F465708
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 341 | 566 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100000512|Ga0068864_10000051238 |
| Length | 125 |
| Sequence | MSIDGIGGGAMSVDRVMALRAQILERNQALSRAGDNAAVSTPGTIGGTGGTQPASFAQTLSDALNTVNAGQQKAADLSASYERGETIDIAKVMLARQEASVGFEATMQVRNKLLSAYKDIMSMPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 3 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 4 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 5 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 6 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 7 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 8 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 9 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 10 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 11 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 12 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 15 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 26 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 109 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 126 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 214 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 215 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 224 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 230 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 231 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 234 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 235 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 315 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 316 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 330 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 334 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 339 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 340 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 341 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 0.17 |
| Isolates | 2.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.87 |
| Bulb | 0 |
| Endosphere | 17.99 |
| Nodule | 0.35 |
| Rhizoplane | 3.81 |
| Rhizosphere | 68.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c014582 | 3300000041 | Bacteria | 680 |
| 2 | ARcpr5yngRDRAFT_c001077 | 3300000043 | Bacteria | 3090 |
| 3 | ARCol0yngRDRAFT_1015786 | 3300000652 | Bacteria | 570 |
| 4 | JGI24741J21665_1002900 | 3300001915 | Bacteria | 4293 |
| 5 | JGI24740J21852_10009356 | 3300001979 | Bacteria | 3842 |
| 6 | JGI24740J21852_10013488 | 3300001979 | Bacteria | 3044 |
| 7 | JGI24740J21852_10023649 | 3300001979 | Bacteria | 2095 |
| 8 | JGI24739J22299_10006986 | 3300001989 | Bacteria | 4252 |
| 9 | JGI24737J22298_10031352 | 3300001990 | Bacteria | 1660 |
| 10 | JGI24748J21848_1000023 | 3300002074 | Bacteria | 106523 |
| 11 | JGI24738J21930_10044854 | 3300002075 | Bacteria | 899 |
| 12 | JGI24749J21850_1000156 | 3300002076 | Bacteria | 10935 |
| 13 | JGI24034J26672_10000010 | 3300002239 | Bacteria | 150746 |
| 14 | JGI24742J22300_10017402 | 3300002244 | Bacteria | 1215 |
| 15 | JGI24751J29686_10049336 | 3300002459 | Bacteria | 868 |
| 16 | JGI25150J39212_1000135 | 3300002774 | Bacteria | 41540 |
| 17 | JGI25151J46595_10063231 | 3300003187 | Bacteria | 1165 |
| 18 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 19 | JGI25153J46596_10000073 | 3300003215 | Bacteria | 115166 |
| 20 | JGI25153J46596_10004475 | 3300003215 | Bacteria | 7533 |
| 21 | rootL2_10086552 | 3300003322 | Bacteria | 1331 |
| 22 | rootL2_10291844 | 3300003322 | Bacteria | 1117 |
| 23 | Ga0055542_1000353 | 3300003762 | Bacteria | 48131 |
| 24 | Ga0055529_1000377 | 3300003763 | Bacteria | 48143 |
| 25 | Ga0055526_1008606 | 3300003771 | Bacteria | 5055 |
| 26 | Ga0055537_1000896 | 3300003773 | Bacteria | 14122 |
| 27 | Ga0055537_1003695 | 3300003773 | Bacteria | 4629 |
| 28 | Ga0055524_1000244 | 3300003775 | Bacteria | 56875 |
| 29 | Ga0055536_1009513 | 3300003781 | Bacteria | 4008 |
| 30 | Ga0055528_1034524 | 3300003790 | Bacteria | 1245 |
| 31 | Ga0055530_10014066 | 3300003791 | Bacteria | 2690 |
| 32 | Ga0055530_10017873 | 3300003791 | Bacteria | 2206 |
| 33 | Ga0055540_1001397 | 3300003792 | Bacteria | 14403 |
| 34 | Ga0055531_10001111 | 3300003794 | Bacteria | 20915 |
| 35 | Ga0055543_1007973 | 3300004625 | Bacteria | 2389 |
| 36 | Ga0065165_1007527 | 3300005262 | Bacteria | 5324 |
| 37 | Ga0065165_1021463 | 3300005262 | Bacteria | 2243 |
| 38 | Ga0065165_1070188 | 3300005262 | Bacteria | 933 |
| 39 | Ga0070658_10000050 | 3300005327 | Bacteria | 119052 |
| 40 | Ga0070658_10000057 | 3300005327 | Bacteria | 113572 |
| 41 | Ga0070658_10104586 | 3300005327 | Bacteria | 2342 |
| 42 | Ga0070676_10679270 | 3300005328 | Unclassified | 750 |
| 43 | Ga0070683_101048199 | 3300005329 | Bacteria | 783 |
| 44 | Ga0070683_101059577 | 3300005329 | Bacteria | 779 |
| 45 | Ga0070670_100303741 | 3300005331 | Bacteria | 1396 |
| 46 | Ga0070670_100346298 | 3300005331 | Bacteria | 1305 |
| 47 | Ga0070666_10019177 | 3300005335 | Bacteria | 4412 |
| 48 | Ga0068868_100627143 | 3300005338 | Bacteria | 955 |
| 49 | Ga0070660_100002838 | 3300005339 | Bacteria | 11930 |
| 50 | Ga0070660_100992365 | 3300005339 | Bacteria | 709 |
| 51 | Ga0070661_100013732 | 3300005344 | Bacteria | 5689 |
| 52 | Ga0070668_100000119 | 3300005347 | Bacteria | 48651 |
| 53 | Ga0070668_100002467 | 3300005347 | Bacteria | 13618 |
| 54 | Ga0070668_100524958 | 3300005347 | Bacteria | 1028 |
| 55 | Ga0070668_102066056 | 3300005347 | Bacteria | 526 |
| 56 | Ga0070669_100014398 | 3300005353 | Bacteria | 5630 |
| 57 | Ga0070669_100131635 | 3300005353 | Bacteria | 1920 |
| 58 | Ga0070675_100106452 | 3300005354 | Bacteria | 2367 |
| 59 | Ga0070671_100292373 | 3300005355 | Bacteria | 1387 |
| 60 | Ga0070671_101509784 | 3300005355 | Bacteria | 595 |
| 61 | Ga0070673_100568277 | 3300005364 | Bacteria | 1032 |
| 62 | Ga0070659_100049994 | 3300005366 | Bacteria | 3288 |
| 63 | Ga0070659_100632487 | 3300005366 | Bacteria | 922 |
| 64 | Ga0070667_100000357 | 3300005367 | Bacteria | 49937 |
| 65 | Ga0070667_100113685 | 3300005367 | Bacteria | 2350 |
| 66 | Ga0070663_100958709 | 3300005455 | Bacteria | 742 |
| 67 | Ga0070663_101557172 | 3300005455 | Bacteria | 589 |
| 68 | Ga0070678_100063976 | 3300005456 | Bacteria | 2724 |
| 69 | Ga0070678_101117160 | 3300005456 | Bacteria | 728 |
| 70 | Ga0070662_100160946 | 3300005457 | Bacteria | 1756 |
| 71 | Ga0070662_100171954 | 3300005457 | Bacteria | 1702 |
| 72 | Ga0068867_100190815 | 3300005459 | Bacteria | 1635 |
| 73 | Ga0070685_11253676 | 3300005466 | Bacteria | 565 |
| 74 | Ga0070707_100778539 | 3300005468 | Bacteria | 920 |
| 75 | Ga0070698_101008150 | 3300005471 | Bacteria | 780 |
| 76 | Ga0070699_101796619 | 3300005518 | Bacteria | 561 |
| 77 | Ga0070684_100501475 | 3300005535 | Bacteria | 1124 |
| 78 | Ga0070684_101665788 | 3300005535 | Bacteria | 602 |
| 79 | Ga0068853_100156433 | 3300005539 | Bacteria | 2054 |
| 80 | Ga0068853_100489210 | 3300005539 | Bacteria | 1160 |
| 81 | Ga0070672_100271546 | 3300005543 | Bacteria | 1432 |
| 82 | Ga0070686_100002456 | 3300005544 | Bacteria | 10217 |
| 83 | Ga0070693_100187501 | 3300005547 | Bacteria | 1336 |
| 84 | Ga0068855_100008205 | 3300005563 | Bacteria | 12626 |
| 85 | Ga0068855_100357824 | 3300005563 | Bacteria | 1607 |
| 86 | Ga0068855_100563177 | 3300005563 | Bacteria | 1232 |
| 87 | Ga0070664_100127861 | 3300005564 | Bacteria | 2230 |
| 88 | Ga0070664_100179635 | 3300005564 | Bacteria | 1880 |
| 89 | Ga0068857_100646853 | 3300005577 | Bacteria | 1002 |
| 90 | Ga0068857_101325583 | 3300005577 | Bacteria | 699 |
| 91 | Ga0068857_101358641 | 3300005577 | Bacteria | 690 |
| 92 | Ga0068854_100001318 | 3300005578 | Bacteria | 14977 |
| 93 | Ga0068854_100545696 | 3300005578 | Bacteria | 982 |
| 94 | Ga0068856_100192320 | 3300005614 | Bacteria | 2054 |
| 95 | Ga0068856_100362316 | 3300005614 | Bacteria | 1468 |
| 96 | Ga0068856_100373216 | 3300005614 | Bacteria | 1445 |
| 97 | Ga0068856_100910960 | 3300005614 | Bacteria | 898 |
| 98 | Ga0068852_100154994 | 3300005616 | Bacteria | 2133 |
| 99 | Ga0068852_101152868 | 3300005616 | Bacteria | 796 |
| 100 | Ga0068852_101346391 | 3300005616 | Bacteria | 736 |
| 101 | Ga0068859_102105870 | 3300005617 | Bacteria | 623 |
| 102 | Ga0068864_100000512 | 3300005618 | Bacteria | 33477 |
| 103 | Ga0068861_100132553 | 3300005719 | Bacteria | 2024 |
| 104 | Ga0068861_100323665 | 3300005719 | Bacteria | 1343 |
| 105 | Ga0068851_10299820 | 3300005834 | Bacteria | 924 |
| 106 | Ga0068863_100000166 | 3300005841 | Bacteria | 71068 |
| 107 | Ga0068863_100005052 | 3300005841 | Bacteria | 13009 |
| 108 | Ga0068863_100349892 | 3300005841 | Bacteria | 1439 |
| 109 | Ga0068858_100000288 | 3300005842 | Bacteria | 54436 |
| 110 | Ga0068860_100101000 | 3300005843 | Bacteria | 2752 |
| 111 | Ga0068862_100007236 | 3300005844 | Bacteria | 9215 |
| 112 | Ga0068862_100018449 | 3300005844 | Bacteria | 5810 |
| 113 | Ga0068862_101095716 | 3300005844 | Bacteria | 791 |
| 114 | Ga0068862_101455734 | 3300005844 | Bacteria | 689 |
| 115 | Ga0081455_10000049 | 3300005937 | Bacteria | 126459 |
| 116 | Ga0081540_1058834 | 3300005983 | Bacteria | 1848 |
| 117 | Ga0075362_10230975 | 3300006177 | Bacteria | 906 |
| 118 | Ga0097621_100186209 | 3300006237 | Bacteria | 1796 |
| 119 | Ga0075370_10032663 | 3300006353 | Bacteria | 2911 |
| 120 | Ga0075370_10685878 | 3300006353 | Bacteria | 622 |
| 121 | Ga0075370_10704382 | 3300006353 | Bacteria | 614 |
| 122 | Ga0068871_100722740 | 3300006358 | Bacteria | 914 |
| 123 | Ga0068871_101111933 | 3300006358 | Bacteria | 739 |
| 124 | Ga0075430_101037875 | 3300006846 | Bacteria | 675 |
| 125 | Ga0075434_100470951 | 3300006871 | Bacteria | 1277 |
