403 | 3300006871 | Ga0075434_100152364 | Ga0075434_1001523643 | 334 |
| 404 | 3300006881 | Ga0068865_100148051 | Ga0068865_1001480511 | 334 |
| 405 | 3300006914 | Ga0075436_100125947 | Ga0075436_1001259472 | 334 |
| 406 | 3300006931 | Ga0097620_100032216 | Ga0097620_1000322164 | 334 |
| 407 | 3300006931 | Ga0097620_100134544 | Ga0097620_1001345441 | 334 |
| 408 | 3300009553 | Ga0105249_10001774 | Ga0105249_100017748 | 334 |
| 409 | 3300012481 | Ga0157320_1000654 | Ga0157320_10006541 | 334 |
| 410 | 3300012507 | Ga0157342_1000297 | Ga0157342_10002972 | 334 |
| 411 | 3300012515 | Ga0157338_1000224 | Ga0157338_10002242 | 334 |
| 412 | 3300013105 | Ga0157369_10051616 | Ga0157369_100516165 | 334 |
| 413 | 3300013307 | Ga0157372_10043914 | Ga0157372_100439143 | 334 |
| 414 | 3300013308 | Ga0157375_10022576 | Ga0157375_100225762 | 334 |
| 415 | 3300017792 | Ga0163161_10003601 | Ga0163161_1000360112 | 334 |
| 416 | 3300025271 | Ga0207666_1000497 | Ga0207666_10004972 | 334 |
| 417 | 3300025297 | Ga0209758_1001507 | Ga0209758_100150716 | 334 |
| 418 | 3300025315 | Ga0207697_10021107 | Ga0207697_100211073 | 334 |
| 419 | 3300025901 | Ga0207688_10046379 | Ga0207688_100463792 | 334 |
| 420 | 3300025901 | Ga0207688_10078506 | Ga0207688_100785062 | 334 |
| 421 | 3300025904 | Ga0207647_10008867 | Ga0207647_100088677 | 334 |
| 422 | 3300025907 | Ga0207645_10058475 | Ga0207645_100584751 | 334 |
| 423 | 3300025910 | Ga0207684_10025016 | Ga0207684_100250163 | 334 |
| 424 | 3300025910 | Ga0207684_10063778 | Ga0207684_100637782 | 334 |
| 425 | 3300025910 | Ga0207684_10141231 | Ga0207684_101412313 | 334 |
| 426 | 3300025917 | Ga0207660_10009390 | Ga0207660_100093904 | 334 |
| 427 | 3300025917 | Ga0207660_10069481 | Ga0207660_100694813 | 334 |
| 428 | 3300025918 | Ga0207662_10026368 | Ga0207662_100263682 | 334 |
| 429 | 3300025919 | Ga0207657_10058340 | Ga0207657_100583402 | 334 |
| 430 | 3300025919 | Ga0207657_10177378 | Ga0207657_101773782 | 334 |
| 431 | 3300025920 | Ga0207649_10070306 | Ga0207649_100703062 | 334 |
| 432 | 3300025921 | Ga0207652_10041610 | Ga0207652_100416103 | 334 |
| 433 | 3300025921 | Ga0207652_10115192 | Ga0207652_101151922 | 334 |
| 434 | 3300025923 | Ga0207681_10015114 | Ga0207681_100151142 | 334 |
| 435 | 3300025923 | Ga0207681_10229423 | Ga0207681_102294232 | 334 |
| 436 | 3300025928 | Ga0207700_10264924 | Ga0207700_102649242 | 334 |
| 437 | 3300025932 | Ga0207690_10008048 | Ga0207690_100080481 | 334 |
| 438 | 3300025933 | Ga0207706_10009628 | Ga0207706_100096286 | 334 |
| 439 | 3300025933 | Ga0207706_10026463 | Ga0207706_100264632 | 334 |
| 440 | 3300025935 | Ga0207709_10164511 | Ga0207709_101645111 | 334 |
| 441 | 3300025936 | Ga0207670_10023433 | Ga0207670_100234333 | 334 |
| 442 | 3300025938 | Ga0207704_10069375 | Ga0207704_100693753 | 334 |
| 443 | 3300025940 | Ga0207691_10088334 | Ga0207691_100883343 | 334 |
| 444 | 3300025944 | Ga0207661_10125311 | Ga0207661_101253112 | 334 |
| 445 | 3300025945 | Ga0207679_10007601 | Ga0207679_100076012 | 334 |
| 446 | 3300025961 | Ga0207712_10025372 | Ga0207712_100253723 | 334 |
| 447 | 3300025972 | Ga0207668_10018538 | Ga0207668_100185382 | 334 |
| 448 | 3300025972 | Ga0207668_10311279 | Ga0207668_103112791 | 334 |
| 449 | 3300026035 | Ga0207703_10378494 | Ga0207703_103784941 | 334 |
| 450 | 3300026041 | Ga0207639_10045997 | Ga0207639_100459972 | 334 |
| 451 | 3300026067 | Ga0207678_10003426 | Ga0207678_1000342610 | 334 |
| 452 | 3300026067 | Ga0207678_10021702 | Ga0207678_100217022 | 334 |
| 453 | 3300026067 | Ga0207678_10186960 | Ga0207678_101869602 | 334 |
| 454 | 3300026075 | Ga0207708_10005456 | Ga0207708_100054563 | 334 |
| 455 | 3300026075 | Ga0207708_10005844 | Ga0207708_100058449 | 334 |
| 456 | 3300026075 | Ga0207708_10007962 | Ga0207708_100079628 | 334 |
| 457 | 3300026088 | Ga0207641_10174243 | Ga0207641_101742432 | 334 |
| 458 | 3300026089 | Ga0207648_10052305 | Ga0207648_100523052 | 334 |
| 459 | 3300026116 | Ga0207674_10009358 | Ga0207674_100093583 | 334 |
| 460 | 3300026116 | Ga0207674_10082438 | Ga0207674_100824382 | 334 |
| 461 | 3300026118 | Ga0207675_100056667 | Ga0207675_1000566673 | 334 |
| 462 | 3300026118 | Ga0207675_100066051 | Ga0207675_1000660512 | 334 |
| 463 | 3300026121 | Ga0207683_10021746 | Ga0207683_100217462 | 334 |
| 464 | 3300026121 | Ga0207683_10179745 | Ga0207683_101797452 | 334 |
| 465 | 3300026142 | Ga0207698_10049585 | Ga0207698_100495852 | 334 |
| 466 | 3300027695 | Ga0209966_1001307 | Ga0209966_10013072 | 334 |
| 467 | 3300027717 | Ga0209998_10001451 | Ga0209998_100014517 | 334 |
| 468 | 3300027717 | Ga0209998_10003218 | Ga0209998_100032183 | 334 |
| 469 | 3300027876 | Ga0209974_10018298 | Ga0209974_100182982 | 334 |
| 470 | 3300027876 | Ga0209974_10021058 | Ga0209974_100210582 | 334 |
| 471 | 3300027907 | Ga0207428_10000255 | Ga0207428_1000025559 | 334 |
| 472 | 3300027907 | Ga0207428_10050828 | Ga0207428_100508282 | 334 |
| 473 | 3300028380 | Ga0268265_10003089 | Ga0268265_100030897 | 334 |
| 474 | 3300028381 | Ga0268264_10003127 | Ga0268264_100031274 | 334 |
| 475 | 3300031238 | Ga0265332_10025356 | Ga0265332_100253562 | 334 |
| 476 | 3300031241 | Ga0265325_10000708 | Ga0265325_1000070811 | 334 |
| 477 | 3300031595 | Ga0265313_10009620 | Ga0265313_100096203 | 334 |
| 478 | 3300031911 | Ga0307412_10175021 | Ga0307412_101750211 | 334 |
| 479 | 3300031995 | Ga0307409_100263115 | Ga0307409_1002631151 | 334 |
| 480 | 3300032005 | Ga0307411_10314804 | Ga0307411_103148041 | 334 |
| 481 | 3300035111 | Ga0373923_0010688 | Ga0373923_0010688_606_1613 | 334 |
| 482 | 3300035113 | Ga0373936_0001591 | Ga0373936_0001591_1922_2929 | 334 |
| 483 | 3300035113 | Ga0373936_0004284 | Ga0373936_0004284_3290_4297 | 334 |
| 484 | 3300035117 | Ga0373953_0022944 | Ga0373953_0022944_1330_2337 | 334 |
| 485 | 3300035118 | Ga0373954_0020778 | Ga0373954_0020778_1588_2595 | 334 |
| 486 | 3300035170 | Ga0373943_0001108 | Ga0373943_0001108_3227_4234 | 334 |
| 487 | 3300035171 | Ga0373946_0001186 | Ga0373946_0001186_4162_5169 | 334 |
| 488 | 3300035172 | Ga0373955_0008613 | Ga0373955_0008613_2339_3346 | 334 |
| 489 | 3300035410 | Ga0373924_0014055 | Ga0373924_0014055_1266_2273 | 334 |
| 490 | 3300035692 | Ga0373935_0003508 | Ga0373935_0003508_3955_4962 | 334 |
| 491 | 3300035695 | Ga0373927_0002017 | Ga0373927_0002017_4162_5169 | 334 |
| 492 | 3300035724 | Ga0373933_0022312 | Ga0373933_0022312_460_1467 | 334 |
| 493 | 3300035725 | Ga0373947_0016168 | Ga0373947_0016168_2592_3599 | 334 |
| 494 | 3300036401 | Ga0373937_0215916 | Ga0373937_0215916_787_1794 | 334 |
| 495 | 3300036401 | Ga0373937_0455248 | Ga0373937_0455248_169_1179 | 334 |
| 496 | 3300037068 | Ga0373925_0004980 | Ga0373925_0004980_4805_5812 | 334 |
| 497 | 3300041509 | Ga0451843_0100024 | Ga0451843_0100024_305_1312 | 334 |
| 498 | 3300046454 | Ga0495592_0006155 | Ga0495592_0006155_1470_2477 | 334 |
| 499 | 3300046459 | Ga0495629_0005121 | Ga0495629_0005121_6393_7400 | 334 |
| 500 | 3300046461 | Ga0495641_0003638 | Ga0495641_0003638_8605_9612 | 334 |
| 501 | 3300046461 | Ga0495641_0089976 | Ga0495641_0089976_319_1326 | 334 |
| 502 | 3300046462 | Ga0495651_0002175 | Ga0495651_0002175_7404_8411 | 334 |
| 503 | 3300046463 | Ga0495653_0002883 | Ga0495653_0002883_4932_5939 | 334 |
| 504 | 3300046463 | Ga0495653_0045259 | Ga0495653_0045259_1363_2370 | 334 |
| 505 | 3300046472 | Ga0495580_0012164 | Ga0495580_0012164_990_1997 | 334 |
| 506 | 3300046473 | Ga0495582_0002391 | Ga0495582_0002391_5836_6843 | 334 |
| 507 | 3300046475 | Ga0495639_0000713 | Ga0495639_0000713_4230_5237 | 334 |
| 508 | 3300046476 | Ga0495662_0000084 | Ga0495662_0000084_4134_5141 | 334 |
| 509 | 3300046477 | Ga0495664_0000482 | Ga0495664_0000482_16721_17728 | 334 |
| 510 | 3300046477 | Ga0495664_0059591 | Ga0495664_0059591_189_1196 | 334 |
| 511 | 3300046492 | Ga0495585_0032653 | Ga0495585_0032653_424_1431 | 334 |
| 512 | 3300046499 | Ga0495594_0008249 | Ga0495594_0008249_1763_2770 | 334 |
| 513 | 3300046514 | Ga0495618_0004433 | Ga0495618_0004433_5037_6044 | 334 |
| 514 | 3300046516 | Ga0495628_0007423 | Ga0495628_0007423_6408_7415 | 334 |
| 515 | 3300046516 | Ga0495628_0018284 | Ga0495628_0018284_743_1750 | 334 |
| 516 | 3300046517 | Ga0495630_0001951 | Ga0495630_0001951_1979_2986 | 334 |
| 517 | 3300046517 | Ga0495630_0006736 | Ga0495630_0006736_2720_3727 | 334 |
| 518 | 3300046517 | Ga0495630_0129648 | Ga0495630_0129648_425_1432 | 334 |
| 519 | 3300046519 | Ga0495632_0056324 | Ga0495632_0056324_883_1890 | 334 |
| 520 | 3300046526 | Ga0495666_0004463 | Ga0495666_0004463_2617_3624 | 334 |
| 521 | 3300046529 | Ga0495652_0007683 | Ga0495652_0007683_6393_7400 | 334 |
| 522 | 3300046531 | Ga0495665_0002359 | Ga0495665_0002359_1608_2615 | 334 |
| 523 | 3300046531 | Ga0495665_0024936 | Ga0495665_0024936_1611_2618 | 334 |
| 524 | 3300046533 | Ga0495640_0007345 | Ga0495640_0007345_4945_5952 | 334 |
| 525 | 3300046533 | Ga0495640_0043685 | Ga0495640_0043685_1823_2830 | 334 |
| 526 | 3300046536 | Ga0495587_0010083 | Ga0495587_0010083_3941_4948 | 334 |
| 527 | 3300046543 | Ga0495645_0046268 | Ga0495645_0046268_220_1227 | 334 |
| 528 | 3300046557 | Ga0495622_0069760 | Ga0495622_0069760_543_1550 | 334 |
| 529 | 3300046558 | Ga0495633_0035702 | Ga0495633_0035702_83_1090 | 334 |
| 530 | 3300046559 | Ga0495667_0000202 | Ga0495667_0000202_9028_10035 | 334 |
| 531 | 3300046559 | Ga0495667_0035082 | Ga0495667_0035082_1020_2027 | 334 |
| 532 | 3300046559 | Ga0495667_0086742 | Ga0495667_0086742_541_1548 | 334 |
| 533 | 3300046615 | Ga0495656_0105891 | Ga0495656_0105891_196_1203 | 334 |
| 534 | 3300046642 | Ga0495634_0005317 | Ga0495634_0005317_6521_7528 | 334 |
| 535 | 3300046660 | Ga0495625_0035683 | Ga0495625_0035683_460_1467 | 334 |
| 536 | 3300046660 | Ga0495625_0037749 | Ga0495625_0037749_440_1447 | 334 |
| 537 | 3300046663 | Ga0495635_0000399 | Ga0495635_0000399_7449_8456 | 334 |
| 538 | 3300046675 | Ga0495657_0001733 | Ga0495657_0001733_2859_3866 | 334 |
| 539 | 3300046678 | Ga0495599_0004717 | Ga0495599_0004717_4049_5056 | 334 |
| 540 | 3300046680 | Ga0495646_0003722 | Ga0495646_0003722_8316_9323 | 334 |
| 541 | 3300046681 | Ga0495647_0004315 | Ga0495647_0004315_1534_2541 | 334 |
| 542 | 3300046683 | Ga0495658_0008581 | Ga0495658_0008581_1534_2541 | 334 |
| 543 | 3300046689 | Ga0495613_0001462 | Ga0495613_0001462_11262_12269 | 334 |
| 544 | 3300046689 | Ga0495613_0008236 | Ga0495613_0008236_6036_7043 | 334 |
| 545 | 3300046690 | Ga0495624_0000222 | Ga0495624_0000222_34274_35281 | 334 |
| 546 | 3300046690 | Ga0495624_0041636 | Ga0495624_0041636_1057_2064 | 334 |
| 547 | 3300046691 | Ga0495670_0000837 | Ga0495670_0000837_1614_2621 | 334 |
| 548 | 3300046809 | Ga0495600_0002124 | Ga0495600_0002124_1202_2209 | 334 |
| 549 | 3300046809 | Ga0495600_0003235 | Ga0495600_0003235_5938_6945 | 334 |
| 550 | 3300047315 | Ga0495581_0000145 | Ga0495581_0000145_21673_22680 | 334 |
| 551 | 3300047317 | Ga0495604_0005816 | Ga0495604_0005816_5589_6596 | 334 |
| 552 | 3300047317 | Ga0495604_0086560 | Ga0495604_0086560_509_1516 | 334 |
| 553 | 3300047319 | Ga0495674_0007404 | Ga0495674_0007404_4134_5141 | 334 |
| 554 | 3300047319 | Ga0495674_0015727 | Ga0495674_0015727_1915_2922 | 334 |
| 555 | 3300047321 | Ga0495676_0020974 | Ga0495676_0020974_550_1557 | 334 |
| 556 | 3300047322 | Ga0495680_0001864 | Ga0495680_0001864_11629_12636 | 334 |
| 557 | 3300047471 | Ga0495684_0000075 | Ga0495684_0000075_33247_34254 | 334 |
| 558 | 3300047673 | Ga0495593_0000228 | Ga0495593_0000228_25162_26169 | 334 |
| 559 | 3300048905 | Ga0496102_0004792 | Ga0496102_0004792_5533_6654 | 334 |
| 560 | 3300048907 | Ga0496104_0000061 | Ga0496104_0000061_106930_107934 | 334 |
| 561 | 3300048909 | Ga0496106_0000300 | Ga0496106_0000300_3055_4176 | 334 |
| 562 | 3300048910 | Ga0496107_0002193 | Ga0496107_0002193_9366_10487 | 334 |
| 563 | 3300048918 | Ga0496115_0051521 | Ga0496115_0051521_235_1239 | 334 |
| 564 | 3300050507 | nmdc:mga05p37_208054_c1 | nmdc:mga05p37_208054_c1_930_1937 | 334 |
| 565 | 3300053077 | Ga0495601_0010704 | Ga0495601_0010704_818_1825 | 334 |
| 566 | 3300053078 | Ga0495612_0001242 | Ga0495612_0001242_3931_4938 | 334 |
| 567 | 3300053078 | Ga0495612_0063252 | Ga0495612_0063252_324_1331 | 334 |
| 568 | 3300053084 | Ga0495595_0000988 | Ga0495595_0000988_4365_5372 | 334 |
| 569 | 3300053084 | Ga0495595_0013080 | Ga0495595_0013080_1413_2420 | 334 |
| 570 | 3300053085 | Ga0495619_0001117 | Ga0495619_0001117_8756_9763 | 334 |
| 571 | 3300053085 | Ga0495619_0043241 | Ga0495619_0043241_747_1754 | 334 |
| 572 | 3300053087 | Ga0500643_000795 | Ga0500643_000795_8481_9488 | 334 |
| 573 | 3300053093 | Ga0500651_0014672 | Ga0500651_0014672_1938_2945 | 334 |
| 574 | 3300053094 | Ga0500566_0127711 | Ga0500566_0127711_43_1050 | 334 |
| 575 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_326650_327657 | 334 |
| 576 | 3300053151 | Ga0500604_0043800 | Ga0500604_0043800_274_1281 | 334 |
| 577 | 3300053178 | Ga0500637_0030651 | Ga0500637_0030651_1731_2741 | 334 |
| 578 | 3300053730 | Ga0500645_000015 | Ga0500645_000015_143213_144220 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pfr-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered | 0.9115 | 88 | 334 |
| 4pfr-assembly2.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3541, target efi-510203), apo open partially disordered | 0.9077 | 88 | 334 |
| 4pfi-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from marinobacter aquaeolei vt8 (maqu_2829, target efi-510133), apo open structure | 0.9064 | 30 | 330 |
| 4p47-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket | 0.9014 | 27 | 333 |
| 4ng7-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899), target efi-510094, apo, open structure | 0.9003 | 33 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p47A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9013 | 27 | 333 | 3.40.190.170 |
| 4ng7A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9003 | 33 | 331 | 3.40.190.170 |
| 4pfiA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8999 | 30 | 330 | 3.40.190.170 |
| 4pfiA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8914 | 30 | 330 | 3.40.190.170 |
| 4pfrA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8913 | 31 | 334 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A416Z4W9-F1-model_v4 | deleted | 0.9458 | 29 | 334 |
|
| AF-A0A373PRQ1-F1-model_v4 | deleted | 0.9201 | 110 | 331 |
|
| AF-A0A841PW79-F1-model_v4 | Tripartite ATP-independent transporter DctP family solute receptor | 0.9108 | 28 | 331 |
GO:0030288
GO:0055085 |
| AF-A0A6P5P1F9-F1-model_v4 | deleted | 0.91 | 72 | 331 |
|
| AF-A0A101W8W5-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.909 | 27 | 333 |
GO:0030288
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar