F465701

General Info

Members Datasets Scaffolds Average Seq Length
578 272 1156 126

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100335399|Ga0070708_1003353992
Length 149
Sequence MTPTTAVVVGVFLEPDEASETMMSRFFWICLGGAAGTGARYVLSGWALRALGTGFPYGTLAVNVLGSFAVGLLMQVGLTTPLMSPTLRLSLTTGVMGGFTTYSTFNYETIRYIQDGAWLLAVANIGVTLLACLAAGFAGLAVGRALIGG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
196 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
250 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
251 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 3.63
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 15.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100335399 3300005445 Bacteria 1425
2 rootL2_10039738 3300003322 Bacteria 4276
3 Ga0070658_10081130 3300005327 Bacteria 2664
4 Ga0070676_10021306 3300005328 Bacteria 3628
5 Ga0070676_10830545 3300005328 Unclassified 684
6 Ga0070690_100035165 3300005330 Bacteria 3143
7 Ga0070690_101295838 3300005330 Unclassified 583
8 Ga0070670_100029376 3300005331 Bacteria 4732
9 Ga0070670_101251760 3300005331 Unclassified 679
10 Ga0068869_100039698 3300005334 Bacteria 3362
11 Ga0068869_100086833 3300005334 Bacteria 2346
12 Ga0070666_10001044 3300005335 Bacteria 16951
13 Ga0070666_10014491 3300005335 Bacteria 5021
14 Ga0070680_100419102 3300005336 Bacteria 1142
15 Ga0070682_100064938 3300005337 Bacteria 2318
16 Ga0068868_100006709 3300005338 Bacteria 8169
17 Ga0068868_100458458 3300005338 Unclassified 1110
18 Ga0068868_100847187 3300005338 Bacteria 828
19 Ga0070660_100047528 3300005339 Bacteria 3293
20 Ga0070689_100017841 3300005340 Bacteria 5217
21 Ga0070692_10002302 3300005345 Bacteria 7355
22 Ga0070692_11172625 3300005345 Unclassified 546
23 Ga0070669_100082843 3300005353 Bacteria 2392
24 Ga0070669_100129549 3300005353 Bacteria 1934
25 Ga0070669_100893937 3300005353 Bacteria 758
26 Ga0070675_100016337 3300005354 Bacteria 5889
27 Ga0070675_100020078 3300005354 Bacteria 5330
28 Ga0070675_100050849 3300005354 Bacteria 3404
29 Ga0070671_100023535 3300005355 Bacteria 5042
30 Ga0070671_100569855 3300005355 Bacteria 977
31 Ga0070671_100605405 3300005355 Unclassified 947
32 Ga0070671_101780799 3300005355 Bacteria 547
33 Ga0070674_100028856 3300005356 Unclassified 3647
34 Ga0070674_100043113 3300005356 Bacteria 3068
35 Ga0070674_100197561 3300005356 Bacteria 1551
36 Ga0070674_101917258 3300005356 Bacteria 539
37 Ga0070673_100063301 3300005364 Bacteria 2943
38 Ga0070673_100561330 3300005364 Bacteria 1038
39 Ga0070688_100011679 3300005365 Bacteria 4889
40 Ga0070688_100071042 3300005365 Bacteria 2228
41 Ga0070659_100077187 3300005366 Bacteria 2656
42 Ga0070667_100023503 3300005367 Bacteria 5115
43 Ga0070667_100035349 3300005367 Bacteria 4184
44 Ga0070667_100309365 3300005367 Bacteria 1424
45 Ga0070667_100918013 3300005367 Bacteria 815
46 Ga0070667_101502137 3300005367 Unclassified 633
47 Ga0070667_101655669 3300005367 Bacteria 602
48 Ga0070703_10051407 3300005406 Bacteria 1319
49 Ga0070709_11615971 3300005434 Bacteria 528
50 Ga0070701_10034760 3300005438 Bacteria 2527
51 Ga0070701_10102128 3300005438 Bacteria 1590
52 Ga0070705_100048410 3300005440 Bacteria 2462
53 Ga0070705_100752228 3300005440 Bacteria 771
54 Ga0070705_101111824 3300005440 Bacteria 647
55 Ga0070700_100041169 3300005441 Bacteria 2832
56 Ga0070700_100099651 3300005441 Bacteria 1912
57 Ga0070700_100324304 3300005441 Bacteria 1133
58 Ga0070694_100006631 3300005444 Bacteria 7036
59 Ga0070694_100021231 3300005444 Bacteria 4146
60 Ga0070694_100072099 3300005444 Bacteria 2382
61 Ga0070708_100021447 3300005445 Bacteria 5462
62 Ga0070708_100022880 3300005445 Bacteria 5307
63 Ga0070708_100175530 3300005445 Bacteria 2002
64 Ga0070708_100968391 3300005445 Bacteria 798
65 Ga0070708_101537302 3300005445 Bacteria 620
66 Ga0070663_100117435 3300005455 Bacteria 2006
67 Ga0070663_100631974 3300005455 Bacteria 903
68 Ga0070663_100725845 3300005455 Bacteria 846
69 Ga0070678_100011919 3300005456 Bacteria 5381
70 Ga0070678_100476575 3300005456 Bacteria 1097
71 Ga0070678_100558942 3300005456 Bacteria 1017
72 Ga0070678_100969172 3300005456 Bacteria 780
73 Ga0070662_100259068 3300005457 Bacteria 1401
74 Ga0070681_10037333 3300005458 Unclassified 4876
75 Ga0068867_100135248 3300005459 Bacteria 1921
76 Ga0068867_100159941 3300005459 Bacteria 1776
77 Ga0070685_10001422 3300005466 Bacteria 12565
78 Ga0070685_10101557 3300005466 Bacteria 1757
79 Ga0070685_10339729 3300005466 Bacteria 1023
80 Ga0070685_10416325 3300005466 Bacteria 934
81 Ga0070706_100001744 3300005467 Bacteria 22567
82 Ga0070706_100003517 3300005467 Bacteria 15402
83 Ga0070706_100049291 3300005467 Bacteria 3887
84 Ga0070706_100334585 3300005467 Bacteria 1412
85 Ga0070707_100037504 3300005468 Bacteria 4626
86 Ga0070707_100123246 3300005468 Bacteria 2517
87 Ga0070707_100924235 3300005468 Unclassified 837
88 Ga0070707_100969688 3300005468 Bacteria 815
89 Ga0070698_100009054 3300005471 Bacteria 10703
90 Ga0070698_100019690 3300005471 Bacteria 7079
91 Ga0070698_100155552 3300005471 Bacteria 2232
92 Ga0070699_100116709 3300005518 Bacteria 2346
93 Ga0070699_100118076 3300005518 Bacteria 2331
94 Ga0070699_100223118 3300005518 Bacteria 1680
95 Ga0070699_100461652 3300005518 Unclassified 1152
96 Ga0070684_100003429 3300005535 Bacteria 11904
97 Ga0070684_100211772 3300005535 Bacteria 1766
98 Ga0070684_100579627 3300005535 Bacteria 1042
99 Ga0070697_100073360 3300005536 Bacteria 2810
100 Ga0070697_100322222 3300005536 Bacteria 1331
101 Ga0070697_100357521 3300005536 Bacteria 1262
102 Ga0068853_100133352 3300005539 Bacteria 2225
103 Ga0068853_100757341 3300005539 Bacteria 928
104 Ga0068853_101422285 3300005539 Unclassified 671
105 Ga0070672_100074760 3300005543 Bacteria 2704
106 Ga0070672_100099736 3300005543 Unclassified 2354
107 Ga0070672_100185638 3300005543 Bacteria 1734
108 Ga0070672_100211234 3300005543 Unclassified 1625
109 Ga0070672_100216489 3300005543 Bacteria 1605
110 Ga0070672_101661245 3300005543 Bacteria 573
111 Ga0070686_101077825 3300005544 Unclassified 662
112 Ga0070695_100024254 3300005545 Bacteria 3734
113 Ga0070695_100065145 3300005545 Bacteria 2372
114 Ga0070695_100676393 3300005545 Unclassified 817
115 Ga0070696_100192858 3300005546 Bacteria 1517
116 Ga0070693_100692691 3300005547 Unclassified 745
117 Ga0070665_100000779 3300005548 Bacteria 41952
118 Ga0070665_100014159 3300005548 Bacteria 8014
119 Ga0070665_100350635 3300005548 Bacteria 1481
120 Ga0070704_100037999 3300005549 Bacteria 3294
121 Ga0070704_100078402 3300005549 Bacteria 2423
122 Ga0068855_100251566 3300005563 Bacteria 1971
123 Ga0070664_100049595 3300005564 Bacteria 3551
124 Ga0068857_100743042 3300005577 Bacteria 934
125 Ga0068854_100006315 3300005578 Bacteria 7536
126 Ga0068854_100057428 3300005578 Bacteria 2807
127 Ga0068854_100849508 3300005578 Bacteria 799
128 Ga0068856_100940833 3300005614 Bacteria 883
129 Ga0068852_102436856 3300005616 Bacteria 544
130 Ga0068859_100019751 3300005617 Bacteria 6763
131 Ga0068859_100038744 3300005617 Bacteria 4781
132 Ga0068859_100043867 3300005617 Bacteria 4494
133 Ga0068859_100050943 3300005617 Bacteria 4160
134 Ga0068859_100094306 3300005617 Bacteria 3045
135 Ga0068859_100136282 3300005617 Bacteria 2528
136 Ga0068859_100811095 3300005617 Bacteria 1023
137 Ga0068864_100101689 3300005618 Unclassified 2549
138 Ga0068864_100295915 3300005618 Bacteria 1514
139 Ga0068861_100036731 3300005719 Bacteria 3638
140 Ga0068861_100257373 3300005719 Bacteria 1493
141 Ga0068861_100379660 3300005719 Bacteria 1248
142 Ga0068861_100751213 3300005719 Unclassified 911
143 Ga0068870_10041710 3300005840 Bacteria 2386
144 Ga0068870_10053399 3300005840 Unclassified 2146
145 Ga0068870_10060421 3300005840 Unclassified 2034
146 Ga0068870_10358875 3300005840 Unclassified 937
147 Ga0068863_100027192 3300005841 Bacteria 5455
148 Ga0068863_100051299 3300005841 Bacteria 3910
149 Ga0068863_100373732 3300005841 Bacteria 1391
150 Ga0068863_100416945 3300005841 Unclassified 1315
151 Ga0068863_100453370 3300005841 Bacteria 1259
152 Ga0068858_100019620 3300005842 Bacteria 6320
153 Ga0068858_100342201 3300005842 Unclassified 1432
154 Ga0068858_100391976 3300005842 Bacteria 1333
155 Ga0068858_101305622 3300005842 Bacteria 714
156 Ga0068860_100146816 3300005843 Unclassified 2269
157 Ga0068860_100515125 3300005843 Bacteria 1196
158 Ga0068860_101396618 3300005843 Unclassified 721
159 Ga0068862_100006862 3300005844 Bacteria 9443
160 Ga0068862_100041159 3300005844 Bacteria 3931
161 Ga0068862_100110825 3300005844 Bacteria 2408
162 Ga0068862_100326985 3300005844 Bacteria 1417
163 Ga0068862_100718255 3300005844 Bacteria 969
164 Ga0081455_10005569 3300005937 Bacteria 13785
165 Ga0081455_10029544 3300005937 Bacteria 4997
166 Ga0081455_10337120 3300005937 Bacteria 1068
167 Ga0081540_1001505 3300005983 Bacteria 20051
168 Ga0070717_11060712 3300006028 Unclassified 738
169 Ga0075365_10027827 3300006038 Bacteria 3601
170 Ga0075368_10018948 3300006042 Bacteria 2594
171 Ga0075363_100171508 3300006048 Bacteria 1232
172 Ga0075364_10192197 3300006051 Bacteria 1382
173 Ga0070716_100070680 3300006173 Bacteria 2050
174 Ga0075362_10140587 3300006177 Bacteria 1153
175 Ga0075367_10256435 3300006178 Bacteria 1097
176 Ga0075366_10000055 3300006195 Bacteria 41182
177 Ga0097621_100023843 3300006237 Bacteria 4769
178 Ga0075370_10068323 3300006353 Bacteria 2029
179 Ga0068871_100126269 3300006358 Bacteria 2165
180 Ga0075428_100001079 3300006844 Bacteria 28987
181 Ga0075428_100116212 3300006844 Bacteria 2914
182 Ga0075428_100142340 3300006844 Bacteria 2607
183 Ga0075428_100152163 3300006844 Bacteria 2513
184 Ga0075430_100009866 3300006846 Bacteria 8076
185 Ga0075430_100035232 3300006846 Bacteria 4247
186 Ga0075430_101039779 3300006846 Unclassified 675
187 Ga0075431_100004351 3300006847 Bacteria 13890
188 Ga0075431_100149552 3300006847 Bacteria 2405
189 Ga0075431_100200190 3300006847 Bacteria 2044
190 Ga0075431_100722847 3300006847 Bacteria 972
191 Ga0075431_100881709 3300006847 Bacteria 865
192 Ga0075433_10006939 3300006852 Bacteria 8975
193 Ga0075433_10248199 3300006852 Unclassified 1579
194 Ga0075434_100034345 3300006871 Bacteria 5007
195 Ga0075434_100087890 3300006871 Bacteria 3109
196 Ga0075434_100124009 3300006871 Bacteria 2600
197 Ga0075429_100005240 3300006880 Bacteria 11153
198 Ga0075429_100245043 3300006880 Bacteria 1569
199 Ga0075429_100504454 3300006880 Bacteria 1060
200 Ga0075429_101263386 3300006880 Bacteria 644
201 Ga0068865_100018391 3300006881 Unclassified 4508
202 Ga0068865_100305318 3300006881 Bacteria 1275
203 Ga0068865_100332286 3300006881 Unclassified 1226
204 Ga0075436_100305816 3300006914 Bacteria 1140
205 Ga0097620_100019750 3300006931 Bacteria 6763
206 Ga0097620_100038743 3300006931 Bacteria 4781
207 Ga0097620_100043867 3300006931 Bacteria 4494
208 Ga0097620_100050945 3300006931 Bacteria 4160
209 Ga0097620_100094309 3300006931 Bacteria 3045
210 Ga0097620_100136279 3300006931 Bacteria 2528
211 Ga0097620_100811036 3300006931 Bacteria 1023
212 Ga0097620_100936281 3300006931 Bacteria 950
213 Ga0075435_100156159 3300007076 Bacteria 1920
214 Ga0075435_100159116 3300007076 Bacteria 1902
215 Ga0075435_100393782 3300007076 Bacteria 1191
216 Ga0111539_10000083 3300009094 Bacteria 96473
217 Ga0111539_10005357 3300009094 Bacteria 16592
218 Ga0111539_10077416 3300009094 Bacteria 3914
219 Ga0111539_10105159 3300009094 Bacteria 3312
220 Ga0111539_10292948 3300009094 Bacteria 1894
221 Ga0111539_10371535 3300009094 Bacteria 1664
222 Ga0111539_10457213 3300009094 Unclassified 1487
223 Ga0111539_11139330 3300009094 Bacteria 906
224 Ga0111539_11245958 3300009094 Bacteria 864
225 Ga0111539_11288571 3300009094 Unclassified 848
226 Ga0105245_10001819 3300009098 Bacteria 19407
227 Ga0105245_10615572 3300009098 Bacteria 1114
228 Ga0105247_11201098 3300009101 Unclassified 604
229 Ga0114129_10000895 3300009147 Bacteria 38835
230 Ga0114129_10243196 3300009147 Bacteria 2419
231 Ga0114129_11476054 3300009147 Bacteria 836
232 Ga0114129_12226030 3300009147 Bacteria 659
233 Ga0105243_10006424 3300009148 Bacteria 9086
234 Ga0105242_10587006 3300009176 Unclassified 1074
235 Ga0105248_10045634 3300009177 Bacteria 4913
236 Ga0105248_10198805 3300009177 Bacteria 2258
237 Ga0105248_10447928 3300009177 Unclassified 1455
238 Ga0105248_13093644 3300009177 Unclassified 530
239 Ga0105238_10000001 3300009551 Bacteria 2036163
240 Ga0105238_11621548 3300009551 Bacteria 677
241 Ga0105249_10015073 3300009553 Bacteria 6839
242 Ga0105249_10228921 3300009553 Bacteria 1833
243 Ga0105249_10697279 3300009553 Bacteria 1075
244 Ga0105249_11987868 3300009553 Unclassified 654
245 Ga0157373_10213533 3300013100 Bacteria 1360
246 Ga0157369_10000483 3300013105 Bacteria 52815
247 Ga0157374_10000022 3300013296 Bacteria 270307
248 Ga0157374_10011342 3300013296 Bacteria 7712
249 Ga0157374_10783995 3300013296 Bacteria 969
250 Ga0157378_10034641 3300013297 Bacteria 4465
251 Ga0163162_10026683 3300013306 Bacteria 5710
252 Ga0163162_10031489 3300013306 Bacteria 5261
253 Ga0163162_10714550 3300013306 Bacteria 1123
254 Ga0157375_10000004 3300013308 Bacteria 474935
255 Ga0157375_10000439 3300013308 Bacteria 37628
256 Ga0157375_10013107 3300013308 Bacteria 7367
257 Ga0157375_10043879 3300013308 Bacteria 4339
258 Ga0157375_10244970 3300013308 Bacteria 1952
259 Ga0157375_10425449 3300013308 Bacteria 1494
260 Ga0157375_10727525 3300013308 Bacteria 1145
261 Ga0163163_10032013 3300014325 Bacteria 5079
262 Ga0163163_10107758 3300014325 Bacteria 2813
263 Ga0157380_10022754 3300014326 Unclassified 4724
264 Ga0157380_10068118 3300014326 Bacteria 2868
265 Ga0157380_10739130 3300014326 Unclassified 994
266 Ga0157380_11118134 3300014326 Bacteria 828
267 Ga0157377_10000009 3300014745 Bacteria 385287
268 Ga0157377_10000229 3300014745 Bacteria 29325
269 Ga0157377_10021674 3300014745 Bacteria 3383
270 Ga0157377_10087818 3300014745 Bacteria 1830
271 Ga0157377_10090401 3300014745 Bacteria 1807
272 Ga0157377_10248659 3300014745 Unclassified 1151
273 Ga0157379_10077399 3300014968 Bacteria 2978
274 Ga0157379_10509430 3300014968 Bacteria 1116
275 Ga0157376_10000045 3300014969 Bacteria 109693
276 Ga0157376_10515815 3300014969 Unclassified 1177
277 Ga0157376_12737140 3300014969 Bacteria 533
278 Ga0182007_10221592 3300015262 Unclassified 668
279 Ga0163161_10023620 3300017792 Bacteria 4339
280 Ga0213876_10000012 3300021384 Bacteria 396530
281 Ga0213876_10033808 3300021384 Bacteria 2695
282 Ga0207697_10012309 3300025315 Bacteria 3591
283 Ga0207653_10017628 3300025885 Bacteria 2249
284 Ga0207653_10051323 3300025885 Unclassified 1373
285 Ga0207682_10001705 3300025893 Bacteria 10055
286 Ga0207642_10404926 3300025899 Bacteria 817
287 Ga0207688_10604082 3300025901 Unclassified 691
288 Ga0207680_10009024 3300025903 Bacteria 4925
289 Ga0207680_10025643 3300025903 Bacteria 3254
290 Ga0207680_10036737 3300025903 Bacteria 2823
291 Ga0207680_10424222 3300025903 Bacteria 942
292 Ga0207647_10098803 3300025904 Bacteria 1734
293 Ga0207645_10059707 3300025907 Bacteria 2435
294 Ga0207645_10452738 3300025907 Bacteria 867
295 Ga0207643_10006009 3300025908 Bacteria 6488
296 Ga0207643_10053810 3300025908 Bacteria 2287
297 Ga0207643_10061297 3300025908 Unclassified 2148
298 Ga0207643_10108783 3300025908 Bacteria 1631
299 Ga0207705_10470683 3300025909 Bacteria 975
300 Ga0207684_10013133 3300025910 Bacteria 7169
301 Ga0207684_10018952 3300025910 Bacteria 5887
302 Ga0207684_10084474 3300025910 Bacteria 2703
303 Ga0207707_10265780 3300025912 Unclassified 1487
304 Ga0207662_10024428 3300025918 Bacteria 3478
305 Ga0207657_10076140 3300025919 Bacteria 2831
306 Ga0207657_10242197 3300025919 Bacteria 1440
307 Ga0207646_10066078 3300025922 Bacteria 3228
308 Ga0207681_10000016 3300025923 Bacteria 345352
309 Ga0207681_10099809 3300025923 Bacteria 2091
310 Ga0207681_10404504 3300025923 Bacteria 1103
311 Ga0207681_10812808 3300025923 Bacteria 781
312 Ga0207694_10000001 3300025924 Bacteria 4078485
313 Ga0207650_10009486 3300025925 Bacteria 6650
314 Ga0207650_10024434 3300025925 Bacteria 4295
315 Ga0207650_10030119 3300025925 Bacteria 3906
316 Ga0207650_10039486 3300025925 Unclassified 3449
317 Ga0207650_10146881 3300025925 Bacteria 1858
318 Ga0207659_10004597 3300025926 Bacteria 8352
319 Ga0207659_10760013 3300025926 Bacteria 832
320 Ga0207687_10001830 3300025927 Bacteria 14634
321 Ga0207690_10943138 3300025932 Bacteria 717
322 Ga0207690_11246098 3300025932 Bacteria 621
323 Ga0207706_10171957 3300025933 Bacteria 1903
324 Ga0207706_10258784 3300025933 Bacteria 1519
325 Ga0207706_10408109 3300025933 Bacteria 1177
326 Ga0207709_10083768 3300025935 Bacteria 2063
327 Ga0207670_10430823 3300025936 Bacteria 1060
328 Ga0207669_10013713 3300025937 Bacteria 4038
329 Ga0207669_10084636 3300025937 Bacteria 2044
330 Ga0207669_10386759 3300025937 Bacteria 1092
331 Ga0207704_10027551 3300025938 Bacteria 3138
332 Ga0207665_10106215 3300025939 Bacteria 1967
333 Ga0207665_10322931 3300025939 Bacteria 1159
334 Ga0207691_10001286 3300025940 Bacteria 25022
335 Ga0207691_10020846 3300025940 Bacteria 6194
336 Ga0207691_10055812 3300025940 Bacteria 3599
337 Ga0207691_10079914 3300025940 Bacteria 2942
338 Ga0207691_10116398 3300025940 Bacteria 2372
339 Ga0207711_10411524 3300025941 Unclassified 1257
340 Ga0207711_10614441 3300025941 Bacteria 1014
341 Ga0207689_10013836 3300025942 Bacteria 6874
342 Ga0207689_10029414 3300025942 Bacteria 4587
343 Ga0207689_10041972 3300025942 Bacteria 3785
344 Ga0207661_10000001 3300025944 Bacteria 937688
345 Ga0207661_10079397 3300025944 Unclassified 2704
346 Ga0207667_11051671 3300025949 Unclassified 799
347 Ga0207651_10463488 3300025960 Unclassified 1089
348 Ga0207712_10090951 3300025961 Bacteria 2247
349 Ga0207712_10269593 3300025961 Bacteria 1384
350 Ga0207668_10186346 3300025972 Bacteria 1641
351 Ga0207668_10399536 3300025972 Bacteria 1161
352 Ga0207668_11310091 3300025972 Unclassified 652
353 Ga0207640_10009858 3300025981 Bacteria 5361
354 Ga0207640_10137094 3300025981 Bacteria 1778
355 Ga0207658_10014817 3300025986 Bacteria 5342
356 Ga0207658_10018927 3300025986 Bacteria 4762
357 Ga0207658_10810248 3300025986 Bacteria 850
358 Ga0207658_10856744 3300025986 Bacteria 826
359 Ga0207658_11596456 3300025986 Unclassified 596
360 Ga0207677_10000561 3300026023 Bacteria 23486
361 Ga0207677_10035375 3300026023 Bacteria 3244
362 Ga0207677_10259995 3300026023 Bacteria 1415
363 Ga0207703_10242401 3300026035 Bacteria 1621
364 Ga0207703_11052472 3300026035 Unclassified 781
365 Ga0207703_11510140 3300026035 Bacteria 646
366 Ga0207639_10044562 3300026041 Bacteria 3337
367 Ga0207639_10479365 3300026041 Bacteria 1133
368 Ga0207678_10040775 3300026067 Bacteria 4025
369 Ga0207678_10174316 3300026067 Bacteria 1836
370 Ga0207678_10674513 3300026067 Bacteria 909
371 Ga0207708_10098072 3300026075 Bacteria 2265
372 Ga0207708_10156424 3300026075 Bacteria 1798
373 Ga0207708_10157673 3300026075 Unclassified 1791
374 Ga0207641_10166806 3300026088 Bacteria 2006
375 Ga0207641_10385537 3300026088 Bacteria 1343
376 Ga0207641_10563068 3300026088 Bacteria 1112
377 Ga0207648_10045575 3300026089 Unclassified 3846
378 Ga0207648_10141497 3300026089 Bacteria 2120
379 Ga0207676_10004523 3300026095 Bacteria 9835
380 Ga0207674_10680669 3300026116 Bacteria 993
381 Ga0207674_11530306 3300026116 Bacteria 636
382 Ga0207675_100031128 3300026118 Bacteria 4968
383 Ga0207675_100039616 3300026118 Bacteria 4398
384 Ga0207675_100746984 3300026118 Unclassified 989
385 Ga0207683_10033909 3300026121 Bacteria 4435
386 Ga0207683_10669137 3300026121 Bacteria 962
387 Ga0207683_10833902 3300026121 Unclassified 856
388 Ga0207683_10900337 3300026121 Bacteria 822
389 Ga0209813_10031853 3300027866 Bacteria 1559
390 Ga0207428_10000060 3300027907 Bacteria 156452
391 Ga0207428_10004678 3300027907 Bacteria 12971
392 Ga0268266_10000575 3300028379 Bacteria 50661
393 Ga0268266_10010292 3300028379 Bacteria 8185
394 Ga0268266_10018328 3300028379 Bacteria 5968
395 Ga0268266_11463281 3300028379 Unclassified 659
396 Ga0268265_10012774 3300028380 Bacteria 5700
397 Ga0268265_10013605 3300028380 Bacteria 5532
398 Ga0268265_10498944 3300028380 Bacteria 1146
399 Ga0268265_10685620 3300028380 Bacteria 988
400 Ga0268264_10005430 3300028381 Bacteria 10797
401 Ga0268264_10069089 3300028381 Unclassified 2987
402 Ga0268264_10127277 3300028381 Bacteria 2253
403 Ga0268264_10235692 3300028381 Bacteria 1692
404 Ga0268264_10688791 3300028381 Bacteria 1014
405 Ga0307513_10188984 3300031456 Bacteria 1913
406 Ga0307408_100020031 3300031548 Bacteria 4509
407 Ga0316579_10300624 3300031691 Unclassified 776
408 Ga0316578_10632035 3300031728 Bacteria 626
409 Ga0316577_10118724 3300031733 Unclassified 1486
410 Ga0307413_10230843 3300031824 Bacteria 1359
411 Ga0307406_10059761 3300031901 Bacteria 2455
412 Ga0307409_100506546 3300031995 Bacteria 1177
413 Ga0307416_101865553 3300032002 Bacteria 705
414 Ga0373923_0117006 3300035111 Bacteria 1188
415 Ga0373932_0155950 3300035112 Unclassified 787
416 Ga0373939_0546091 3300035114 Bacteria 500
417 Ga0373953_0041684 3300035117 Bacteria 1827
418 Ga0373953_0557820 3300035117 Bacteria 509
419 Ga0373954_0060184 3300035118 Bacteria 1791
420 Ga0373954_0374215 3300035118 Bacteria 704
421 Ga0373954_0391375 3300035118 Bacteria 687
422 Ga0373954_0397000 3300035118 Bacteria 682
423 Ga0373954_0559915 3300035118 Bacteria 567
424 Ga0373957_0095468 3300035120 Unclassified 1186
425 Ga0373957_0298824 3300035120 Bacteria 683
426 Ga0373955_0024507 3300035172 Unclassified 3086
427 Ga0373955_0082627 3300035172 Bacteria 1818
428 Ga0316574_0205601 3300035398 Bacteria 1264
429 Ga0373931_0855949 3300035691 Bacteria 609
430 Ga0373935_0192354 3300035692 Bacteria 1406
431 Ga0373933_0000384 3300035724 Bacteria 28317
432 Ga0373933_0015838 3300035724 Bacteria 4208
433 Ga0373933_0430269 3300035724 Bacteria 862
434 Ga0373937_0008656 3300036401 Bacteria 8843
435 Ga0373937_0013329 3300036401 Bacteria 7242
436 Ga0373937_0029670 3300036401 Bacteria 4955
437 Ga0373925_0263156 3300037068 Bacteria 1386
438 Ga0373925_0547196 3300037068 Bacteria 952
439 Ga0395898_0207065 3300037466 Bacteria 1872
440 Ga0395901_0245121 3300038443 Bacteria 1868
441 Ga0436365_0140160 3300039437 Bacteria 11965
442 Ga0436365_1316487 3300039437 Bacteria 6916
443 Ga0436363_1490899 3300039450 Unclassified 969
444 Ga0436362_0450863 3300039453 Bacteria 7595
445 Ga0439465_0111504 3300041413 Bacteria 952
446 Ga0439431_0228757 3300041997 Bacteria 547
447 Ga0439445_0056905 3300042004 Bacteria 1064
448 Ga0439449_0291364 3300042007 Bacteria 616
449 Ga0439446_0072451 3300042156 Unclassified 1056
450 Ga0439458_0025731 3300042157 Bacteria 1381
451 Ga0439444_0019035 3300042437 Bacteria 1194
452 Ga0439464_0002851 3300042439 Bacteria 4299
453 Ga0451577_0144944 3300042876 Bacteria 2135
454 Ga0451577_0729289 3300042876 Bacteria 897
455 Ga0451577_0913976 3300042876 Bacteria 790
456 Ga0453683_0099500 3300044673 Bacteria 1826
457 Ga0453684_0049866 3300044712 Bacteria 5512
458 Ga0466957_1023629 3300044842 Bacteria 594
459 Ga0466960_0013180 3300044901 Unclassified 3506
460 Ga0466960_0525112 3300044901 Bacteria 696
461 Ga0451576_0022930 3300045051 Bacteria 6765
462 Ga0451576_0318769 3300045051 Bacteria 1627
463 Ga0451576_0382140 3300045051 Bacteria 1476
464 Ga0451576_0574218 3300045051 Bacteria 1185
465 Ga0451576_1288122 3300045051 Bacteria 762
466 Ga0466967_1417402 3300045976 Bacteria 692
467 Ga0495592_0043940 3300046454 Bacteria 3341
468 Ga0495651_0806934 3300046462 Bacteria 579
469 Ga0495580_0000622 3300046472 Bacteria 30013
470 Ga0495580_0078715 3300046472 Unclassified 2299
471 Ga0495580_0283045 3300046472 Bacteria 1131
472 Ga0495639_0139049 3300046475 Bacteria 1166
473 Ga0495662_0018502 3300046476 Bacteria 3373
474 Ga0495662_0256783 3300046476 Unclassified 860
475 Ga0495628_0114618 3300046516 Bacteria 2070
476 Ga0495630_0000001 3300046517 Bacteria 1687293
477 Ga0495630_0448229 3300046517 Bacteria 989
478 Ga0495630_1037067 3300046517 Bacteria 623
479 Ga0495640_0293967 3300046533 Bacteria 1010
480 Ga0495587_0515188 3300046536 Bacteria 661
481 Ga0495634_0211517 3300046642 Bacteria 1200
482 Ga0495657_0089840 3300046675 Bacteria 1973
483 Ga0495647_0376440 3300046681 Unclassified 649
484 Ga0495674_1226079 3300047319 Bacteria 566
485 Ga0495680_0036897 3300047322 Unclassified 3919
486 Ga0495680_0896071 3300047322 Bacteria 573
487 Ga0495602_0036929 3300048088 Bacteria 4541
488 Ga0496100_1025908 3300048903 Bacteria 649
489 Ga0496101_0035270 3300048904 Bacteria 3537
490 Ga0496101_0190707 3300048904 Unclassified 1582
491 Ga0496101_0277558 3300048904 Bacteria 1309
492 Ga0496102_0180058 3300048905 Bacteria 1991
493 Ga0496102_0234633 3300048905 Bacteria 1729
494 Ga0496104_0272850 3300048907 Bacteria 1604
495 Ga0496104_1184284 3300048907 Unclassified 667
496 Ga0496105_0203407 3300048908 Bacteria 1616
497 Ga0496106_0045863 3300048909 Bacteria 3285
498 Ga0496106_0069625 3300048909 Bacteria 2686
499 Ga0496106_0422048 3300048909 Bacteria 1072
500 Ga0496107_0075172 3300048910 Bacteria 2459
501 Ga0496109_0477645 3300048912 Bacteria 1177
502 Ga0496109_0483033 3300048912 Bacteria 1170
503 Ga0496110_0181694 3300048913 Bacteria 1910
504 Ga0496110_0338191 3300048913 Bacteria 1371
505 Ga0496111_0229470 3300048914 Bacteria 1379
506 Ga0496112_0764070 3300048915 Bacteria 892
507 Ga0496114_0000157 3300048917 Bacteria 48126
508 Ga0496115_0047466 3300048918 Bacteria 3435
509 Ga0501298_189134 3300049521 Unclassified 519
510 Ga0501032_0769384 3300049569 Bacteria 609
511 Ga0501034_0031599 3300049571 Bacteria 5379
512 Ga0501034_0113160 3300049571 Bacteria 2704
513 Ga0501036_0962403 3300049572 Bacteria 699
514 Ga0501042_0665914 3300049578 Bacteria 757
515 Ga0501046_0094399 3300049580 Bacteria 2299
516 Ga0501047_0035524 3300049581 Bacteria 4815
517 Ga0501047_0278869 3300049581 Bacteria 1516
518 Ga0501047_0283129 3300049581 Bacteria 1502
519 Ga0501047_0782760 3300049581 Bacteria 769
520 Ga0501048_0016078 3300049582 Bacteria 5518
521 Ga0501067_0230296 3300049583 Bacteria 1031
522 Ga0501068_0066563 3300049584 Bacteria 2194
523 Ga0501070_0070766 3300049586 Bacteria 2888
524 Ga0501070_0118373 3300049586 Bacteria 2189
525 Ga0501072_0509683 3300049588 Unclassified 951
526 Ga0501074_0193133 3300049590 Bacteria 1451
527 Ga0501075_0036990 3300049591 Bacteria 3644
528 Ga0501076_0507113 3300049592 Unclassified 994
529 Ga0501076_1055587 3300049592 Bacteria 669
530 Ga0501077_0000681 3300049593 Bacteria 20569
531 Ga0501202_124071 3300049652 Unclassified 652
532 Ga0501233_049618 3300049668 Bacteria 1013
533 Ga0501259_056914 3300049688 Unclassified 808
534 Ga0501080_0038253 3300049742 Bacteria 4480
535 Ga0501080_0651631 3300049742 Unclassified 932
536 Ga0501035_0261037 3300049822 Bacteria 1468
537 Ga0501044_0911300 3300049823 Bacteria 753
538 Ga0501045_0518387 3300049824 Unclassified 885
539 Ga0501045_1071190 3300049824 Bacteria 590
540 nmdc:mga03683_373679_c1 3300050489 Bacteria 678
541 nmdc:mga03n38_341258_c1 3300050490 Bacteria 813
542 nmdc:mga0k408_700_c1 3300050493 Bacteria 18347
543 nmdc:mga06z11_4934_c1 3300050494 Bacteria 5295
544 nmdc:mga04h51_10662_c1 3300050495 Bacteria 2529
545 nmdc:mga07m45_93146_c1 3300050496 Unclassified 1727
546 nmdc:mga05p37_1102025_c1 3300050507 Bacteria 831
547 nmdc:mga05p37_1177564_c1 3300050507 Bacteria 794
548 nmdc:mga05p37_1665_c1 3300050507 Bacteria 25824
549 nmdc:mga09592_3444_c1 3300050508 Bacteria 12779
550 nmdc:mga09592_943108_c1 3300050508 Bacteria 724
551 nmdc:mga0qj67_1068824_c1 3300050509 Bacteria 631
552 nmdc:mga0qj67_15830_c1 3300050509 Bacteria 5711
553 nmdc:mga0qj67_82285_c1 3300050509 Bacteria 2582
554 nmdc:mga06r32_104931_c1 3300050510 Bacteria 2776
555 nmdc:mga06r32_179627_c1 3300050510 Bacteria 2101
556 nmdc:mga06r32_24490_c1 3300050510 Bacteria 5603
557 nmdc:mga06r32_633932_c1 3300050510 Bacteria 1038
558 nmdc:mga06r32_669311_c1 3300050510 Bacteria 1005
559 nmdc:mga08y16_1837797_c1 3300050511 Bacteria 558
560 nmdc:mga08y16_185775_c1 3300050511 Unclassified 2157
561 nmdc:mga08y16_223373_c1 3300050511 Bacteria 1949
562 nmdc:mga08y16_3553_c1 3300050511 Bacteria 16186
563 nmdc:mga08y16_461970_c1 3300050511 Bacteria 1294
564 nmdc:mga08y16_55608_c1 3300050511 Bacteria 4135
565 nmdc:mga0n895_124363_c1 3300050512 Bacteria 2602
566 nmdc:mga0n895_644733_c1 3300050512 Bacteria 1058
567 nmdc:mga0n895_96820_c1 3300050512 Bacteria 2956
568 nmdc:mga0rr50_133827_c1 3300050513 Bacteria 1988
569 nmdc:mga0rr50_27911_c1 3300050513 Unclassified 3960
570 nmdc:mga0rr50_775270_c1 3300050513 Bacteria 818
571 nmdc:mga0a205_1073049_c1 3300050515 Unclassified 653
572 nmdc:mga0a205_1132843_c1 3300050515 Bacteria 630
573 nmdc:mga0a205_2556_c1 3300050515 Bacteria 16039
574 nmdc:mga0a205_637404_c1 3300050515 Unclassified 917
575 Ga0500646_0225900 3300053090 Bacteria 651
576 Ga0500652_096185 3300053131 Bacteria 1237
577 Ga0501082_0000072 3300060353 Bacteria 73322
578 Ga0501082_0337493 3300060353 Unclassified 1313
579 Ga0070708_100335399
580 rootL2_10039738
581 Ga0070658_10081130
582 Ga0070676_10021306
583 Ga0070676_10830545
584 Ga0070690_100035165
585 Ga0070690_101295838
586 Ga0070670_100029376
587 Ga0070670_101251760
588 Ga0068869_100039698
589 Ga0068869_100086833
590 Ga0070666_10001044
591 Ga0070666_10014491
592 Ga0070680_100419102
593 Ga0070682_100064938
594 Ga0068868_100006709
595 Ga0068868_100458458
596 Ga0068868_100847187
597 Ga0070660_100047528
598 Ga0070689_100017841
599 Ga0070692_10002302
600 Ga0070692_11172625
601 Ga0070669_100082843
602 Ga0070669_100129549
603 Ga0070669_100893937
604 Ga0070675_100016337
605 Ga0070675_100020078
606 Ga0070675_100050849
607 Ga0070671_100023535
608 Ga0070671_100569855
609 Ga0070671_100605405
610 Ga0070671_101780799
611 Ga0070674_100028856
612 Ga0070674_100043113
613 Ga0070674_100197561
614 Ga0070674_101917258
615 Ga0070673_100063301
616 Ga0070673_100561330
617 Ga0070688_100011679
618 Ga0070688_100071042
619 Ga0070659_100077187
620 Ga0070667_100023503
621 Ga0070667_100035349
622 Ga0070667_100309365
623 Ga0070667_100918013
624 Ga0070667_101502137
625 Ga0070667_101655669
626 Ga0070703_10051407
627 Ga0070709_11615971
628 Ga0070701_10034760
629 Ga0070701_10102128
630 Ga0070705_100048410
631 Ga0070705_100752228
632 Ga0070705_101111824
633 Ga0070700_100041169
634 Ga0070700_100099651
635 Ga0070700_100324304
636 Ga0070694_100006631
637 Ga0070694_100021231
638 Ga0070694_100072099
639 Ga0070708_100021447
640 Ga0070708_100022880
641 Ga0070708_100175530
642 Ga0070708_100968391
643 Ga0070708_101537302
644 Ga0070663_100117435
645 Ga0070663_100631974
646 Ga0070663_100725845
647 Ga0070678_100011919
648 Ga0070678_100476575
649 Ga0070678_100558942
650 Ga0070678_100969172
651 Ga0070662_100259068
652 Ga0070681_10037333
653 Ga0068867_100135248
654 Ga0068867_100159941
655 Ga0070685_10001422
656 Ga0070685_10101557
657 Ga0070685_10339729
658 Ga0070685_10416325
659 Ga0070706_100001744
660 Ga0070706_100003517
661 Ga0070706_100049291
662 Ga0070706_100334585
663 Ga0070707_100037504
664 Ga0070707_100123246
665 Ga0070707_100924235
666 Ga0070707_100969688
667 Ga0070698_100009054
668 Ga0070698_100019690
669 Ga0070698_100155552
670 Ga0070699_100116709
671 Ga0070699_100118076
672 Ga0070699_100223118
673 Ga0070699_100461652
674 Ga0070684_100003429
675 Ga0070684_100211772
676 Ga0070684_100579627
677 Ga0070697_100073360
678 Ga0070697_100322222
679 Ga0070697_100357521
680 Ga0068853_100133352
681 Ga0068853_100757341
682 Ga0068853_101422285
683 Ga0070672_100074760
684 Ga0070672_100099736
685 Ga0070672_100185638
686 Ga0070672_100211234
687 Ga0070672_100216489
688 Ga0070672_101661245
689 Ga0070686_101077825
690 Ga0070695_100024254
691 Ga0070695_100065145
692 Ga0070695_100676393
693 Ga0070696_100192858
694 Ga0070693_100692691
695 Ga0070665_100000779
696 Ga0070665_100014159
697 Ga0070665_100350635
698 Ga0070704_100037999
699 Ga0070704_100078402
700 Ga0068855_100251566
701 Ga0070664_100049595
702 Ga0068857_100743042
703 Ga0068854_100006315
704 Ga0068854_100057428
705 Ga0068854_100849508
706 Ga0068856_100940833
707 Ga0068852_102436856
708 Ga0068859_100019751
709 Ga0068859_100038744
710 Ga0068859_100043867
711 Ga0068859_100050943
712 Ga0068859_100094306
713 Ga0068859_100136282
714 Ga0068859_100811095
715 Ga0068864_100101689
716 Ga0068864_100295915
717 Ga0068861_100036731
718 Ga0068861_100257373
719 Ga0068861_100379660
720 Ga0068861_100751213
721 Ga0068870_10041710
722 Ga0068870_10053399
723 Ga0068870_10060421
724 Ga0068870_10358875
725 Ga0068863_100027192
726 Ga0068863_100051299
727 Ga0068863_100373732
728 Ga0068863_100416945
729 Ga0068863_100453370
730 Ga0068858_100019620
731 Ga0068858_100342201
732 Ga0068858_100391976
733 Ga0068858_101305622
734 Ga0068860_100146816
735 Ga0068860_100515125
736 Ga0068860_101396618
737 Ga0068862_100006862
738 Ga0068862_100041159
739 Ga0068862_100110825
740 Ga0068862_100326985
741 Ga0068862_100718255
742 Ga0081455_10005569
743 Ga0081455_10029544
744 Ga0081455_10337120
745 Ga0081540_1001505
746 Ga0070717_11060712
747 Ga0075365_10027827
748 Ga0075368_10018948
749 Ga0075363_100171508
750 Ga0075364_10192197
751 Ga0070716_100070680
752 Ga0075362_10140587
753 Ga0075367_10256435
754 Ga0075366_10000055
755 Ga0097621_100023843
756 Ga0075370_10068323
757 Ga0068871_100126269
758 Ga0075428_100001079
759 Ga0075428_100116212
760 Ga0075428_100142340
761 Ga0075428_100152163
762 Ga0075430_100009866
763 Ga0075430_100035232
764 Ga0075430_101039779
765 Ga0075431_100004351
766 Ga0075431_100149552
767 Ga0075431_100200190
768 Ga0075431_100722847
769 Ga0075431_100881709
770 Ga0075433_10006939
771 Ga0075433_10248199
772 Ga0075434_100034345
773 Ga0075434_100087890
774 Ga0075434_100124009
775 Ga0075429_100005240
776 Ga0075429_100245043
777 Ga0075429_100504454
778 Ga0075429_101263386
779 Ga0068865_100018391
780 Ga0068865_100305318
781 Ga0068865_100332286
782 Ga0075436_100305816
783 Ga0097620_100019750
784 Ga0097620_100038743
785 Ga0097620_100043867
786 Ga0097620_100050945
787 Ga0097620_100094309
788 Ga0097620_100136279
789 Ga0097620_100811036
790 Ga0097620_100936281
791 Ga0075435_100156159
792 Ga0075435_100159116
793 Ga0075435_100393782
794 Ga0111539_10000083
795 Ga0111539_10005357
796 Ga0111539_10077416
797 Ga0111539_10105159
798 Ga0111539_10292948
799 Ga0111539_10371535
800 Ga0111539_10457213
801 Ga0111539_11139330
802 Ga0111539_11245958
803 Ga0111539_11288571
804 Ga0105245_10001819
805 Ga0105245_10615572
806 Ga0105247_11201098
807 Ga0114129_10000895
808 Ga0114129_10243196
809 Ga0114129_11476054
810 Ga0114129_12226030
811 Ga0105243_10006424
812 Ga0105242_10587006
813 Ga0105248_10045634
814 Ga0105248_10198805
815 Ga0105248_10447928
816 Ga0105248_13093644
817 Ga0105238_10000001
818 Ga0105238_11621548
819 Ga0105249_10015073
820 Ga0105249_10228921
821 Ga0105249_10697279
822 Ga0105249_11987868
823 Ga0157373_10213533
824 Ga0157369_10000483
825 Ga0157374_10000022
826 Ga0157374_10011342
827 Ga0157374_10783995
828 Ga0157378_10034641
829 Ga0163162_10026683
830 Ga0163162_10031489
831 Ga0163162_10714550
832 Ga0157375_10000004
833 Ga0157375_10000439
834 Ga0157375_10013107
835 Ga0157375_10043879
836 Ga0157375_10244970
837 Ga0157375_10425449
838 Ga0157375_10727525
839 Ga0163163_10032013
840 Ga0163163_10107758
841 Ga0157380_10022754
842 Ga0157380_10068118
843 Ga0157380_10739130
844 Ga0157380_11118134
845 Ga0157377_10000009
846 Ga0157377_10000229
847 Ga0157377_10021674
848 Ga0157377_10087818
849 Ga0157377_10090401
850 Ga0157377_10248659
851 Ga0157379_10077399
852 Ga0157379_10509430
853 Ga0157376_10000045
854 Ga0157376_10515815
855 Ga0157376_12737140
856 Ga0182007_10221592
857 Ga0163161_10023620
858 Ga0213876_10000012
859 Ga0213876_10033808
860 Ga0207697_10012309
861 Ga0207653_10017628
862 Ga0207653_10051323
863 Ga0207682_10001705
864 Ga0207642_10404926
865 Ga0207688_10604082
866 Ga0207680_10009024
867 Ga0207680_10025643
868 Ga0207680_10036737
869 Ga0207680_10424222
870 Ga0207647_10098803
871 Ga0207645_10059707
872 Ga0207645_10452738
873 Ga0207643_10006009
874 Ga0207643_10053810
875 Ga0207643_10061297
876 Ga0207643_10108783
877 Ga0207705_10470683
878 Ga0207684_10013133
879 Ga0207684_10018952
880 Ga0207684_10084474
881 Ga0207707_10265780
882 Ga0207662_10024428
883 Ga0207657_10076140
884 Ga0207657_10242197
885 Ga0207646_10066078
886 Ga0207681_10000016
887 Ga0207681_10099809
888 Ga0207681_10404504
889 Ga0207681_10812808
890 Ga0207694_10000001
891 Ga0207650_10009486
892 Ga0207650_10024434
893 Ga0207650_10030119
894 Ga0207650_10039486
895 Ga0207650_10146881
896 Ga0207659_10004597
897 Ga0207659_10760013
898 Ga0207687_10001830
899 Ga0207690_10943138
900 Ga0207690_11246098
901 Ga0207706_10171957
902 Ga0207706_10258784
903 Ga0207706_10408109
904 Ga0207709_10083768
905 Ga0207670_10430823
906 Ga0207669_10013713
907 Ga0207669_10084636
908 Ga0207669_10386759
909 Ga0207704_10027551
910 Ga0207665_10106215
911 Ga0207665_10322931
912 Ga0207691_10001286
913 Ga0207691_10020846
914 Ga0207691_10055812
915 Ga0207691_10079914
916 Ga0207691_10116398
917 Ga0207711_10411524
918 Ga0207711_10614441
919 Ga0207689_10013836
920 Ga0207689_10029414
921 Ga0207689_10041972
922 Ga0207661_10000001
923 Ga0207661_10079397
924 Ga0207667_11051671
925 Ga0207651_10463488
926 Ga0207712_10090951
927 Ga0207712_10269593
928 Ga0207668_10186346
929 Ga0207668_10399536
930 Ga0207668_11310091
931 Ga0207640_10009858
932 Ga0207640_10137094
933 Ga0207658_10014817
934 Ga0207658_10018927
935 Ga0207658_10810248
936 Ga0207658_10856744
937 Ga0207658_11596456
938 Ga0207677_10000561
939 Ga0207677_10035375
940 Ga0207677_10259995
941 Ga0207703_10242401
942 Ga0207703_11052472
943 Ga0207703_11510140
944 Ga0207639_10044562
945 Ga0207639_10479365
946 Ga0207678_10040775
947 Ga0207678_10174316
948 Ga0207678_10674513
949 Ga0207708_10098072
950 Ga0207708_10156424
951 Ga0207708_10157673
952 Ga0207641_10166806
953 Ga0207641_10385537
954 Ga0207641_10563068
955 Ga0207648_10045575
956 Ga0207648_10141497
957 Ga0207676_10004523
958 Ga0207674_10680669
959 Ga0207674_11530306
960 Ga0207675_100031128
961 Ga0207675_100039616
962 Ga0207675_100746984
963 Ga0207683_10033909
964 Ga0207683_10669137
965 Ga0207683_10833902
966 Ga0207683_10900337
967 Ga0209813_10031853
968 Ga0207428_10000060
969 Ga0207428_10004678
970 Ga0268266_10000575
971 Ga0268266_10010292
972 Ga0268266_10018328
973 Ga0268266_11463281
974 Ga0268265_10012774
975 Ga0268265_10013605
976 Ga0268265_10498944
977 Ga0268265_10685620
978 Ga0268264_10005430
979 Ga0268264_10069089
980 Ga0268264_10127277
981 Ga0268264_10235692
982 Ga0268264_10688791
983 Ga0307513_10188984
984 Ga0307408_100020031
985 Ga0316579_10300624
986 Ga0316578_10632035
987 Ga0316577_10118724
988 Ga0307413_10230843
989 Ga0307406_10059761
990 Ga0307409_100506546
991 Ga0307416_101865553
992 Ga0373923_0117006
993 Ga0373932_0155950
994 Ga0373939_0546091
995 Ga0373953_0041684
996 Ga0373953_0557820
997 Ga0373954_0060184
998 Ga0373954_0374215
999 Ga0373954_0391375
1000 Ga0373954_0397000
1001 Ga0373954_0559915
1002 Ga0373957_0095468
1003 Ga0373957_0298824
1004 Ga0373955_0024507
1005 Ga0373955_0082627
1006 Ga0316574_0205601
1007 Ga0373931_0855949
1008 Ga0373935_0192354
1009 Ga0373933_0000384
1010 Ga0373933_0015838
1011 Ga0373933_0430269
1012 Ga0373937_0008656
1013 Ga0373937_0013329
1014 Ga0373937_0029670
1015 Ga0373925_0263156
1016 Ga0373925_0547196
1017 Ga0395898_0207065
1018 Ga0395901_0245121
1019 Ga0436365_0140160
1020 Ga0436365_1316487
1021 Ga0436363_1490899
1022 Ga0436362_0450863
1023 Ga0439465_0111504
1024 Ga0439431_0228757
1025 Ga0439445_0056905
1026 Ga0439449_0291364
1027 Ga0439446_0072451
1028 Ga0439458_0025731
1029 Ga0439444_0019035
1030 Ga0439464_0002851
1031 Ga0451577_0144944
1032 Ga0451577_0729289
1033 Ga0451577_0913976
1034 Ga0453683_0099500
1035 Ga0453684_0049866
1036 Ga0466957_1023629
1037 Ga0466960_0013180
1038 Ga0466960_0525112
1039 Ga0451576_0022930
1040 Ga0451576_0318769
1041 Ga0451576_0382140
1042 Ga0451576_0574218
1043 Ga0451576_1288122
1044 Ga0466967_1417402
1045 Ga0495592_0043940
1046 Ga0495651_0806934
1047 Ga0495580_0000622
1048 Ga0495580_0078715
1049 Ga0495580_0283045
1050 Ga0495639_0139049
1051 Ga0495662_0018502
1052 Ga0495662_0256783
1053 Ga0495628_0114618
1054 Ga0495630_0000001
1055 Ga0495630_0448229
1056 Ga0495630_1037067
1057 Ga0495640_0293967
1058 Ga0495587_0515188
1059 Ga0495634_0211517
1060 Ga0495657_0089840
1061 Ga0495647_0376440
1062 Ga0495674_1226079
1063 Ga0495680_0036897
1064 Ga0495680_0896071
1065 Ga0495602_0036929
1066 Ga0496100_1025908
1067 Ga0496101_0035270
1068 Ga0496101_0190707
1069 Ga0496101_0277558
1070 Ga0496102_0180058
1071 Ga0496102_0234633
1072 Ga0496104_0272850
1073 Ga0496104_1184284
1074 Ga0496105_0203407
1075 Ga0496106_0045863
1076 Ga0496106_0069625
1077 Ga0496106_0422048
1078 Ga0496107_0075172
1079 Ga0496109_0477645
1080 Ga0496109_0483033
1081 Ga0496110_0181694
1082 Ga0496110_0338191
1083 Ga0496111_0229470
1084 Ga0496112_0764070
1085 Ga0496114_0000157
1086 Ga0496115_0047466
1087 Ga0501298_189134
1088 Ga0501032_0769384
1089 Ga0501034_0031599
1090 Ga0501034_0113160
1091 Ga0501036_0962403
1092 Ga0501042_0665914
1093 Ga0501046_0094399
1094 Ga0501047_0035524
1095 Ga0501047_0278869
1096 Ga0501047_0283129
1097 Ga0501047_0782760
1098 Ga0501048_0016078
1099 Ga0501067_0230296
1100 Ga0501068_0066563
1101 Ga0501070_0070766
1102 Ga0501070_0118373
1103 Ga0501072_0509683
1104 Ga0501074_0193133
1105 Ga0501075_0036990
1106 Ga0501076_0507113
1107 Ga0501076_1055587
1108 Ga0501077_0000681
1109 Ga0501202_124071
1110 Ga0501233_049618
1111 Ga0501259_056914
1112 Ga0501080_0038253
1113 Ga0501080_0651631
1114 Ga0501035_0261037
1115 Ga0501044_0911300
1116 Ga0501045_0518387
1117 Ga0501045_1071190
1118 nmdc:mga03683_373679_c1
1119 nmdc:mga03n38_341258_c1
1120 nmdc:mga0k408_700_c1
1121 nmdc:mga06z11_4934_c1
1122 nmdc:mga04h51_10662_c1
1123 nmdc:mga07m45_93146_c1
1124 nmdc:mga05p37_1102025_c1
1125 nmdc:mga05p37_1177564_c1
1126 nmdc:mga05p37_1665_c1
1127 nmdc:mga09592_3444_c1
1128 nmdc:mga09592_943108_c1
1129 nmdc:mga0qj67_1068824_c1
1130 nmdc:mga0qj67_15830_c1
1131 nmdc:mga0qj67_82285_c1
1132 nmdc:mga06r32_104931_c1
1133 nmdc:mga06r32_179627_c1
1134 nmdc:mga06r32_24490_c1
1135 nmdc:mga06r32_633932_c1
1136 nmdc:mga06r32_669311_c1
1137 nmdc:mga08y16_1837797_c1
1138 nmdc:mga08y16_185775_c1
1139 nmdc:mga08y16_223373_c1
1140 nmdc:mga08y16_3553_c1
1141 nmdc:mga08y16_461970_c1
1142 nmdc:mga08y16_55608_c1
1143 nmdc:mga0n895_124363_c1
1144 nmdc:mga0n895_644733_c1
1145 nmdc:mga0n895_96820_c1
1146 nmdc:mga0rr50_133827_c1
1147 nmdc:mga0rr50_27911_c1
1148 nmdc:mga0rr50_775270_c1
1149 nmdc:mga0a205_1073049_c1
1150 nmdc:mga0a205_1132843_c1
1151 nmdc:mga0a205_2556_c1
1152 nmdc:mga0a205_637404_c1
1153 Ga0500646_0225900
1154 Ga0500652_096185
1155 Ga0501082_0000072
1156 Ga0501082_0337493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

27

140

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9398 2 124
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9395 2 122
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.9377 2 123
6bx4-assembly2.cif.gz_B the crystal structure of fluoride channel fluc ec2 with monobody s9 0.937 1 122
5kom-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f83i mutant 0.936 1 123
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9595 6 116 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9514 7 116 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.934 6 116 1.10.287.70
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9306 6 116 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9265 7 116 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7C5UM20-F1-model_v4 Fluoride-specific ion channel FluC 0.9924 2 125 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A7C6PQP6-F1-model_v4 Fluoride-specific ion channel FluC 0.9896 2 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1M3MX82-F1-model_v4 Fluoride-specific ion channel FluC 0.989 1 122 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A356TGG5-F1-model_v4 Fluoride-specific ion channel FluC 0.9877 1 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A7Y3JG48-F1-model_v4 Fluoride-specific ion channel FluC 0.986 3 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Map