| 126 | Ga0068865_100465775 | 3300006881 | Bacteria | 1048 |
| 127 | Ga0097620_102106191 | 3300006931 | Bacteria | 623 |
| 128 | Ga0079104_1019212 | 3300006946 | Bacteria | 1916 |
| 129 | Ga0105250_10027805 | 3300009092 | Bacteria | 2279 |
| 130 | Ga0105240_10493651 | 3300009093 | Bacteria | 1363 |
| 131 | Ga0105245_10510539 | 3300009098 | Bacteria | 1219 |
| 132 | Ga0105247_10054793 | 3300009101 | Bacteria | 2461 |
| 133 | Ga0105247_11513283 | 3300009101 | Bacteria | 548 |
| 134 | Ga0105243_10000077 | 3300009148 | Bacteria | 110432 |
| 135 | Ga0105243_10981560 | 3300009148 | Bacteria | 846 |
| 136 | Ga0105241_10031269 | 3300009174 | Bacteria | 3986 |
| 137 | Ga0105241_10739271 | 3300009174 | Bacteria | 901 |
| 138 | Ga0105242_13041820 | 3300009176 | Bacteria | 519 |
| 139 | Ga0105248_10020187 | 3300009177 | Bacteria | 7382 |
| 140 | Ga0105248_10932467 | 3300009177 | Bacteria | 981 |
| 141 | Ga0105248_11957901 | 3300009177 | Bacteria | 665 |
| 142 | Ga0105237_10125704 | 3300009545 | Bacteria | 2559 |
| 143 | Ga0105237_10176343 | 3300009545 | Bacteria | 2137 |
| 144 | Ga0105237_10537488 | 3300009545 | Bacteria | 1175 |
| 145 | Ga0105238_10019274 | 3300009551 | Bacteria | 6950 |
| 146 | Ga0105238_10167642 | 3300009551 | Bacteria | 2172 |
| 147 | Ga0105238_10196334 | 3300009551 | Bacteria | 1994 |
| 148 | Ga0105249_10664199 | 3300009553 | Bacteria | 1100 |
| 149 | Ga0105148_102161 | 3300009978 | Bacteria | 1383 |
| 150 | Ga0105239_10265704 | 3300010375 | Bacteria | 1929 |
| 151 | Ga0105239_10474026 | 3300010375 | Bacteria | 1422 |
| 152 | Ga0105239_10528868 | 3300010375 | Bacteria | 1342 |
| 153 | Ga0105239_10575524 | 3300010375 | Bacteria | 1283 |
| 154 | Ga0105239_13047003 | 3300010375 | Bacteria | 546 |
| 155 | Ga0105246_10899178 | 3300011119 | Unclassified | 794 |
| 156 | Ga0157317_1002649 | 3300012475 | Bacteria | 1070 |
| 157 | Ga0157314_1010565 | 3300012500 | Bacteria | 800 |
| 158 | Ga0157313_1002072 | 3300012503 | Bacteria | 1161 |
| 159 | Ga0157373_10076123 | 3300013100 | Bacteria | 2368 |
| 160 | Ga0157373_10093852 | 3300013100 | Bacteria | 2113 |
| 161 | Ga0157373_11391634 | 3300013100 | Bacteria | 533 |
| 162 | Ga0157371_10000376 | 3300013102 | Bacteria | 56269 |
| 163 | Ga0157371_10091026 | 3300013102 | Bacteria | 2160 |
| 164 | Ga0157370_10083238 | 3300013104 | Bacteria | 3009 |
| 165 | Ga0157370_10304804 | 3300013104 | Bacteria | 1470 |
| 166 | Ga0157370_10892119 | 3300013104 | Bacteria | 807 |
| 167 | Ga0157370_11894846 | 3300013104 | Bacteria | 535 |
| 168 | Ga0157369_10215265 | 3300013105 | Bacteria | 2012 |
| 169 | Ga0157369_10313250 | 3300013105 | Bacteria | 1632 |
| 170 | Ga0157369_10313251 | 3300013105 | Bacteria | 1632 |
| 171 | Ga0157374_10386651 | 3300013296 | Bacteria | 1394 |
| 172 | Ga0157378_10257574 | 3300013297 | Bacteria | 1673 |
| 173 | Ga0163162_10002879 | 3300013306 | Bacteria | 16380 |
| 174 | Ga0163162_10090807 | 3300013306 | Bacteria | 3136 |
| 175 | Ga0163162_10138830 | 3300013306 | Bacteria | 2542 |
| 176 | Ga0163162_11362536 | 3300013306 | Bacteria | 807 |
| 177 | Ga0157372_10210567 | 3300013307 | Bacteria | 2253 |
| 178 | Ga0157375_11111792 | 3300013308 | Bacteria | 925 |
| 179 | Ga0157375_12621750 | 3300013308 | Bacteria | 602 |
| 180 | Ga0163163_10675384 | 3300014325 | Bacteria | 1096 |
| 181 | Ga0163163_10742123 | 3300014325 | Bacteria | 1045 |
| 182 | Ga0157380_10001483 | 3300014326 | Bacteria | 15349 |
| 183 | Ga0182008_10296491 | 3300014497 | Bacteria | 845 |
| 184 | Ga0157379_11289623 | 3300014968 | Bacteria | 705 |
| 185 | Ga0157376_10892582 | 3300014969 | Bacteria | 907 |
| 186 | Ga0157376_11920924 | 3300014969 | Bacteria | 629 |
| 187 | Ga0183360_11696 | 3300015689 | Bacteria | 789 |
| 188 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 189 | Ga0163161_10839692 | 3300017792 | Bacteria | 774 |
| 190 | Ga0206356_10597583 | 3300020070 | Bacteria | 2754 |
| 191 | Ga0213875_10293205 | 3300021388 | Bacteria | 769 |
| 192 | Ga0207672_1000207 | 3300025223 | Bacteria | 8253 |
| 193 | Ga0209674_108501 | 3300025226 | Bacteria | 1209 |
| 194 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 195 | Ga0207425_1021754 | 3300025245 | Bacteria | 1357 |
| 196 | Ga0209026_1011925 | 3300025250 | Bacteria | 1536 |
| 197 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 198 | Ga0209129_1003733 | 3300025258 | Bacteria | 6443 |
| 199 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 200 | Ga0209565_1000251 | 3300025263 | Bacteria | 57054 |
| 201 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 202 | Ga0209673_1003715 | 3300025273 | Bacteria | 8742 |
| 203 | Ga0209673_1038797 | 3300025273 | Bacteria | 1382 |
| 204 | Ga0209675_1020012 | 3300025291 | Bacteria | 1826 |
| 205 | Ga0209676_1007848 | 3300025292 | Bacteria | 4906 |
| 206 | Ga0209025_1000477 | 3300025294 | Bacteria | 77692 |
| 207 | Ga0209564_1002600 | 3300025295 | Bacteria | 13840 |
| 208 | Ga0209564_1035825 | 3300025295 | Bacteria | 1429 |
| 209 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 210 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 211 | Ga0209758_1008577 | 3300025297 | Bacteria | 6580 |
| 212 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 213 | Ga0209050_1000213 | 3300025298 | Bacteria | 129359 |
| 214 | Ga0209050_1002327 | 3300025298 | Bacteria | 16704 |
| 215 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 216 | Ga0209051_1000360 | 3300025303 | Bacteria | 67080 |
| 217 | Ga0209257_1002435 | 3300025304 | Bacteria | 18508 |
| 218 | Ga0209257_1017280 | 3300025304 | Bacteria | 2853 |
| 219 | Ga0209257_1031355 | 3300025304 | Bacteria | 1701 |
| 220 | Ga0207697_10029816 | 3300025315 | Bacteria | 2233 |
| 221 | Ga0207697_10278433 | 3300025315 | Bacteria | 741 |
| 222 | Ga0207656_10001313 | 3300025321 | Bacteria | 8183 |
| 223 | Ga0207688_10052344 | 3300025901 | Bacteria | 2287 |
| 224 | Ga0207680_10012515 | 3300025903 | Bacteria | 4324 |
| 225 | Ga0207647_10012841 | 3300025904 | Bacteria | 5818 |
| 226 | Ga0207705_10000014 | 3300025909 | Bacteria | 434286 |
| 227 | Ga0207705_10000145 | 3300025909 | Bacteria | 76141 |
| 228 | Ga0207705_10000175 | 3300025909 | Bacteria | 68190 |
| 229 | Ga0207654_10001453 | 3300025911 | Bacteria | 12567 |
| 230 | Ga0207695_10007837 | 3300025913 | Bacteria | 13512 |
| 231 | Ga0207695_10124923 | 3300025913 | Bacteria | 2537 |
| 232 | Ga0207695_10514781 | 3300025913 | Bacteria | 1078 |
| 233 | Ga0207671_10012962 | 3300025914 | Bacteria | 6671 |
| 234 | Ga0207671_10124184 | 3300025914 | Bacteria | 1976 |
| 235 | Ga0207662_10301226 | 3300025918 | Bacteria | 1066 |
| 236 | Ga0207657_10001736 | 3300025919 | Bacteria | 23488 |
| 237 | Ga0207657_10010116 | 3300025919 | Bacteria | 9428 |
| 238 | Ga0207657_10111605 | 3300025919 | Bacteria | 2257 |
| 239 | Ga0207649_10000356 | 3300025920 | Bacteria | 34254 |
| 240 | Ga0207649_10072319 | 3300025920 | Bacteria | 2206 |
| 241 | Ga0207649_10349233 | 3300025920 | Bacteria | 1094 |
| 242 | Ga0207649_11497616 | 3300025920 | Bacteria | 534 |
| 243 | Ga0207646_10829703 | 3300025922 | Bacteria | 822 |
| 244 | Ga0207681_10010518 | 3300025923 | Bacteria | 5667 |
| 245 | Ga0207681_10256885 | 3300025923 | Bacteria | 1366 |
| 246 | Ga0207681_10533001 | 3300025923 | Bacteria | 965 |
| 247 | Ga0207681_11154288 | 3300025923 | Bacteria | 651 |
| 248 | Ga0207694_10032950 | 3300025924 | Bacteria | 3968 |
| 249 | Ga0207694_10129540 | 3300025924 | Bacteria | 2022 |
| 250 | Ga0207694_10175151 | 3300025924 | Bacteria | 1738 |
| 251 | Ga0207650_10017523 | 3300025925 | Bacteria | 5018 |
| 252 | Ga0207650_10264172 | 3300025925 | Bacteria | 1397 |
| 253 | Ga0207659_10199359 | 3300025926 | Bacteria | 1597 |
| 254 | Ga0207687_10107527 | 3300025927 | Bacteria | 2064 |
| 255 | Ga0207644_11806421 | 3300025931 | Bacteria | 511 |
| 256 | Ga0207690_10000740 | 3300025932 | Bacteria | 21050 |
| 257 | Ga0207690_10902023 | 3300025932 | Bacteria | 733 |
| 258 | Ga0207690_11782033 | 3300025932 | Bacteria | 514 |
| 259 | Ga0207706_10027462 | 3300025933 | Bacteria | 5088 |
| 260 | Ga0207706_10157746 | 3300025933 | Bacteria | 1995 |
| 261 | Ga0207706_11143824 | 3300025933 | Bacteria | 649 |
| 262 | Ga0207709_10000110 | 3300025935 | Bacteria | 127725 |
| 263 | Ga0207669_10000180 | 3300025937 | Bacteria | 29217 |
| 264 | Ga0207669_10004008 | 3300025937 | Bacteria | 6438 |
| 265 | Ga0207669_10875886 | 3300025937 | Bacteria | 749 |
| 266 | Ga0207691_10146371 | 3300025940 | Bacteria | 2079 |
| 267 | Ga0207691_10237993 | 3300025940 | Bacteria | 1575 |
| 268 | Ga0207711_10006235 | 3300025941 | Bacteria | 10061 |
| 269 | Ga0207711_10154354 | 3300025941 | Bacteria | 2074 |
| 270 | Ga0207711_10947418 | 3300025941 | Bacteria | 800 |
| 271 | Ga0207689_10111078 | 3300025942 | Bacteria | 2253 |
| 272 | Ga0207661_10107178 | 3300025944 | Bacteria | 2357 |
| 273 | Ga0207661_11576007 | 3300025944 | Bacteria | 601 |
| 274 | Ga0207679_10248378 | 3300025945 | Bacteria | 1511 |
| 275 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 276 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 277 | Ga0207667_10030786 | 3300025949 | Bacteria | 5800 |
| 278 | Ga0207651_11265471 | 3300025960 | Bacteria | 663 |
| 279 | Ga0207668_10000142 | 3300025972 | Bacteria | 48783 |
| 280 | Ga0207668_10167392 | 3300025972 | Bacteria | 1720 |
| 281 | Ga0207668_10446666 | 3300025972 | Bacteria | 1102 |
| 282 | Ga0207640_11609093 | 3300025981 | Bacteria | 585 |
| 283 | Ga0207658_10000309 | 3300025986 | Bacteria | 49982 |
| 284 | Ga0207658_10093098 | 3300025986 | Bacteria | 2343 |
| 285 | Ga0207677_10079560 | 3300026023 | Bacteria | 2344 |
| 286 | Ga0207703_10000499 | 3300026035 | Bacteria | 40585 |
| 287 | Ga0207703_10873846 | 3300026035 | Bacteria | 860 |
| 288 | Ga0207639_10006283 | 3300026041 | Bacteria | 8068 |
| 289 | Ga0207639_10477193 | 3300026041 | Bacteria | 1136 |
| 290 | Ga0207678_10026444 | 3300026067 | Bacteria | 5061 |
| 291 | Ga0207678_11341710 | 3300026067 | Bacteria | 633 |
| 292 | Ga0207702_10009788 | 3300026078 | Bacteria | 8041 |
| 293 | Ga0207702_10277187 | 3300026078 | Bacteria | 1584 |
| 294 | Ga0207702_11961022 | 3300026078 | Bacteria | 576 |
| 295 | Ga0207641_10000239 | 3300026088 | Bacteria | 71088 |
| 296 | Ga0207641_10000263 | 3300026088 | Bacteria | 66525 |
| 297 | Ga0207641_10036160 | 3300026088 | Bacteria | 4121 |
| 298 | Ga0207648_10056611 | 3300026089 | Bacteria | 3421 |
| 299 | Ga0207676_10000462 | 3300026095 | Bacteria | 34094 |
| 300 | Ga0207674_10095289 | 3300026116 | Bacteria | 2962 |
| 301 | Ga0207675_100000131 | 3300026118 | Bacteria | 62791 |
| 302 | Ga0207675_100173025 | 3300026118 | Bacteria | 2065 |
| 303 | Ga0207683_10002356 | 3300026121 | Bacteria | 16533 |
| 304 | Ga0207698_10118919 | 3300026142 | Bacteria | 2232 |
| 305 | Ga0207698_10344540 | 3300026142 | Bacteria | 1405 |
| 306 | Ga0207698_11318135 | 3300026142 | Bacteria | 737 |
| 307 | Ga0207698_11694738 | 3300026142 | Bacteria | 647 |
| 308 | Ga0207698_11860258 | 3300026142 | Bacteria | 617 |
| 309 | Ga0209281_1013547 | 3300027111 | Bacteria | 1756 |
| 310 | Ga0209971_1012838 | 3300027682 | Bacteria | 1985 |
| 311 | Ga0268265_10000347 | 3300028380 | Bacteria | 50038 |
| 312 | Ga0268265_11064554 | 3300028380 | Bacteria | 801 |
| 313 | Ga0268264_10081868 | 3300028381 | Bacteria | 2760 |
| 314 | Ga0307517_10010535 | 3300028786 | Bacteria | 12933 |
| 315 | Ga0307513_10013397 | 3300031456 | Bacteria | 10063 |
| 316 | Ga0307513_10056040 | 3300031456 | Bacteria | 4212 |
| 317 | Ga0307408_100291702 | 3300031548 | Bacteria | 1362 |
| 318 | Ga0307405_10019245 | 3300031731 | Bacteria | 3787 |
| 319 | Ga0307406_10143174 | 3300031901 | Bacteria | 1695 |
| 320 | Ga0307407_10078246 | 3300031903 | Bacteria | 1992 |
| 321 | Ga0307412_10008992 | 3300031911 | Bacteria | 5724 |
| 322 | Ga0307412_10080016 | 3300031911 | Bacteria | 2256 |
| 323 | Ga0307412_10219688 | 3300031911 | Bacteria | 1456 |
| 324 | Ga0307409_100236548 | 3300031995 | Bacteria | 1660 |
| 325 | Ga0307416_100014503 | 3300032002 | Bacteria | 5406 |
| 326 | Ga0307414_10093964 | 3300032004 | Bacteria | 2237 |
| 327 | Ga0307411_10194422 | 3300032005 | Bacteria | 1552 |
| 328 | Ga0307510_10002511 | 3300033180 | Bacteria | 20892 |
| 329 | Ga0307510_10034976 | 3300033180 | Bacteria | 5616 |
| 330 | Ga0373954_0136606 | 3300035118 | Bacteria | 1195 |
| 331 | Ga0436364_0376551 | 3300037853 | Bacteria | 945 |
| 332 | Ga0436365_0623759 | 3300039437 | Bacteria | 1289 |
| 333 | Ga0436365_1719205 | 3300039437 | Bacteria | 1440 |
| 334 | Ga0436363_0066076 | 3300039450 | Bacteria | 2967 |
| 335 | Ga0436363_0878797 | 3300039450 | Bacteria | 1342 |
| 336 | Ga0439439_0062767 | 3300041406 | Bacteria | 988 |
| 337 | Ga0439447_171077 | 3300041407 | Bacteria | 501 |
| 338 | Ga0439461_0000016 | 3300041410 | Bacteria | 22235 |
| 339 | Ga0439461_0024660 | 3300041410 | Bacteria | 1217 |
| 340 | Ga0439466_0043324 | 3300041411 | Bacteria | 1495 |
| 341 | Ga0439465_0000383 | 3300041413 | Bacteria | 12773 |
| 342 | Ga0439465_0235968 | 3300041413 | Bacteria | 673 |
| 343 | Ga0451789_0191616 | 3300041443 | Bacteria | 602 |
| 344 | Ga0451795_1493436 | 3300041456 | Bacteria | 731 |
| 345 | Ga0451804_1081906 | 3300041463 | Bacteria | 564 |
| 346 | Ga0451853_0928386 | 3300041512 | Bacteria | 1027 |
| 347 | Ga0439431_0074304 | 3300041997 | Bacteria | 909 |
| 348 | Ga0439433_0151568 | 3300041999 | Bacteria | 597 |
| 349 | Ga0439442_011840 | 3300042002 | Bacteria | 1780 |
| 350 | Ga0439445_0000596 | 3300042004 | Bacteria | 7408 |
| 351 | Ga0439445_0010152 | 3300042004 | Bacteria | 2224 |
| 352 | Ga0439448_0082116 | 3300042005 | Bacteria | 1083 |
| 353 | Ga0439432_025619 | 3300042006 | Bacteria | 1933 |
| 354 | Ga0439449_0226626 | 3300042007 | Bacteria | 701 |
| 355 | Ga0439452_047965 | 3300042010 | Bacteria | 986 |
| 356 | Ga0439457_015805 | 3300042014 | Bacteria | 1684 |
| 357 | Ga0439462_0011139 | 3300042015 | Bacteria | 2285 |
| 358 | Ga0450890_006555 | 3300042127 | Bacteria | 1488 |
| 359 | Ga0450908_037927 | 3300042184 | Bacteria | 835 |
| 360 | Ga0439434_0000681 | 3300042435 | Bacteria | 9802 |
| 361 | Ga0439434_0007685 | 3300042435 | Bacteria | 3159 |
| 362 | Ga0439459_0198010 | 3300042438 | Bacteria | 547 |
| 363 | Ga0466971_0001334 | 3300044719 | Bacteria | 10314 |
| 364 | Ga0466970_0041610 | 3300044765 | Bacteria | 2442 |
| 365 | Ga0495627_016344 | 3300046453 | Bacteria | 2542 |
| 366 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 367 | Ga0495638_0000253 | 3300046460 | Bacteria | 72446 |
| 368 | Ga0495638_0149484 | 3300046460 | Bacteria | 1356 |
| 369 | Ga0495638_0274181 | 3300046460 | Bacteria | 919 |
| 370 | Ga0495650_0000364 | 3300046471 | Bacteria | 79811 |
| 371 | Ga0495650_0000861 | 3300046471 | Bacteria | 36461 |
| 372 | Ga0495584_0031870 | 3300046491 | Bacteria | 2668 |
| 373 | Ga0495584_0032605 | 3300046491 | Bacteria | 2636 |
| 374 | Ga0495585_0059085 | 3300046492 | Bacteria | 2114 |
| 375 | Ga0495585_0087333 | 3300046492 | Bacteria | 1683 |
| 376 | Ga0495596_0011775 | 3300046500 | Bacteria | 3757 |
| 377 | Ga0495583_0000311 | 3300046506 | Bacteria | 76925 |
| 378 | Ga0495583_0000422 | 3300046506 | Bacteria | 64011 |
| 379 | Ga0495583_0006357 | 3300046506 | Bacteria | 7745 |
| 380 | Ga0495583_0009032 | 3300046506 | Bacteria | 6005 |
| 381 | Ga0495606_0000071 | 3300046507 | Bacteria | 175933 |
| 382 | Ga0495606_0009784 | 3300046507 | Bacteria | 8056 |
| 383 | Ga0495616_0000013 | 3300046513 | Bacteria | 202334 |
| 384 | Ga0495616_0109386 | 3300046513 | Bacteria | 1285 |
| 385 | Ga0495632_0000359 | 3300046519 | Bacteria | 43288 |
| 386 | Ga0495637_0013302 | 3300046520 | Bacteria | 3908 |
| 387 | Ga0495643_0005960 | 3300046522 | Bacteria | 8134 |
| 388 | Ga0495643_0059810 | 3300046522 | Bacteria | 2024 |
| 389 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 390 | Ga0495648_0004148 | 3300046524 | Bacteria | 12456 |
| 391 | Ga0495648_0011410 | 3300046524 | Bacteria | 6693 |
| 392 | Ga0495648_0011503 | 3300046524 | Bacteria | 6658 |
| 393 | Ga0495663_0005078 | 3300046525 | Bacteria | 3676 |
| 394 | Ga0495663_0024185 | 3300046525 | Bacteria | 1764 |
| 395 | Ga0495663_0095737 | 3300046525 | Bacteria | 972 |
| 396 | Ga0495642_0002920 | 3300046528 | Bacteria | 6808 |
| 397 | Ga0495642_0129605 | 3300046528 | Bacteria | 1085 |
| 398 | Ga0495654_0001078 | 3300046530 | Bacteria | 19876 |
| 399 | Ga0495654_0173140 | 3300046530 | Bacteria | 940 |
| 400 | Ga0495609_0116761 | 3300046538 | Bacteria | 1149 |
| 401 | Ga0495597_0043979 | 3300046542 | Bacteria | 1987 |
| 402 | Ga0495622_0026294 | 3300046557 | Bacteria | 2718 |
| 403 | Ga0495622_0064688 | 3300046557 | Bacteria | 1691 |
| 404 | Ga0495633_0000102 | 3300046558 | Bacteria | 115655 |
| 405 | Ga0495633_0015197 | 3300046558 | Bacteria | 3999 |
| 406 | Ga0495633_0091476 | 3300046558 | Bacteria | 1414 |
| 407 | Ga0495633_0245384 | 3300046558 | Bacteria | 817 |
| 408 | Ga0495668_0000335 | 3300046616 | Bacteria | 64094 |
| 409 | Ga0495668_0003028 | 3300046616 | Bacteria | 13087 |
| 410 | Ga0495668_0004587 | 3300046616 | Bacteria | 9720 |
| 411 | Ga0495668_0010516 | 3300046616 | Bacteria | 5596 |
| 412 | Ga0495668_0013888 | 3300046616 | Bacteria | 4736 |
| 413 | Ga0495668_0543449 | 3300046616 | Bacteria | 641 |
| 414 | Ga0495668_0772829 | 3300046616 | Bacteria | 532 |
| 415 | Ga0495611_0011045 | 3300046648 | Bacteria | 3824 |
| 416 | Ga0495611_0365635 | 3300046648 | Bacteria | 661 |
| 417 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 418 | Ga0495625_0000212 | 3300046660 | Bacteria | 91883 |
| 419 | Ga0495625_0012733 | 3300046660 | Bacteria | 6802 |
| 420 | Ga0495625_0032342 | 3300046660 | Bacteria | 3880 |
| 421 | Ga0495625_0049982 | 3300046660 | Bacteria | 3003 |
| 422 | Ga0495625_0095060 | 3300046660 | Bacteria | 2055 |
| 423 | Ga0495625_0104248 | 3300046660 | Bacteria | 1944 |
| 424 | Ga0495625_0110302 | 3300046660 | Bacteria | 1881 |
| 425 | Ga0495625_0121079 | 3300046660 | Bacteria | 1780 |
| 426 | Ga0495625_0272424 | 3300046660 | Bacteria | 1092 |
| 427 | Ga0495625_0835857 | 3300046660 | Bacteria | 533 |
| 428 | Ga0495661_0378506 | 3300046665 | Bacteria | 692 |
| 429 | Ga0495661_0593238 | 3300046665 | Bacteria | 521 |
| 430 | Ga0495669_0000016 | 3300046684 | Bacteria | 135096 |
| 431 | Ga0495613_0210665 | 3300046689 | Bacteria | 1367 |
| 432 | Ga0495670_0002841 | 3300046691 | Bacteria | 8561 |
| 433 | Ga0495670_0166050 | 3300046691 | Bacteria | 1161 |
| 434 | Ga0495670_0194420 | 3300046691 | Bacteria | 1073 |
| 435 | Ga0495670_0234624 | 3300046691 | Bacteria | 976 |
| 436 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 437 | Ga0495671_0001468 | 3300046692 | Bacteria | 15811 |
| 438 | Ga0495671_0646683 | 3300046692 | Bacteria | 502 |
| 439 | Ga0495649_0045366 | 3300046694 | Bacteria | 2396 |
| 440 | Ga0495649_0067080 | 3300046694 | Bacteria | 1925 |
| 441 | Ga0495589_0007669 | 3300046794 | Bacteria | 5653 |
| 442 | Ga0495600_0341717 | 3300046809 | Bacteria | 938 |
| 443 | Ga0495660_0100344 | 3300046810 | Bacteria | 1491 |
| 444 | Ga0495660_0404959 | 3300046810 | Bacteria | 597 |
| 445 | Ga0495660_0517350 | 3300046810 | Bacteria | 508 |
| 446 | Ga0495604_0968883 | 3300047317 | Bacteria | 528 |
| 447 | Ga0495683_0015856 | 3300047323 | Bacteria | 3913 |
| 448 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 449 | Ga0495687_007447 | 3300047443 | Bacteria | 6443 |
| 450 | Ga0495677_0002869 | 3300047445 | Bacteria | 6717 |
| 451 | Ga0495677_0012258 | 3300047445 | Bacteria | 3128 |
| 452 | Ga0495685_082289 | 3300047447 | Bacteria | 1072 |
| 453 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 454 | Ga0495673_0066082 | 3300047469 | Bacteria | 1534 |
| 455 | Ga0495681_0011962 | 3300047470 | Bacteria | 5126 |
| 456 | Ga0495681_0012432 | 3300047470 | Bacteria | 5001 |
| 457 | Ga0495686_0206804 | 3300047472 | Bacteria | 1123 |
| 458 | Ga0496101_0448668 | 3300048904 | Bacteria | 1018 |
| 459 | Ga0496101_0752839 | 3300048904 | Bacteria | 769 |
| 460 | Ga0496102_0000218 | 3300048905 | Bacteria | 75909 |
| 461 | Ga0496103_0000045 | 3300048906 | Bacteria | 165828 |
| 462 | Ga0496103_0004526 | 3300048906 | Bacteria | 8422 |
| 463 | Ga0496103_0286144 | 3300048906 | Bacteria | 1060 |
| 464 | Ga0496103_0952809 | 3300048906 | Bacteria | 536 |
| 465 | Ga0496104_0061903 | 3300048907 | Bacteria | 3548 |
| 466 | Ga0496104_0115782 | 3300048907 | Bacteria | 2572 |
| 467 | Ga0496105_0000559 | 3300048908 | Bacteria | 24579 |
| 468 | Ga0496105_0045019 | 3300048908 | Bacteria | 3641 |
| 469 | Ga0496106_0210081 | 3300048909 | Bacteria | 1550 |
| 470 | Ga0496108_0462648 | 3300048911 | Bacteria | 1108 |
| 471 | Ga0496109_0048777 | 3300048912 | Bacteria | 3853 |
| 472 | Ga0496111_0004043 | 3300048914 | Bacteria | 9212 |
| 473 | Ga0496112_0195922 | 3300048915 | Bacteria | 1981 |
| 474 | Ga0496114_0015728 | 3300048917 | Bacteria | 6088 |
| 475 | Ga0496115_0000136 | 3300048918 | Bacteria | 67646 |
| 476 | Ga0496115_0000310 | 3300048918 | Bacteria | 41423 |
| 477 | Ga0496116_0001537 | 3300048919 | Bacteria | 25567 |
| 478 | Ga0496117_0000046 | 3300048920 | Bacteria | 300879 |
| 479 | Ga0496117_0005707 | 3300048920 | Bacteria | 12955 |
| 480 | Ga0496117_0024874 | 3300048920 | Bacteria | 4719 |
| 481 | Ga0496117_0117256 | 3300048920 | Bacteria | 1644 |
| 482 | Ga0496118_0000036 | 3300048921 | Bacteria | 318213 |
| 483 | Ga0496118_0000873 | 3300048921 | Bacteria | 47650 |
| 484 | Ga0496118_0044754 | 3300048921 | Bacteria | 3462 |
| 485 | Ga0496118_0342565 | 3300048921 | Bacteria | 800 |
| 486 | Ga0496119_0016658 | 3300048922 | Bacteria | 5578 |
| 487 | Ga0496119_0167459 | 3300048922 | Bacteria | 1163 |
| 488 | Ga0496120_0012993 | 3300048923 | Bacteria | 5631 |
| 489 | Ga0496120_0211205 | 3300048923 | Bacteria | 933 |
| 490 | Ga0496121_0000163 | 3300048924 | Bacteria | 145648 |
| 491 | Ga0496121_0000267 | 3300048924 | Bacteria | 109129 |
| 492 | Ga0496121_0191252 | 3300048924 | Bacteria | 1467 |
| 493 | Ga0496122_0000176 | 3300048925 | Bacteria | 152190 |
| 494 | Ga0496122_0030656 | 3300048925 | Bacteria | 4499 |
| 495 | Ga0496122_0334226 | 3300048925 | Bacteria | 799 |
| 496 | Ga0496123_0000220 | 3300048926 | Bacteria | 115824 |
| 497 | Ga0496123_0008373 | 3300048926 | Bacteria | 9508 |
| 498 | Ga0496123_0138332 | 3300048926 | Bacteria | 1336 |
| 499 | Ga0496123_0349080 | 3300048926 | Bacteria | 689 |
| 500 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 501 | Ga0496124_0088150 | 3300048927 | Bacteria | 2537 |
| 502 | Ga0496125_0000919 | 3300048928 | Bacteria | 46303 |
| 503 | Ga0496125_0244802 | 3300048928 | Bacteria | 1136 |
| 504 | Ga0496126_0000440 | 3300048929 | Bacteria | 82896 |
| 505 | Ga0496126_0132521 | 3300048929 | Bacteria | 2152 |
| 506 | Ga0501223_000068 | 3300049663 | Bacteria | 31779 |
| 507 | Ga0501225_0032185 | 3300049705 | Bacteria | 1443 |
| 508 | Ga0501241_020003 | 3300049758 | Bacteria | 1230 |
| 509 | Ga0501263_033744 | 3300049760 | Bacteria | 731 |
| 510 | Ga0501035_0469616 | 3300049822 | Bacteria | 1039 |
| 511 | nmdc:mga0k408_680189_c1 | 3300050493 | Bacteria | 604 |
| 512 | nmdc:mga0n895_283835_c1 | 3300050512 | Bacteria | 1679 |
| 513 | Ga0500610_0000177 | 3300053079 | Bacteria | 19233 |
| 514 | Ga0495619_0385739 | 3300053085 | Bacteria | 968 |
| 515 | Ga0500643_000198 | 3300053087 | Bacteria | 57293 |
| 516 | Ga0500643_004388 | 3300053087 | Bacteria | 6401 |
| 517 | Ga0500643_019936 | 3300053087 | Bacteria | 2201 |
| 518 | Ga0500644_0042264 | 3300053088 | Bacteria | 1519 |
| 519 | Ga0500646_0013617 | 3300053090 | Bacteria | 2106 |
| 520 | Ga0500646_0051018 | 3300053090 | Bacteria | 1194 |
| 521 | Ga0500647_0085607 | 3300053091 | Bacteria | 1511 |
| 522 | Ga0500583_0471968 | 3300053092 | Bacteria | 593 |
| 523 | Ga0500651_0469138 | 3300053093 | Bacteria | 698 |
| 524 | Ga0500566_0000390 | 3300053094 | Bacteria | 24310 |
| 525 | Ga0500641_0022767 | 3300053096 | Bacteria | 2403 |
| 526 | Ga0500556_0023742 | 3300053104 | Bacteria | 2007 |
| 527 | Ga0500562_000641 | 3300053108 | Bacteria | 8461 |
| 528 | Ga0500562_016888 | 3300053108 | Bacteria | 1878 |
| 529 | Ga0500562_135535 | 3300053108 | Bacteria | 671 |
| 530 | Ga0500594_0009535 | 3300053118 | Bacteria | 2237 |
| 531 | Ga0500595_000561 | 3300053119 | Bacteria | 22169 |
| 532 | Ga0500595_003380 | 3300053119 | Bacteria | 7474 |
| 533 | Ga0500626_070579 | 3300053128 | Bacteria | 1555 |
| 534 | Ga0500642_0000820 | 3300053130 | Bacteria | 9091 |
| 535 | Ga0500652_094110 | 3300053131 | Bacteria | 1251 |
| 536 | Ga0500658_0000712 | 3300053134 | Bacteria | 13753 |
| 537 | Ga0500658_0003978 | 3300053134 | Bacteria | 5547 |
| 538 | Ga0500658_0050036 | 3300053134 | Bacteria | 1705 |
| 539 | Ga0500559_0001109 | 3300053136 | Bacteria | 16234 |
| 540 | Ga0500559_0035224 | 3300053136 | Bacteria | 2161 |
| 541 | Ga0500559_0044255 | 3300053136 | Bacteria | 1947 |
| 542 | Ga0500559_0051515 | 3300053136 | Bacteria | 1818 |
| 543 | Ga0500559_0221315 | 3300053136 | Bacteria | 892 |
| 544 | Ga0500564_235322 | 3300053138 | Bacteria | 734 |
| 545 | Ga0500568_0005082 | 3300053139 | Bacteria | 6882 |
| 546 | Ga0500568_0020938 | 3300053139 | Bacteria | 2821 |
| 547 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 548 | Ga0500573_0056822 | 3300053140 | Bacteria | 2247 |
| 549 | Ga0500604_0000209 | 3300053151 | Bacteria | 16814 |
| 550 | Ga0500604_0001692 | 3300053151 | Bacteria | 6195 |
| 551 | Ga0500604_0322580 | 3300053151 | Bacteria | 536 |
| 552 | Ga0500604_0331370 | 3300053151 | Bacteria | 528 |
| 553 | Ga0500616_0002626 | 3300053153 | Bacteria | 14669 |
| 554 | Ga0500619_002987 | 3300053154 | Bacteria | 3372 |
| 555 | Ga0500622_0081920 | 3300053156 | Bacteria | 1615 |
| 556 | Ga0500627_0003617 | 3300053158 | Bacteria | 4819 |
| 557 | Ga0500627_0023169 | 3300053158 | Bacteria | 2528 |
| 558 | Ga0500636_0005235 | 3300053177 | Bacteria | 7384 |
| 559 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 560 | Ga0500645_004247 | 3300053730 | Bacteria | 5558 |
| 561 | Ga0500645_009030 | 3300053730 | Bacteria | 3367 |
| 562 | Ga0500609_005248 | 3300053731 | Bacteria | 1771 |
| 563 | Ga0500596_000564 | 3300053735 | Bacteria | 7057 |
| 564 | Ga0500661_000242 | 3300055283 | Bacteria | 9826 |
| 565 | Ga0500661_015226 | 3300055283 | Bacteria | 1380 |
| 566 | Ga0466962_0106486 | 3300061719 | Bacteria | 1348 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100470951 | Ga0075434_1004709511 | 89 |
| 2 | 3300050512 | nmdc:mga0n895_283835_c1 | nmdc:mga0n895_283835_c1_914_1261 | 89 |
| 3 | 3300005617 | Ga0068859_102105870 | Ga0068859_1021058702 | 93 |
| 4 | 3300006931 | Ga0097620_102106191 | Ga0097620_1021061912 | 93 |
| 5 | 3300025918 | Ga0207662_10301226 | Ga0207662_103012262 | 93 |
| 6 | 3300005539 | Ga0068853_100489210 | Ga0068853_1004892102 | 96 |
| 7 | 3300013104 | Ga0157370_10083238 | Ga0157370_100832383 | 96 |
| 8 | 3300044719 | Ga0466971_0001334 | Ga0466971_0001334_8274_8648 | 97 |
| 9 | 3300044765 | Ga0466970_0041610 | Ga0466970_0041610_1644_2018 | 97 |
| 10 | 3300048923 | Ga0496120_0211205 | Ga0496120_0211205_585_905 | 97 |
| 11 | 3300061719 | Ga0466962_0106486 | Ga0466962_0106486_777_1151 | 97 |
| 12 | 3300005327 | Ga0070658_10000057 | Ga0070658_1000005780 | 98 |
| 13 | 3300025909 | Ga0207705_10000145 | Ga0207705_1000014543 | 98 |
| 14 | 3300025919 | Ga0207657_10001736 | Ga0207657_1000173612 | 98 |
| 15 | 3300025932 | Ga0207690_10902023 | Ga0207690_109020232 | 98 |
| 16 | 3300003322 | rootL2_10086552 | rootL2_100865521 | 99 |
| 17 | 3300049822 | Ga0501035_0469616 | Ga0501035_0469616_61_432 | 99 |
| 18 | 3300053108 | Ga0500562_000641 | Ga0500562_000641_864_1211 | 99 |
| 19 | 3300005471 | Ga0070698_101008150 | Ga0070698_1010081502 | 100 |
| 20 | 3300013307 | Ga0157372_10210567 | Ga0157372_102105673 | 100 |
| 21 | 3300013308 | Ga0157375_12621750 | Ga0157375_126217501 | 100 |
| 22 | 3300027682 | Ga0209971_1012838 | Ga0209971_10128382 | 100 |
| 23 | 3300037853 | Ga0436364_0376551 | Ga0436364_0376551_27_350 | 100 |
| 24 | 3300046558 | Ga0495633_0000102 | Ga0495633_0000102_29882_30241 | 100 |
| 25 | 3300048926 | Ga0496123_0349080 | Ga0496123_0349080_13_333 | 100 |
| 26 | 3300001979 | JGI24740J21852_10013488 | JGI24740J21852_100134883 | 101 |
| 27 | 3300005339 | Ga0070660_100002838 | Ga0070660_1000028383 | 101 |
| 28 | 3300005563 | Ga0068855_100357824 | Ga0068855_1003578242 | 101 |
| 29 | 3300005577 | Ga0068857_100646853 | Ga0068857_1006468532 | 101 |
| 30 | 3300005834 | Ga0068851_10299820 | Ga0068851_102998202 | 101 |
| 31 | 3300009545 | Ga0105237_10125704 | Ga0105237_101257042 | 101 |
| 32 | 3300010375 | Ga0105239_10474026 | Ga0105239_104740262 | 101 |
| 33 | 3300013105 | Ga0157369_10215265 | Ga0157369_102152652 | 101 |
| 34 | 3300025914 | Ga0207671_10124184 | Ga0207671_101241842 | 101 |
| 35 | 3300025919 | Ga0207657_10010116 | Ga0207657_1001011611 | 101 |
| 36 | 3300025949 | Ga0207667_10030786 | Ga0207667_100307862 | 101 |
| 37 | 3300046460 | Ga0495638_0000051 | Ga0495638_0000051_86615_86974 | 101 |
| 38 | 3300046506 | Ga0495583_0000422 | Ga0495583_0000422_28621_28980 | 101 |
| 39 | 3300046519 | Ga0495632_0000359 | Ga0495632_0000359_11881_12240 | 101 |
| 40 | 3300046524 | Ga0495648_0000032 | Ga0495648_0000032_119010_119369 | 101 |
| 41 | 3300046558 | Ga0495633_0245384 | Ga0495633_0245384_446_805 | 101 |
| 42 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_86003_86362 | 101 |
| 43 | 3300046810 | Ga0495660_0517350 | Ga0495660_0517350_15_335 | 101 |
| 44 | 3300047469 | Ga0495673_0000076 | Ga0495673_0000076_119111_119470 | 101 |
| 45 | 3300053108 | Ga0500562_016888 | Ga0500562_016888_990_1340 | 101 |
| 46 | 3300049663 | Ga0501223_000068 | Ga0501223_000068_3206_3565 | 102 |
| 47 | 3300049705 | Ga0501225_0032185 | Ga0501225_0032185_210_569 | 102 |
| 48 | 3300005347 | Ga0070668_102066056 | Ga0070668_1020660562 | 103 |
| 49 | 3300005563 | Ga0068855_100008205 | Ga0068855_1000082051 | 103 |
| 50 | 3300005578 | Ga0068854_100001318 | Ga0068854_10000131817 | 103 |
| 51 | 3300006846 | Ga0075430_101037875 | Ga0075430_1010378751 | 103 |
| 52 | 3300009551 | Ga0105238_10196334 | Ga0105238_101963342 | 103 |
| 53 | 3300014969 | Ga0157376_11920924 | Ga0157376_119209242 | 103 |
| 54 | 3300017792 | Ga0163161_10839692 | Ga0163161_108396922 | 103 |
| 55 | 3300025923 | Ga0207681_11154288 | Ga0207681_111542882 | 103 |
| 56 | 3300025924 | Ga0207694_10175151 | Ga0207694_101751512 | 103 |
| 57 | 3300025949 | Ga0207667_10000007 | Ga0207667_10000007521 | 103 |
| 58 | 3300031456 | Ga0307513_10056040 | Ga0307513_100560402 | 103 |
| 59 | 3300041443 | Ga0451789_0191616 | Ga0451789_0191616_262_585 | 103 |
| 60 | 3300041463 | Ga0451804_1081906 | Ga0451804_1081906_20_343 | 103 |
| 61 | 3300003771 | Ga0055526_1008606 | Ga0055526_10086063 | 104 |
| 62 | 3300003773 | Ga0055537_1003695 | Ga0055537_10036954 | 104 |
| 63 | 3300003781 | Ga0055536_1009513 | Ga0055536_10095132 | 104 |
| 64 | 3300003791 | Ga0055530_10017873 | Ga0055530_100178733 | 104 |
| 65 | 3300003792 | Ga0055540_1001397 | Ga0055540_10013979 | 104 |
| 66 | 3300005262 | Ga0065165_1070188 | Ga0065165_10701881 | 104 |
| 67 | 3300005518 | Ga0070699_101796619 | Ga0070699_1017966191 | 104 |
| 68 | 3300010375 | Ga0105239_10528868 | Ga0105239_105288682 | 104 |
| 69 | 3300025263 | Ga0209565_1000251 | Ga0209565_10002512 | 104 |
| 70 | 3300025273 | Ga0209673_1038797 | Ga0209673_10387972 | 104 |
| 71 | 3300025292 | Ga0209676_1007848 | Ga0209676_10078483 | 104 |
| 72 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001599 | 104 |
| 73 | 3300025298 | Ga0209050_1000213 | Ga0209050_100021332 | 104 |
| 74 | 3300025303 | Ga0209051_1000360 | Ga0209051_100036025 | 104 |
| 75 | 3300025304 | Ga0209257_1017280 | Ga0209257_10172803 | 104 |
| 76 | 3300025920 | Ga0207649_10072319 | Ga0207649_100723192 | 104 |
| 77 | 3300031911 | Ga0307412_10080016 | Ga0307412_100800162 | 104 |
| 78 | 3300031911 | Ga0307412_10219688 | Ga0307412_102196882 | 104 |
| 79 | 3300046616 | Ga0495668_0013888 | Ga0495668_0013888_3674_4030 | 104 |
| 80 | 3300048920 | Ga0496117_0117256 | Ga0496117_0117256_950_1321 | 104 |
| 81 | 3300048921 | Ga0496118_0342565 | Ga0496118_0342565_150_521 | 104 |
| 82 | 3300048925 | Ga0496122_0334226 | Ga0496122_0334226_222_593 | 104 |
| 83 | 3300048926 | Ga0496123_0138332 | Ga0496123_0138332_106_477 | 104 |
| 84 | 3300053156 | Ga0500622_0081920 | Ga0500622_0081920_646_981 | 104 |
| 85 | 3300055283 | Ga0500661_000242 | Ga0500661_000242_8796_9152 | 104 |
| 86 | iso_pu_bacteria | 2919709256 | 2919710735 | 104 |
| 87 | 3300031548 | Ga0307408_100291702 | Ga0307408_1002917022 | 105 |
| 88 | 3300031731 | Ga0307405_10019245 | Ga0307405_100192451 | 105 |
| 89 | 3300031901 | Ga0307406_10143174 | Ga0307406_101431742 | 105 |
| 90 | 3300031911 | Ga0307412_10008992 | Ga0307412_100089921 | 105 |
| 91 | 3300032002 | Ga0307416_100014503 | Ga0307416_1000145035 | 105 |
| 92 | 3300032004 | Ga0307414_10093964 | Ga0307414_100939642 | 105 |
| 93 | 3300032005 | Ga0307411_10194422 | Ga0307411_101944222 | 105 |
| 94 | 3300046660 | Ga0495625_0000031 | Ga0495625_0000031_27867_28226 | 105 |
| 95 | 3300046660 | Ga0495625_0272424 | Ga0495625_0272424_119_457 | 105 |
| 96 | 3300048925 | Ga0496122_0000176 | Ga0496122_0000176_44303_44641 | 105 |
| 97 | 3300048926 | Ga0496123_0000220 | Ga0496123_0000220_12823_13161 | 105 |
| 98 | 3300048929 | Ga0496126_0132521 | Ga0496126_0132521_111_449 | 105 |
| 99 | 3300053088 | Ga0500644_0042264 | Ga0500644_0042264_659_997 | 105 |
| 100 | 3300053091 | Ga0500647_0085607 | Ga0500647_0085607_537_884 | 105 |
| 101 | 3300053136 | Ga0500559_0035224 | Ga0500559_0035224_11_349 | 105 |
| 102 | 3300053138 | Ga0500564_235322 | Ga0500564_235322_85_432 | 105 |
| 103 | iso_pu_bacteria | 2775507255 | 2778126222 | 105 |
| 104 | 3300002074 | JGI24748J21848_1000023 | JGI24748J21848_100002378 | 106 |
| 105 | 3300002076 | JGI24749J21850_1000156 | JGI24749J21850_10001566 | 106 |
| 106 | 3300002239 | JGI24034J26672_10000010 | JGI24034J26672_1000001030 | 106 |
| 107 | 3300002244 | JGI24742J22300_10017402 | JGI24742J22300_100174022 | 106 |
| 108 | 3300002459 | JGI24751J29686_10049336 | JGI24751J29686_100493362 | 106 |
| 109 | 3300005328 | Ga0070676_10679270 | Ga0070676_106792701 | 106 |
| 110 | 3300005329 | Ga0070683_101059577 | Ga0070683_1010595772 | 106 |
| 111 | 3300005331 | Ga0070670_100303741 | Ga0070670_1003037412 | 106 |
| 112 | 3300005331 | Ga0070670_100346298 | Ga0070670_1003462982 | 106 |
| 113 | 3300005335 | Ga0070666_10019177 | Ga0070666_100191772 | 106 |
| 114 | 3300005339 | Ga0070660_100992365 | Ga0070660_1009923651 | 106 |
| 115 | 3300005347 | Ga0070668_100000119 | Ga0070668_1000001193 | 106 |
| 116 | 3300005353 | Ga0070669_100014398 | Ga0070669_1000143982 | 106 |
| 117 | 3300005355 | Ga0070671_101509784 | Ga0070671_1015097842 | 106 |
| 118 | 3300005367 | Ga0070667_100000357 | Ga0070667_10000035764 | 106 |
| 119 | 3300005455 | Ga0070663_100958709 | Ga0070663_1009587092 | 106 |
| 120 | 3300005456 | Ga0070678_101117160 | Ga0070678_1011171602 | 106 |
| 121 | 3300005466 | Ga0070685_11253676 | Ga0070685_112536761 | 106 |
| 122 | 3300005468 | Ga0070707_100778539 | Ga0070707_1007785392 | 106 |
| 123 | 3300005535 | Ga0070684_101665788 | Ga0070684_1016657881 | 106 |
| 124 | 3300005544 | Ga0070686_100002456 | Ga0070686_1000024569 | 106 |
| 125 | 3300005547 | Ga0070693_100187501 | Ga0070693_1001875012 | 106 |
| 126 | 3300005564 | Ga0070664_100179635 | Ga0070664_1001796352 | 106 |
| 127 | 3300005577 | Ga0068857_101325583 | Ga0068857_1013255832 | 106 |
| 128 | 3300005578 | Ga0068854_100545696 | Ga0068854_1005456961 | 106 |
| 129 | 3300005614 | Ga0068856_100910960 | Ga0068856_1009109602 | 106 |
| 130 | 3300005616 | Ga0068852_101152868 | Ga0068852_1011528682 | 106 |
| 131 | 3300005616 | Ga0068852_101346391 | Ga0068852_1013463912 | 106 |
| 132 | 3300005719 | Ga0068861_100323665 | Ga0068861_1003236651 | 106 |
| 133 | 3300005841 | Ga0068863_100000166 | Ga0068863_10000016663 | 106 |
| 134 | 3300005841 | Ga0068863_100005052 | Ga0068863_1000050523 | 106 |
| 135 | 3300005841 | Ga0068863_100349892 | Ga0068863_1003498922 | 106 |
| 136 | 3300005843 | Ga0068860_100101000 | Ga0068860_1001010003 | 106 |
| 137 | 3300005844 | Ga0068862_100007236 | Ga0068862_1000072364 | 106 |
| 138 | 3300005844 | Ga0068862_101095716 | Ga0068862_1010957161 | 106 |
| 139 | 3300005937 | Ga0081455_10000049 | Ga0081455_1000004952 | 106 |
| 140 | 3300006358 | Ga0068871_100722740 | Ga0068871_1007227402 | 106 |
| 141 | 3300009092 | Ga0105250_10027805 | Ga0105250_100278052 | 106 |
| 142 | 3300009098 | Ga0105245_10510539 | Ga0105245_105105392 | 106 |
| 143 | 3300009101 | Ga0105247_10054793 | Ga0105247_100547932 | 106 |
| 144 | 3300009101 | Ga0105247_11513283 | Ga0105247_115132831 | 106 |
| 145 | 3300009148 | Ga0105243_10981560 | Ga0105243_109815602 | 106 |
| 146 | 3300009174 | Ga0105241_10739271 | Ga0105241_107392712 | 106 |
| 147 | 3300009177 | Ga0105248_10932467 | Ga0105248_109324672 | 106 |
| 148 | 3300011119 | Ga0105246_10899178 | Ga0105246_108991782 | 106 |
| 149 | 3300013104 | Ga0157370_11894846 | Ga0157370_118948462 | 106 |
| 150 | 3300013297 | Ga0157378_10257574 | Ga0157378_102575742 | 106 |
| 151 | 3300013306 | Ga0163162_10090807 | Ga0163162_100908072 | 106 |
| 152 | 3300013308 | Ga0157375_11111792 | Ga0157375_111117922 | 106 |
| 153 | 3300014325 | Ga0163163_10742123 | Ga0163163_107421232 | 106 |
| 154 | 3300014326 | Ga0157380_10001483 | Ga0157380_1000148317 | 106 |
| 155 | 3300014968 | Ga0157379_11289623 | Ga0157379_112896231 | 106 |
| 156 | 3300020070 | Ga0206356_10597583 | Ga0206356_105975832 | 106 |
| 157 | 3300025223 | Ga0207672_1000207 | Ga0207672_10002072 | 106 |
| 158 | 3300025903 | Ga0207680_10012515 | Ga0207680_100125152 | 106 |
| 159 | 3300025920 | Ga0207649_10349233 | Ga0207649_103492332 | 106 |
| 160 | 3300025920 | Ga0207649_11497616 | Ga0207649_114976161 | 106 |
| 161 | 3300025922 | Ga0207646_10829703 | Ga0207646_108297032 | 106 |
| 162 | 3300025923 | Ga0207681_10010518 | Ga0207681_100105185 | 106 |
| 163 | 3300025925 | Ga0207650_10264172 | Ga0207650_102641722 | 106 |
| 164 | 3300025927 | Ga0207687_10107527 | Ga0207687_101075272 | 106 |
| 165 | 3300025931 | Ga0207644_11806421 | Ga0207644_118064212 | 106 |
| 166 | 3300025933 | Ga0207706_11143824 | Ga0207706_111438242 | 106 |
| 167 | 3300025937 | Ga0207669_10875886 | Ga0207669_108758862 | 106 |
| 168 | 3300025940 | Ga0207691_10146371 | Ga0207691_101463712 | 106 |
| 169 | 3300025942 | Ga0207689_10111078 | Ga0207689_101110782 | 106 |
| 170 | 3300025944 | Ga0207661_10107178 | Ga0207661_101071782 | 106 |
| 171 | 3300025960 | Ga0207651_11265471 | Ga0207651_112654711 | 106 |
| 172 | 3300025972 | Ga0207668_10000142 | Ga0207668_1000014252 | 106 |
| 173 | 3300025981 | Ga0207640_11609093 | Ga0207640_116090931 | 106 |
| 174 | 3300025986 | Ga0207658_10000309 | Ga0207658_1000030954 | 106 |
| 175 | 3300026035 | Ga0207703_10873846 | Ga0207703_108738462 | 106 |
| 176 | 3300026041 | Ga0207639_10477193 | Ga0207639_104771932 | 106 |
| 177 | 3300026078 | Ga0207702_11961022 | Ga0207702_119610222 | 106 |
| 178 | 3300026088 | Ga0207641_10000239 | Ga0207641_1000023953 | 106 |
| 179 | 3300026088 | Ga0207641_10000263 | Ga0207641_1000026340 | 106 |
| 180 | 3300026088 | Ga0207641_10036160 | Ga0207641_100361602 | 106 |
| 181 | 3300026118 | Ga0207675_100000131 | Ga0207675_10000013138 | 106 |
| 182 | 3300026142 | Ga0207698_10344540 | Ga0207698_103445402 | 106 |
| 183 | 3300026142 | Ga0207698_11318135 | Ga0207698_113181352 | 106 |
| 184 | 3300026142 | Ga0207698_11694738 | Ga0207698_116947382 | 106 |
| 185 | 3300026142 | Ga0207698_11860258 | Ga0207698_118602582 | 106 |
| 186 | 3300028380 | Ga0268265_10000347 | Ga0268265_100003475 | 106 |
| 187 | 3300028380 | Ga0268265_11064554 | Ga0268265_110645541 | 106 |
| 188 | 3300028381 | Ga0268264_10081868 | Ga0268264_100818681 | 106 |
| 189 | 3300039437 | Ga0436365_0623759 | Ga0436365_0623759_328_675 | 106 |
| 190 | 3300039450 | Ga0436363_0878797 | Ga0436363_0878797_337_684 | 106 |
| 191 | 3300046471 | Ga0495650_0000861 | Ga0495650_0000861_25679_26035 | 106 |
| 192 | 3300046525 | Ga0495663_0095737 | Ga0495663_0095737_166_522 | 106 |
| 193 | 3300046528 | Ga0495642_0129605 | Ga0495642_0129605_561_908 | 106 |
| 194 | 3300046530 | Ga0495654_0001078 | Ga0495654_0001078_17177_17533 | 106 |
| 195 | 3300046542 | Ga0495597_0043979 | Ga0495597_0043979_104_457 | 106 |
| 196 | 3300046557 | Ga0495622_0026294 | Ga0495622_0026294_1512_1865 | 106 |
| 197 | 3300046616 | Ga0495668_0003028 | Ga0495668_0003028_406_762 | 106 |
| 198 | 3300046660 | Ga0495625_0049982 | Ga0495625_0049982_944_1297 | 106 |
| 199 | 3300046692 | Ga0495671_0001468 | Ga0495671_0001468_9641_9994 | 106 |
| 200 | 3300046794 | Ga0495589_0007669 | Ga0495589_0007669_1510_1866 | 106 |
| 201 | 3300048904 | Ga0496101_0752839 | Ga0496101_0752839_334_687 | 106 |
| 202 | 3300048906 | Ga0496103_0004526 | Ga0496103_0004526_6042_6395 | 106 |
| 203 | 3300048907 | Ga0496104_0115782 | Ga0496104_0115782_1331_1684 | 106 |
| 204 | 3300048908 | Ga0496105_0045019 | Ga0496105_0045019_2722_3075 | 106 |
| 205 | 3300048909 | Ga0496106_0210081 | Ga0496106_0210081_452_805 | 106 |
| 206 | 3300048911 | Ga0496108_0462648 | Ga0496108_0462648_694_1047 | 106 |
| 207 | 3300048920 | Ga0496117_0024874 | Ga0496117_0024874_2649_3002 | 106 |
| 208 | 3300048921 | Ga0496118_0044754 | Ga0496118_0044754_3059_3412 | 106 |
| 209 | 3300048922 | Ga0496119_0167459 | Ga0496119_0167459_91_444 | 106 |
| 210 | 3300048924 | Ga0496121_0191252 | Ga0496121_0191252_634_987 | 106 |
| 211 | 3300053118 | Ga0500594_0009535 | Ga0500594_0009535_1806_2159 | 106 |
| 212 | 3300053151 | Ga0500604_0322580 | Ga0500604_0322580_159_515 | 106 |
| 213 | 3300053158 | Ga0500627_0023169 | Ga0500627_0023169_1158_1514 | 106 |
| 214 | 3300005327 | Ga0070658_10000050 | Ga0070658_1000005015 | 107 |
| 215 | 3300005457 | Ga0070662_100160946 | Ga0070662_1001609462 | 107 |
| 216 | 3300006353 | Ga0075370_10704382 | Ga0075370_107043821 | 107 |
| 217 | 3300025909 | Ga0207705_10000014 | Ga0207705_10000014387 | 107 |
| 218 | 3300025933 | Ga0207706_10027462 | Ga0207706_100274623 | 107 |
| 219 | 3300041406 | Ga0439439_0062767 | Ga0439439_0062767_553_903 | 107 |
| 220 | 3300041413 | Ga0439465_0235968 | Ga0439465_0235968_58_408 | 107 |
| 221 | 3300041997 | Ga0439431_0074304 | Ga0439431_0074304_184_534 | 107 |
| 222 | 3300042002 | Ga0439442_011840 | Ga0439442_011840_376_726 | 107 |
| 223 | 3300042004 | Ga0439445_0010152 | Ga0439445_0010152_52_402 | 107 |
| 224 | 3300042014 | Ga0439457_015805 | Ga0439457_015805_1036_1386 | 107 |
| 225 | 3300042184 | Ga0450908_037927 | Ga0450908_037927_374_724 | 107 |
| 226 | 3300042435 | Ga0439434_0007685 | Ga0439434_0007685_1075_1425 | 107 |
| 227 | 3300046513 | Ga0495616_0000013 | Ga0495616_0000013_182648_183007 | 107 |
| 228 | 3300046616 | Ga0495668_0010516 | Ga0495668_0010516_3993_4352 | 107 |
| 229 | 3300046616 | Ga0495668_0772829 | Ga0495668_0772829_15_365 | 107 |
| 230 | 3300046648 | Ga0495611_0365635 | Ga0495611_0365635_192_548 | 107 |
| 231 | 3300046691 | Ga0495670_0194420 | Ga0495670_0194420_376_732 | 107 |
| 232 | 3300047472 | Ga0495686_0206804 | Ga0495686_0206804_595_948 | 107 |
| 233 | 3300053087 | Ga0500643_000198 | Ga0500643_000198_200_556 | 107 |
| 234 | 3300053134 | Ga0500658_0000712 | Ga0500658_0000712_12899_13249 | 107 |
| 235 | 3300053136 | Ga0500559_0001109 | Ga0500559_0001109_8729_9085 | 107 |
| 236 | 3300053139 | Ga0500568_0020938 | Ga0500568_0020938_1735_2085 | 107 |
| 237 | 3300053151 | Ga0500604_0001692 | Ga0500604_0001692_2011_2370 | 107 |
| 238 | 3300053151 | Ga0500604_0331370 | Ga0500604_0331370_50_400 | 107 |
| 239 | 3300053158 | Ga0500627_0003617 | Ga0500627_0003617_3182_3541 | 107 |
| 240 | 3300005844 | Ga0068862_101455734 | Ga0068862_1014557342 | 108 |
| 241 | 3300006946 | Ga0079104_1019212 | Ga0079104_10192122 | 108 |
| 242 | 3300025315 | Ga0207697_10278433 | Ga0207697_102784332 | 108 |
| 243 | 3300027111 | Ga0209281_1013547 | Ga0209281_10135472 | 108 |
| 244 | 3300046524 | Ga0495648_0011410 | Ga0495648_0011410_4590_4937 | 108 |
| 245 | 3300046660 | Ga0495625_0835857 | Ga0495625_0835857_37_390 | 108 |
| 246 | 3300053090 | Ga0500646_0051018 | Ga0500646_0051018_492_845 | 108 |
| 247 | 3300053139 | Ga0500568_0005082 | Ga0500568_0005082_1003_1356 | 108 |
| 248 | 3300053151 | Ga0500604_0000209 | Ga0500604_0000209_11523_11876 | 108 |
| 249 | 3300053153 | Ga0500616_0002626 | Ga0500616_0002626_8697_9050 | 108 |
| 250 | 3300053730 | Ga0500645_009030 | Ga0500645_009030_2057_2386 | 108 |
| 251 | 3300005347 | Ga0070668_100002467 | Ga0070668_10000246711 | 109 |
| 252 | 3300005353 | Ga0070669_100131635 | Ga0070669_1001316352 | 109 |
| 253 | 3300005844 | Ga0068862_100018449 | Ga0068862_1000184494 | 109 |
| 254 | 3300009551 | Ga0105238_10019274 | Ga0105238_100192745 | 109 |
| 255 | 3300009978 | Ga0105148_102161 | Ga0105148_1021612 | 109 |
| 256 | 3300010375 | Ga0105239_10575524 | Ga0105239_105755242 | 109 |
| 257 | 3300025923 | Ga0207681_10256885 | Ga0207681_102568852 | 109 |
| 258 | 3300025924 | Ga0207694_10129540 | Ga0207694_101295402 | 109 |
| 259 | 3300025941 | Ga0207711_10154354 | Ga0207711_101543542 | 109 |
| 260 | 3300025972 | Ga0207668_10446666 | Ga0207668_104466662 | 109 |
| 261 | 3300031903 | Ga0307407_10078246 | Ga0307407_100782462 | 109 |
| 262 | 3300046460 | Ga0495638_0274181 | Ga0495638_0274181_557_904 | 109 |
| 263 | 3300046660 | Ga0495625_0095060 | Ga0495625_0095060_996_1334 | 109 |
| 264 | 3300046694 | Ga0495649_0067080 | Ga0495649_0067080_1239_1577 | 109 |
| 265 | 3300048920 | Ga0496117_0005707 | Ga0496117_0005707_8483_8851 | 109 |
| 266 | 3300048921 | Ga0496118_0000873 | Ga0496118_0000873_31300_31668 | 109 |
| 267 | 3300048927 | Ga0496124_0088150 | Ga0496124_0088150_1345_1713 | 109 |
| 268 | iso_pu_bacteria | 8057101203 | 8057105253 | 109 |
| 269 | 3300005262 | Ga0065165_1021463 | Ga0065165_10214632 | 110 |
| 270 | 3300005983 | Ga0081540_1058834 | Ga0081540_10588342 | 110 |
| 271 | 3300025295 | Ga0209564_1002600 | Ga0209564_100260015 | 110 |
| 272 | 3300053085 | Ga0495619_0385739 | Ga0495619_0385739_38_412 | 110 |
| 273 | iso_pu_bacteria | 2990265787 | 2990268958 | 110 |
| 274 | iso_pu_bacteria | 2993693658 | 2993697230 | 110 |
| 275 | 3300021388 | Ga0213875_10293205 | Ga0213875_102932051 | 111 |
| 276 | 3300053140 | Ga0500573_0000010 | Ga0500573_0000010_157044_157403 | 111 |
| 277 | iso_pu_bacteria | 2830075706 | 2830075917 | 111 |
| 278 | 3300039450 | Ga0436363_0066076 | Ga0436363_0066076_2035_2385 | 112 |
| 279 | 3300041456 | Ga0451795_1493436 | Ga0451795_1493436_58_417 | 112 |
| 280 | 3300046460 | Ga0495638_0000253 | Ga0495638_0000253_27324_27683 | 112 |
| 281 | 3300046522 | Ga0495643_0059810 | Ga0495643_0059810_708_1067 | 112 |
| 282 | 3300046525 | Ga0495663_0005078 | Ga0495663_0005078_1008_1367 | 112 |
| 283 | 3300046616 | Ga0495668_0543449 | Ga0495668_0543449_158_514 | 112 |
| 284 | 3300046660 | Ga0495625_0110302 | Ga0495625_0110302_1252_1611 | 112 |
| 285 | 3300046691 | Ga0495670_0002841 | Ga0495670_0002841_1687_2049 | 112 |
| 286 | 3300053093 | Ga0500651_0469138 | Ga0500651_0469138_216_590 | 112 |
| 287 | 3300053136 | Ga0500559_0044255 | Ga0500559_0044255_379_738 | 112 |
| 288 | iso_pu_bacteria | 2643221622 | 2644127309 | 112 |
| 289 | 3300005842 | Ga0068858_100000288 | Ga0068858_10000028826 | 113 |
| 290 | 3300009177 | Ga0105248_11957901 | Ga0105248_119579011 | 113 |
| 291 | 3300013102 | Ga0157371_10091026 | Ga0157371_100910262 | 113 |
| 292 | 3300013104 | Ga0157370_10892119 | Ga0157370_108921192 | 113 |
| 293 | 3300013306 | Ga0163162_11362536 | Ga0163162_113625362 | 113 |
| 294 | 3300014325 | Ga0163163_10675384 | Ga0163163_106753842 | 113 |
| 295 | 3300014497 | Ga0182008_10296491 | Ga0182008_102964912 | 113 |
| 296 | 3300025941 | Ga0207711_10006235 | Ga0207711_100062356 | 113 |
| 297 | 3300025941 | Ga0207711_10947418 | Ga0207711_109474181 | 113 |
| 298 | 3300026035 | Ga0207703_10000499 | Ga0207703_1000049933 | 113 |
| 299 | 3300035118 | Ga0373954_0136606 | Ga0373954_0136606_173_535 | 113 |
| 300 | 3300046665 | Ga0495661_0593238 | Ga0495661_0593238_120_482 | 113 |
| 301 | 3300053090 | Ga0500646_0013617 | Ga0500646_0013617_837_1196 | 113 |
| 302 | 3300053108 | Ga0500562_135535 | Ga0500562_135535_301_660 | 113 |
| 303 | 3300053119 | Ga0500595_000561 | Ga0500595_000561_5081_5440 | 113 |
| 304 | 3300053140 | Ga0500573_0056822 | Ga0500573_0056822_913_1269 | 113 |
| 305 | iso_pu_bacteria | 2885429604 | 2885432072 | 113 |
| 306 | 3300001915 | JGI24741J21665_1002900 | JGI24741J21665_10029005 | 114 |
| 307 | 3300001979 | JGI24740J21852_10009356 | JGI24740J21852_100093561 | 114 |
| 308 | 3300001979 | JGI24740J21852_10023649 | JGI24740J21852_100236491 | 114 |
| 309 | 3300001989 | JGI24739J22299_10006986 | JGI24739J22299_100069864 | 114 |
| 310 | 3300001990 | JGI24737J22298_10031352 | JGI24737J22298_100313522 | 114 |
| 311 | 3300002075 | JGI24738J21930_10044854 | JGI24738J21930_100448542 | 114 |
| 312 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_1000000710 | 114 |
| 313 | 3300003322 | rootL2_10291844 | rootL2_102918442 | 114 |
| 314 | 3300003762 | Ga0055542_1000353 | Ga0055542_10003535 | 114 |
| 315 | 3300003763 | Ga0055529_1000377 | Ga0055529_10003775 | 114 |
| 316 | 3300005327 | Ga0070658_10104586 | Ga0070658_101045862 | 114 |
| 317 | 3300005338 | Ga0068868_100627143 | Ga0068868_1006271431 | 114 |
| 318 | 3300005344 | Ga0070661_100013732 | Ga0070661_1000137322 | 114 |
| 319 | 3300005347 | Ga0070668_100524958 | Ga0070668_1005249582 | 114 |
| 320 | 3300005354 | Ga0070675_100106452 | Ga0070675_1001064522 | 114 |
| 321 | 3300005355 | Ga0070671_100292373 | Ga0070671_1002923732 | 114 |
| 322 | 3300005364 | Ga0070673_100568277 | Ga0070673_1005682772 | 114 |
| 323 | 3300005366 | Ga0070659_100049994 | Ga0070659_1000499942 | 114 |
| 324 | 3300005366 | Ga0070659_100632487 | Ga0070659_1006324872 | 114 |
| 325 | 3300005367 | Ga0070667_100113685 | Ga0070667_1001136852 | 114 |
| 326 | 3300005455 | Ga0070663_101557172 | Ga0070663_1015571721 | 114 |
| 327 | 3300005456 | Ga0070678_100063976 | Ga0070678_1000639762 | 114 |
| 328 | 3300005457 | Ga0070662_100171954 | Ga0070662_1001719542 | 114 |
| 329 | 3300005459 | Ga0068867_100190815 | Ga0068867_1001908152 | 114 |
| 330 | 3300005535 | Ga0070684_100501475 | Ga0070684_1005014752 | 114 |
| 331 | 3300005539 | Ga0068853_100156433 | Ga0068853_1001564332 | 114 |
| 332 | 3300005543 | Ga0070672_100271546 | Ga0070672_1002715462 | 114 |
| 333 | 3300005563 | Ga0068855_100563177 | Ga0068855_1005631772 | 114 |
| 334 | 3300005564 | Ga0070664_100127861 | Ga0070664_1001278612 | 114 |
| 335 | 3300005577 | Ga0068857_101358641 | Ga0068857_1013586412 | 114 |
| 336 | 3300005614 | Ga0068856_100192320 | Ga0068856_1001923201 | 114 |
| 337 | 3300005614 | Ga0068856_100362316 | Ga0068856_1003623162 | 114 |
| 338 | 3300005614 | Ga0068856_100373216 | Ga0068856_1003732161 | 114 |
| 339 | 3300005616 | Ga0068852_100154994 | Ga0068852_1001549941 | 114 |
| 340 | 3300006177 | Ga0075362_10230975 | Ga0075362_102309752 | 114 |
| 341 | 3300006237 | Ga0097621_100186209 | Ga0097621_1001862092 | 114 |
| 342 | 3300006353 | Ga0075370_10685878 | Ga0075370_106858782 | 114 |
| 343 | 3300006358 | Ga0068871_101111933 | Ga0068871_1011119332 | 114 |
| 344 | 3300006881 | Ga0068865_100465775 | Ga0068865_1004657751 | 114 |
| 345 | 3300009093 | Ga0105240_10493651 | Ga0105240_104936512 | 114 |
| 346 | 3300009148 | Ga0105243_10000077 | Ga0105243_1000007730 | 114 |
| 347 | 3300009174 | Ga0105241_10031269 | Ga0105241_100312694 | 114 |
| 348 | 3300009176 | Ga0105242_13041820 | Ga0105242_130418202 | 114 |
| 349 | 3300009177 | Ga0105248_10020187 | Ga0105248_1002018711 | 114 |
| 350 | 3300009545 | Ga0105237_10176343 | Ga0105237_101763432 | 114 |
| 351 | 3300009545 | Ga0105237_10537488 | Ga0105237_105374881 | 114 |
| 352 | 3300009551 | Ga0105238_10167642 | Ga0105238_101676422 | 114 |
| 353 | 3300010375 | Ga0105239_10265704 | Ga0105239_102657042 | 114 |
| 354 | 3300010375 | Ga0105239_13047003 | Ga0105239_130470032 | 114 |
| 355 | 3300012475 | Ga0157317_1002649 | Ga0157317_10026492 | 114 |
| 356 | 3300012500 | Ga0157314_1010565 | Ga0157314_10105652 | 114 |
| 357 | 3300012503 | Ga0157313_1002072 | Ga0157313_10020722 | 114 |
| 358 | 3300013100 | Ga0157373_10076123 | Ga0157373_100761231 | 114 |
| 359 | 3300013100 | Ga0157373_10093852 | Ga0157373_100938521 | 114 |
| 360 | 3300013100 | Ga0157373_11391634 | Ga0157373_113916341 | 114 |
| 361 | 3300013102 | Ga0157371_10000376 | Ga0157371_1000037618 | 114 |
| 362 | 3300013104 | Ga0157370_10304804 | Ga0157370_103048042 | 114 |
| 363 | 3300013105 | Ga0157369_10313250 | Ga0157369_103132502 | 114 |
| 364 | 3300013105 | Ga0157369_10313251 | Ga0157369_103132512 | 114 |
| 365 | 3300013296 | Ga0157374_10386651 | Ga0157374_103866512 | 114 |
| 366 | 3300014969 | Ga0157376_10892582 | Ga0157376_108925821 | 114 |
| 367 | 3300015689 | Ga0183360_11696 | Ga0183360_116962 | 114 |
| 368 | 3300015690 | Ga0183363_1007 | Ga0183363_1007261 | 114 |
| 369 | 3300025226 | Ga0209674_108501 | Ga0209674_1085011 | 114 |
| 370 | 3300025250 | Ga0209026_1011925 | Ga0209026_10119252 | 114 |
| 371 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008107 | 114 |
| 372 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021318 | 114 |
| 373 | 3300025297 | Ga0209758_1000017 | Ga0209758_100001710 | 114 |
| 374 | 3300025321 | Ga0207656_10001313 | Ga0207656_100013137 | 114 |
| 375 | 3300025901 | Ga0207688_10052344 | Ga0207688_100523442 | 114 |
| 376 | 3300025904 | Ga0207647_10012841 | Ga0207647_100128415 | 114 |
| 377 | 3300025909 | Ga0207705_10000175 | Ga0207705_1000017537 | 114 |
| 378 | 3300025911 | Ga0207654_10001453 | Ga0207654_1000145312 | 114 |
| 379 | 3300025913 | Ga0207695_10007837 | Ga0207695_1000783713 | 114 |
| 380 | 3300025913 | Ga0207695_10124923 | Ga0207695_101249233 | 114 |
| 381 | 3300025913 | Ga0207695_10514781 | Ga0207695_105147812 | 114 |
| 382 | 3300025914 | Ga0207671_10012962 | Ga0207671_100129622 | 114 |
| 383 | 3300025919 | Ga0207657_10111605 | Ga0207657_101116052 | 114 |
| 384 | 3300025920 | Ga0207649_10000356 | Ga0207649_1000035639 | 114 |
| 385 | 3300025923 | Ga0207681_10533001 | Ga0207681_105330012 | 114 |
| 386 | 3300025924 | Ga0207694_10032950 | Ga0207694_100329502 | 114 |
| 387 | 3300025925 | Ga0207650_10017523 | Ga0207650_100175234 | 114 |
| 388 | 3300025926 | Ga0207659_10199359 | Ga0207659_101993591 | 114 |
| 389 | 3300025932 | Ga0207690_10000740 | Ga0207690_1000074013 | 114 |
| 390 | 3300025932 | Ga0207690_11782033 | Ga0207690_117820331 | 114 |
| 391 | 3300025933 | Ga0207706_10157746 | Ga0207706_101577462 | 114 |
| 392 | 3300025935 | Ga0207709_10000110 | Ga0207709_1000011097 | 114 |
| 393 | 3300025937 | Ga0207669_10000180 | Ga0207669_1000018032 | 114 |
| 394 | 3300025937 | Ga0207669_10004008 | Ga0207669_100040085 | 114 |
| 395 | 3300025940 | Ga0207691_10237993 | Ga0207691_102379932 | 114 |
| 396 | 3300025945 | Ga0207679_10248378 | Ga0207679_102483782 | 114 |
| 397 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006191 | 114 |
| 398 | 3300025972 | Ga0207668_10167392 | Ga0207668_101673922 | 114 |
| 399 | 3300025986 | Ga0207658_10093098 | Ga0207658_100930982 | 114 |
| 400 | 3300026023 | Ga0207677_10079560 | Ga0207677_100795601 | 114 |
| 401 | 3300026041 | Ga0207639_10006283 | Ga0207639_100062835 | 114 |
| 402 | 3300026067 | Ga0207678_10026444 | Ga0207678_100264445 | 114 |
| 403 | 3300026067 | Ga0207678_11341710 | Ga0207678_113417102 | 114 |
| 404 | 3300026078 | Ga0207702_10009788 | Ga0207702_100097885 | 114 |
| 405 | 3300026078 | Ga0207702_10277187 | Ga0207702_102771872 | 114 |
| 406 | 3300026089 | Ga0207648_10056611 | Ga0207648_100566112 | 114 |
| 407 | 3300026116 | Ga0207674_10095289 | Ga0207674_100952892 | 114 |
| 408 | 3300026121 | Ga0207683_10002356 | Ga0207683_100023566 | 114 |
| 409 | 3300026142 | Ga0207698_10118919 | Ga0207698_101189191 | 114 |
| 410 | 3300028786 | Ga0307517_10010535 | Ga0307517_100105358 | 114 |
| 411 | 3300033180 | Ga0307510_10034976 | Ga0307510_100349763 | 114 |
| 412 | 3300041512 | Ga0451853_0928386 | Ga0451853_0928386_386_754 | 114 |
| 413 | 3300042005 | Ga0439448_0082116 | Ga0439448_0082116_285_653 | 114 |
| 414 | 3300046460 | Ga0495638_0149484 | Ga0495638_0149484_453_821 | 114 |
| 415 | 3300046471 | Ga0495650_0000364 | Ga0495650_0000364_15044_15412 | 114 |
| 416 | 3300046491 | Ga0495584_0031870 | Ga0495584_0031870_622_990 | 114 |
| 417 | 3300046491 | Ga0495584_0032605 | Ga0495584_0032605_529_897 | 114 |
| 418 | 3300046492 | Ga0495585_0059085 | Ga0495585_0059085_95_463 | 114 |
| 419 | 3300046492 | Ga0495585_0087333 | Ga0495585_0087333_431_799 | 114 |
| 420 | 3300046500 | Ga0495596_0011775 | Ga0495596_0011775_854_1222 | 114 |
| 421 | 3300046506 | Ga0495583_0000311 | Ga0495583_0000311_71536_71904 | 114 |
| 422 | 3300046506 | Ga0495583_0009032 | Ga0495583_0009032_3801_4169 | 114 |
| 423 | 3300046507 | Ga0495606_0000071 | Ga0495606_0000071_11696_12064 | 114 |
| 424 | 3300046507 | Ga0495606_0009784 | Ga0495606_0009784_1662_2030 | 114 |
| 425 | 3300046513 | Ga0495616_0109386 | Ga0495616_0109386_37_405 | 114 |
| 426 | 3300046520 | Ga0495637_0013302 | Ga0495637_0013302_3378_3746 | 114 |
| 427 | 3300046522 | Ga0495643_0005960 | Ga0495643_0005960_685_1053 | 114 |
| 428 | 3300046524 | Ga0495648_0004148 | Ga0495648_0004148_1900_2268 | 114 |
| 429 | 3300046525 | Ga0495663_0024185 | Ga0495663_0024185_897_1265 | 114 |
| 430 | 3300046528 | Ga0495642_0002920 | Ga0495642_0002920_4463_4831 | 114 |
| 431 | 3300046530 | Ga0495654_0173140 | Ga0495654_0173140_247_615 | 114 |
| 432 | 3300046538 | Ga0495609_0116761 | Ga0495609_0116761_504_872 | 114 |
| 433 | 3300046557 | Ga0495622_0064688 | Ga0495622_0064688_229_597 | 114 |
| 434 | 3300046558 | Ga0495633_0015197 | Ga0495633_0015197_2276_2644 | 114 |
| 435 | 3300046558 | Ga0495633_0091476 | Ga0495633_0091476_244_612 | 114 |
| 436 | 3300046616 | Ga0495668_0000335 | Ga0495668_0000335_21679_22047 | 114 |
| 437 | 3300046648 | Ga0495611_0011045 | Ga0495611_0011045_2174_2542 | 114 |
| 438 | 3300046660 | Ga0495625_0000212 | Ga0495625_0000212_82100_82468 | 114 |
| 439 | 3300046660 | Ga0495625_0032342 | Ga0495625_0032342_1802_2170 | 114 |
| 440 | 3300046660 | Ga0495625_0104248 | Ga0495625_0104248_158_526 | 114 |
| 441 | 3300046660 | Ga0495625_0121079 | Ga0495625_0121079_459_827 | 114 |
| 442 | 3300046665 | Ga0495661_0378506 | Ga0495661_0378506_100_468 | 114 |
| 443 | 3300046684 | Ga0495669_0000016 | Ga0495669_0000016_22276_22644 | 114 |
| 444 | 3300046689 | Ga0495613_0210665 | Ga0495613_0210665_956_1324 | 114 |
| 445 | 3300046691 | Ga0495670_0166050 | Ga0495670_0166050_423_791 | 114 |
| 446 | 3300046692 | Ga0495671_0646683 | Ga0495671_0646683_25_393 | 114 |
| 447 | 3300046694 | Ga0495649_0045366 | Ga0495649_0045366_240_608 | 114 |
| 448 | 3300046809 | Ga0495600_0341717 | Ga0495600_0341717_486_854 | 114 |
| 449 | 3300046810 | Ga0495660_0100344 | Ga0495660_0100344_287_655 | 114 |
| 450 | 3300047317 | Ga0495604_0968883 | Ga0495604_0968883_83_451 | 114 |
| 451 | 3300047323 | Ga0495683_0015856 | Ga0495683_0015856_2258_2626 | 114 |
| 452 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_136645_137013 | 114 |
| 453 | 3300047443 | Ga0495687_007447 | Ga0495687_007447_2545_2913 | 114 |
| 454 | 3300047445 | Ga0495677_0012258 | Ga0495677_0012258_1540_1908 | 114 |
| 455 | 3300047447 | Ga0495685_082289 | Ga0495685_082289_402_770 | 114 |
| 456 | 3300047469 | Ga0495673_0066082 | Ga0495673_0066082_802_1170 | 114 |
| 457 | 3300047470 | Ga0495681_0011962 | Ga0495681_0011962_4544_4912 | 114 |
| 458 | 3300048904 | Ga0496101_0448668 | Ga0496101_0448668_628_996 | 114 |
| 459 | 3300048905 | Ga0496102_0000218 | Ga0496102_0000218_18859_19227 | 114 |
| 460 | 3300048906 | Ga0496103_0000045 | Ga0496103_0000045_58279_58647 | 114 |
| 461 | 3300048906 | Ga0496103_0952809 | Ga0496103_0952809_145_504 | 114 |
| 462 | 3300048907 | Ga0496104_0061903 | Ga0496104_0061903_2974_3342 | 114 |
| 463 | 3300048908 | Ga0496105_0000559 | Ga0496105_0000559_3590_3958 | 114 |
| 464 | 3300048912 | Ga0496109_0048777 | Ga0496109_0048777_1310_1678 | 114 |
| 465 | 3300048914 | Ga0496111_0004043 | Ga0496111_0004043_2287_2655 | 114 |
| 466 | 3300048915 | Ga0496112_0195922 | Ga0496112_0195922_995_1363 | 114 |
| 467 | 3300048917 | Ga0496114_0015728 | Ga0496114_0015728_2777_3145 | 114 |
| 468 | 3300048918 | Ga0496115_0000136 | Ga0496115_0000136_9477_9845 | 114 |
| 469 | 3300048919 | Ga0496116_0001537 | Ga0496116_0001537_19629_19997 | 114 |
| 470 | 3300048920 | Ga0496117_0000046 | Ga0496117_0000046_217081_217449 | 114 |
| 471 | 3300048921 | Ga0496118_0000036 | Ga0496118_0000036_83431_83799 | 114 |
| 472 | 3300048922 | Ga0496119_0016658 | Ga0496119_0016658_1631_1999 | 114 |
| 473 | 3300048923 | Ga0496120_0012993 | Ga0496120_0012993_395_763 | 114 |
| 474 | 3300048924 | Ga0496121_0000163 | Ga0496121_0000163_31116_31475 | 114 |
| 475 | 3300048924 | Ga0496121_0000267 | Ga0496121_0000267_56683_57051 | 114 |
| 476 | 3300048925 | Ga0496122_0030656 | Ga0496122_0030656_1190_1558 | 114 |
| 477 | 3300048926 | Ga0496123_0008373 | Ga0496123_0008373_3547_3915 | 114 |
| 478 | 3300048927 | Ga0496124_0000011 | Ga0496124_0000011_370316_370684 | 114 |
| 479 | 3300048928 | Ga0496125_0000919 | Ga0496125_0000919_27393_27761 | 114 |
| 480 | 3300048929 | Ga0496126_0000440 | Ga0496126_0000440_25710_26078 | 114 |
| 481 | 3300050493 | nmdc:mga0k408_680189_c1 | nmdc:mga0k408_680189_c1_32_400 | 114 |
| 482 | 3300053079 | Ga0500610_0000177 | Ga0500610_0000177_13923_14291 | 114 |
| 483 | 3300053092 | Ga0500583_0471968 | Ga0500583_0471968_91_459 | 114 |
| 484 | 3300053096 | Ga0500641_0022767 | Ga0500641_0022767_1635_1997 | 114 |
| 485 | 3300053119 | Ga0500595_003380 | Ga0500595_003380_3533_3901 | 114 |
| 486 | 3300053130 | Ga0500642_0000820 | Ga0500642_0000820_7691_8059 | 114 |
| 487 | 3300053134 | Ga0500658_0003978 | Ga0500658_0003978_990_1361 | 114 |
| 488 | 3300053154 | Ga0500619_002987 | Ga0500619_002987_2119_2487 | 114 |
| 489 | 3300053177 | Ga0500636_0005235 | Ga0500636_0005235_3514_3882 | 114 |
| 490 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_238802_239170 | 114 |
| 491 | 3300053731 | Ga0500609_005248 | Ga0500609_005248_522_890 | 114 |
| 492 | 3300053735 | Ga0500596_000564 | Ga0500596_000564_3074_3442 | 114 |
| 493 | 3300055283 | Ga0500661_015226 | Ga0500661_015226_47_415 | 114 |
| 494 | iso_pu_bacteria | 2928027323 | 2928028850 | 114 |
| 495 | iso_pu_bacteria | 2984555340 | 2984556388 | 114 |
| 496 | iso_pu_bacteria | 2984564862 | 2984565423 | 114 |
| 497 | iso_pu_bacteria | 2993356040 | 2993356515 | 114 |
| 498 | 3300005329 | Ga0070683_101048199 | Ga0070683_1010481991 | 115 |
| 499 | 3300025944 | Ga0207661_11576007 | Ga0207661_115760072 | 115 |
| 500 | 3300039437 | Ga0436365_1719205 | Ga0436365_1719205_981_1340 | 115 |
| 501 | 3300042438 | Ga0439459_0198010 | Ga0439459_0198010_45_416 | 115 |
| 502 | 3300048918 | Ga0496115_0000310 | Ga0496115_0000310_24401_24766 | 115 |
| 503 | 3300053104 | Ga0500556_0023742 | Ga0500556_0023742_1601_1963 | 115 |
| 504 | 3300053730 | Ga0500645_004247 | Ga0500645_004247_4400_4762 | 115 |
| 505 | 3300000041 | ARcpr5oldR_c014582 | ARcpr5oldR_0145822 | 116 |
| 506 | 3300000043 | ARcpr5yngRDRAFT_c001077 | ARcpr5yngRDRAFT_0010772 | 116 |
| 507 | 3300000652 | ARCol0yngRDRAFT_1015786 | ARCol0yngRDRAFT_10157862 | 116 |
| 508 | 3300002774 | JGI25150J39212_1000135 | JGI25150J39212_100013522 | 116 |
| 509 | 3300003187 | JGI25151J46595_10063231 | JGI25151J46595_100632312 | 116 |
| 510 | 3300003215 | JGI25153J46596_10000073 | JGI25153J46596_1000007393 | 116 |
| 511 | 3300003215 | JGI25153J46596_10004475 | JGI25153J46596_100044752 | 116 |
| 512 | 3300003773 | Ga0055537_1000896 | Ga0055537_10008963 | 116 |
| 513 | 3300003775 | Ga0055524_1000244 | Ga0055524_100024422 | 116 |
| 514 | 3300003790 | Ga0055528_1034524 | Ga0055528_10345242 | 116 |
| 515 | 3300003791 | Ga0055530_10014066 | Ga0055530_100140662 | 116 |
| 516 | 3300003794 | Ga0055531_10001111 | Ga0055531_100011117 | 116 |
| 517 | 3300004625 | Ga0055543_1007973 | Ga0055543_10079732 | 116 |
| 518 | 3300005262 | Ga0065165_1007527 | Ga0065165_10075273 | 116 |
| 519 | 3300005618 | Ga0068864_100000512 | Ga0068864_10000051238 | 116 |
| 520 | 3300005719 | Ga0068861_100132553 | Ga0068861_1001325532 | 116 |
| 521 | 3300006353 | Ga0075370_10032663 | Ga0075370_100326633 | 116 |
| 522 | 3300009553 | Ga0105249_10664199 | Ga0105249_106641992 | 116 |
| 523 | 3300013306 | Ga0163162_10002879 | Ga0163162_100028792 | 116 |
| 524 | 3300013306 | Ga0163162_10138830 | Ga0163162_101388302 | 116 |
| 525 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005727 | 116 |
| 526 | 3300025245 | Ga0207425_1021754 | Ga0207425_10217542 | 116 |
| 527 | 3300025258 | Ga0209129_1003733 | Ga0209129_10037334 | 116 |
| 528 | 3300025263 | Ga0209565_1000029 | Ga0209565_100002990 | 116 |
| 529 | 3300025273 | Ga0209673_1003715 | Ga0209673_10037154 | 116 |
| 530 | 3300025291 | Ga0209675_1020012 | Ga0209675_10200122 | 116 |
| 531 | 3300025294 | Ga0209025_1000477 | Ga0209025_100047712 | 116 |
| 532 | 3300025295 | Ga0209564_1035825 | Ga0209564_10358252 | 116 |
| 533 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002618 | 116 |
| 534 | 3300025297 | Ga0209758_1008577 | Ga0209758_10085772 | 116 |
| 535 | 3300025298 | Ga0209050_1002327 | Ga0209050_10023272 | 116 |
| 536 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008699 | 116 |
| 537 | 3300025304 | Ga0209257_1002435 | Ga0209257_10024354 | 116 |
| 538 | 3300025304 | Ga0209257_1031355 | Ga0209257_10313552 | 116 |
| 539 | 3300025315 | Ga0207697_10029816 | Ga0207697_100298162 | 116 |
| 540 | 3300026095 | Ga0207676_10000462 | Ga0207676_100004625 | 116 |
| 541 | 3300026118 | Ga0207675_100173025 | Ga0207675_1001730252 | 116 |
| 542 | 3300031456 | Ga0307513_10013397 | Ga0307513_100133975 | 116 |
| 543 | 3300031995 | Ga0307409_100236548 | Ga0307409_1002365481 | 116 |
| 544 | 3300033180 | Ga0307510_10002511 | Ga0307510_1000251119 | 116 |
| 545 | 3300041407 | Ga0439447_171077 | Ga0439447_171077_113_463 | 116 |
| 546 | 3300041410 | Ga0439461_0000016 | Ga0439461_0000016_4700_5050 | 116 |
| 547 | 3300041410 | Ga0439461_0024660 | Ga0439461_0024660_18_368 | 116 |
| 548 | 3300041411 | Ga0439466_0043324 | Ga0439466_0043324_943_1293 | 116 |
| 549 | 3300041413 | Ga0439465_0000383 | Ga0439465_0000383_3423_3773 | 116 |
| 550 | 3300041999 | Ga0439433_0151568 | Ga0439433_0151568_125_475 | 116 |
| 551 | 3300042004 | Ga0439445_0000596 | Ga0439445_0000596_4013_4363 | 116 |
| 552 | 3300042006 | Ga0439432_025619 | Ga0439432_025619_888_1238 | 116 |
| 553 | 3300042007 | Ga0439449_0226626 | Ga0439449_0226626_307_657 | 116 |
| 554 | 3300042010 | Ga0439452_047965 | Ga0439452_047965_239_589 | 116 |
| 555 | 3300042015 | Ga0439462_0011139 | Ga0439462_0011139_1025_1375 | 116 |
| 556 | 3300042127 | Ga0450890_006555 | Ga0450890_006555_46_396 | 116 |
| 557 | 3300042435 | Ga0439434_0000681 | Ga0439434_0000681_6695_7045 | 116 |
| 558 | 3300046453 | Ga0495627_016344 | Ga0495627_016344_748_1098 | 116 |
| 559 | 3300046506 | Ga0495583_0006357 | Ga0495583_0006357_3382_3759 | 116 |
| 560 | 3300046524 | Ga0495648_0011503 | Ga0495648_0011503_3248_3625 | 116 |
| 561 | 3300046616 | Ga0495668_0004587 | Ga0495668_0004587_2739_3116 | 116 |
| 562 | 3300046660 | Ga0495625_0012733 | Ga0495625_0012733_6286_6663 | 116 |
| 563 | 3300046691 | Ga0495670_0234624 | Ga0495670_0234624_510_887 | 116 |
| 564 | 3300046810 | Ga0495660_0404959 | Ga0495660_0404959_100_477 | 116 |
| 565 | 3300047445 | Ga0495677_0002869 | Ga0495677_0002869_1423_1800 | 116 |
| 566 | 3300047470 | Ga0495681_0012432 | Ga0495681_0012432_929_1279 | 116 |
| 567 | 3300048906 | Ga0496103_0286144 | Ga0496103_0286144_258_629 | 116 |
| 568 | 3300048928 | Ga0496125_0244802 | Ga0496125_0244802_611_961 | 116 |
| 569 | 3300049758 | Ga0501241_020003 | Ga0501241_020003_698_1048 | 116 |
| 570 | 3300049760 | Ga0501263_033744 | Ga0501263_033744_113_463 | 116 |
| 571 | 3300053087 | Ga0500643_004388 | Ga0500643_004388_3631_4008 | 116 |
| 572 | 3300053087 | Ga0500643_019936 | Ga0500643_019936_853_1203 | 116 |
| 573 | 3300053094 | Ga0500566_0000390 | Ga0500566_0000390_1236_1586 | 116 |
| 574 | 3300053128 | Ga0500626_070579 | Ga0500626_070579_844_1194 | 116 |
| 575 | 3300053131 | Ga0500652_094110 | Ga0500652_094110_115_492 | 116 |
| 576 | 3300053134 | Ga0500658_0050036 | Ga0500658_0050036_907_1257 | 116 |
| 577 | 3300053136 | Ga0500559_0051515 | Ga0500559_0051515_386_763 | 116 |
| 578 | 3300053136 | Ga0500559_0221315 | Ga0500559_0221315_179_529 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar