F465708

General Info

Members Datasets Scaffolds Average Seq Length
578 341 566 117

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100000512|Ga0068864_10000051238
Length 125
Sequence MSIDGIGGGAMSVDRVMALRAQILERNQALSRAGDNAAVSTPGTIGGTGGTQPASFAQTLSDALNTVNAGQQKAADLSASYERGETIDIAKVMLARQEASVGFEATMQVRNKLLSAYKDIMSMPV

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
4 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
5 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
6 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
7 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
8 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
9 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
10 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
11 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
12 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
13 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
14 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
109 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
110 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
126 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
230 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
303 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
304 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
315 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
316 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
317 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
318 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
338 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.17
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0
Endosphere 17.99
Nodule 0.35
Rhizoplane 3.81
Rhizosphere 68.86
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c014582 3300000041 Bacteria 680
2 ARcpr5yngRDRAFT_c001077 3300000043 Bacteria 3090
3 ARCol0yngRDRAFT_1015786 3300000652 Bacteria 570
4 JGI24741J21665_1002900 3300001915 Bacteria 4293
5 JGI24740J21852_10009356 3300001979 Bacteria 3842
6 JGI24740J21852_10013488 3300001979 Bacteria 3044
7 JGI24740J21852_10023649 3300001979 Bacteria 2095
8 JGI24739J22299_10006986 3300001989 Bacteria 4252
9 JGI24737J22298_10031352 3300001990 Bacteria 1660
10 JGI24748J21848_1000023 3300002074 Bacteria 106523
11 JGI24738J21930_10044854 3300002075 Bacteria 899
12 JGI24749J21850_1000156 3300002076 Bacteria 10935
13 JGI24034J26672_10000010 3300002239 Bacteria 150746
14 JGI24742J22300_10017402 3300002244 Bacteria 1215
15 JGI24751J29686_10049336 3300002459 Bacteria 868
16 JGI25150J39212_1000135 3300002774 Bacteria 41540
17 JGI25151J46595_10063231 3300003187 Bacteria 1165
18 JGI25153J46596_10000007 3300003215 Bacteria 377573
19 JGI25153J46596_10000073 3300003215 Bacteria 115166
20 JGI25153J46596_10004475 3300003215 Bacteria 7533
21 rootL2_10086552 3300003322 Bacteria 1331
22 rootL2_10291844 3300003322 Bacteria 1117
23 Ga0055542_1000353 3300003762 Bacteria 48131
24 Ga0055529_1000377 3300003763 Bacteria 48143
25 Ga0055526_1008606 3300003771 Bacteria 5055
26 Ga0055537_1000896 3300003773 Bacteria 14122
27 Ga0055537_1003695 3300003773 Bacteria 4629
28 Ga0055524_1000244 3300003775 Bacteria 56875
29 Ga0055536_1009513 3300003781 Bacteria 4008
30 Ga0055528_1034524 3300003790 Bacteria 1245
31 Ga0055530_10014066 3300003791 Bacteria 2690
32 Ga0055530_10017873 3300003791 Bacteria 2206
33 Ga0055540_1001397 3300003792 Bacteria 14403
34 Ga0055531_10001111 3300003794 Bacteria 20915
35 Ga0055543_1007973 3300004625 Bacteria 2389
36 Ga0065165_1007527 3300005262 Bacteria 5324
37 Ga0065165_1021463 3300005262 Bacteria 2243
38 Ga0065165_1070188 3300005262 Bacteria 933
39 Ga0070658_10000050 3300005327 Bacteria 119052
40 Ga0070658_10000057 3300005327 Bacteria 113572
41 Ga0070658_10104586 3300005327 Bacteria 2342
42 Ga0070676_10679270 3300005328 Unclassified 750
43 Ga0070683_101048199 3300005329 Bacteria 783
44 Ga0070683_101059577 3300005329 Bacteria 779
45 Ga0070670_100303741 3300005331 Bacteria 1396
46 Ga0070670_100346298 3300005331 Bacteria 1305
47 Ga0070666_10019177 3300005335 Bacteria 4412
48 Ga0068868_100627143 3300005338 Bacteria 955
49 Ga0070660_100002838 3300005339 Bacteria 11930
50 Ga0070660_100992365 3300005339 Bacteria 709
51 Ga0070661_100013732 3300005344 Bacteria 5689
52 Ga0070668_100000119 3300005347 Bacteria 48651
53 Ga0070668_100002467 3300005347 Bacteria 13618
54 Ga0070668_100524958 3300005347 Bacteria 1028
55 Ga0070668_102066056 3300005347 Bacteria 526
56 Ga0070669_100014398 3300005353 Bacteria 5630
57 Ga0070669_100131635 3300005353 Bacteria 1920
58 Ga0070675_100106452 3300005354 Bacteria 2367
59 Ga0070671_100292373 3300005355 Bacteria 1387
60 Ga0070671_101509784 3300005355 Bacteria 595
61 Ga0070673_100568277 3300005364 Bacteria 1032
62 Ga0070659_100049994 3300005366 Bacteria 3288
63 Ga0070659_100632487 3300005366 Bacteria 922
64 Ga0070667_100000357 3300005367 Bacteria 49937
65 Ga0070667_100113685 3300005367 Bacteria 2350
66 Ga0070663_100958709 3300005455 Bacteria 742
67 Ga0070663_101557172 3300005455 Bacteria 589
68 Ga0070678_100063976 3300005456 Bacteria 2724
69 Ga0070678_101117160 3300005456 Bacteria 728
70 Ga0070662_100160946 3300005457 Bacteria 1756
71 Ga0070662_100171954 3300005457 Bacteria 1702
72 Ga0068867_100190815 3300005459 Bacteria 1635
73 Ga0070685_11253676 3300005466 Bacteria 565
74 Ga0070707_100778539 3300005468 Bacteria 920
75 Ga0070698_101008150 3300005471 Bacteria 780
76 Ga0070699_101796619 3300005518 Bacteria 561
77 Ga0070684_100501475 3300005535 Bacteria 1124
78 Ga0070684_101665788 3300005535 Bacteria 602
79 Ga0068853_100156433 3300005539 Bacteria 2054
80 Ga0068853_100489210 3300005539 Bacteria 1160
81 Ga0070672_100271546 3300005543 Bacteria 1432
82 Ga0070686_100002456 3300005544 Bacteria 10217
83 Ga0070693_100187501 3300005547 Bacteria 1336
84 Ga0068855_100008205 3300005563 Bacteria 12626
85 Ga0068855_100357824 3300005563 Bacteria 1607
86 Ga0068855_100563177 3300005563 Bacteria 1232
87 Ga0070664_100127861 3300005564 Bacteria 2230
88 Ga0070664_100179635 3300005564 Bacteria 1880
89 Ga0068857_100646853 3300005577 Bacteria 1002
90 Ga0068857_101325583 3300005577 Bacteria 699
91 Ga0068857_101358641 3300005577 Bacteria 690
92 Ga0068854_100001318 3300005578 Bacteria 14977
93 Ga0068854_100545696 3300005578 Bacteria 982
94 Ga0068856_100192320 3300005614 Bacteria 2054
95 Ga0068856_100362316 3300005614 Bacteria 1468
96 Ga0068856_100373216 3300005614 Bacteria 1445
97 Ga0068856_100910960 3300005614 Bacteria 898
98 Ga0068852_100154994 3300005616 Bacteria 2133
99 Ga0068852_101152868 3300005616 Bacteria 796
100 Ga0068852_101346391 3300005616 Bacteria 736
101 Ga0068859_102105870 3300005617 Bacteria 623
102 Ga0068864_100000512 3300005618 Bacteria 33477
103 Ga0068861_100132553 3300005719 Bacteria 2024
104 Ga0068861_100323665 3300005719 Bacteria 1343
105 Ga0068851_10299820 3300005834 Bacteria 924
106 Ga0068863_100000166 3300005841 Bacteria 71068
107 Ga0068863_100005052 3300005841 Bacteria 13009
108 Ga0068863_100349892 3300005841 Bacteria 1439
109 Ga0068858_100000288 3300005842 Bacteria 54436
110 Ga0068860_100101000 3300005843 Bacteria 2752
111 Ga0068862_100007236 3300005844 Bacteria 9215
112 Ga0068862_100018449 3300005844 Bacteria 5810
113 Ga0068862_101095716 3300005844 Bacteria 791
114 Ga0068862_101455734 3300005844 Bacteria 689
115 Ga0081455_10000049 3300005937 Bacteria 126459
116 Ga0081540_1058834 3300005983 Bacteria 1848
117 Ga0075362_10230975 3300006177 Bacteria 906
118 Ga0097621_100186209 3300006237 Bacteria 1796
119 Ga0075370_10032663 3300006353 Bacteria 2911
120 Ga0075370_10685878 3300006353 Bacteria 622
121 Ga0075370_10704382 3300006353 Bacteria 614
122 Ga0068871_100722740 3300006358 Bacteria 914
123 Ga0068871_101111933 3300006358 Bacteria 739
124 Ga0075430_101037875 3300006846 Bacteria 675
125 Ga0075434_100470951 3300006871 Bacteria 1277
126 Ga0068865_100465775 3300006881 Bacteria 1048
127 Ga0097620_102106191 3300006931 Bacteria 623
128 Ga0079104_1019212 3300006946 Bacteria 1916
129 Ga0105250_10027805 3300009092 Bacteria 2279
130 Ga0105240_10493651 3300009093 Bacteria 1363
131 Ga0105245_10510539 3300009098 Bacteria 1219
132 Ga0105247_10054793 3300009101 Bacteria 2461
133 Ga0105247_11513283 3300009101 Bacteria 548
134 Ga0105243_10000077 3300009148 Bacteria 110432
135 Ga0105243_10981560 3300009148 Bacteria 846
136 Ga0105241_10031269 3300009174 Bacteria 3986
137 Ga0105241_10739271 3300009174 Bacteria 901
138 Ga0105242_13041820 3300009176 Bacteria 519
139 Ga0105248_10020187 3300009177 Bacteria 7382
140 Ga0105248_10932467 3300009177 Bacteria 981
141 Ga0105248_11957901 3300009177 Bacteria 665
142 Ga0105237_10125704 3300009545 Bacteria 2559
143 Ga0105237_10176343 3300009545 Bacteria 2137
144 Ga0105237_10537488 3300009545 Bacteria 1175
145 Ga0105238_10019274 3300009551 Bacteria 6950
146 Ga0105238_10167642 3300009551 Bacteria 2172
147 Ga0105238_10196334 3300009551 Bacteria 1994
148 Ga0105249_10664199 3300009553 Bacteria 1100
149 Ga0105148_102161 3300009978 Bacteria 1383
150 Ga0105239_10265704 3300010375 Bacteria 1929
151 Ga0105239_10474026 3300010375 Bacteria 1422
152 Ga0105239_10528868 3300010375 Bacteria 1342
153 Ga0105239_10575524 3300010375 Bacteria 1283
154 Ga0105239_13047003 3300010375 Bacteria 546
155 Ga0105246_10899178 3300011119 Unclassified 794
156 Ga0157317_1002649 3300012475 Bacteria 1070
157 Ga0157314_1010565 3300012500 Bacteria 800
158 Ga0157313_1002072 3300012503 Bacteria 1161
159 Ga0157373_10076123 3300013100 Bacteria 2368
160 Ga0157373_10093852 3300013100 Bacteria 2113
161 Ga0157373_11391634 3300013100 Bacteria 533
162 Ga0157371_10000376 3300013102 Bacteria 56269
163 Ga0157371_10091026 3300013102 Bacteria 2160
164 Ga0157370_10083238 3300013104 Bacteria 3009
165 Ga0157370_10304804 3300013104 Bacteria 1470
166 Ga0157370_10892119 3300013104 Bacteria 807
167 Ga0157370_11894846 3300013104 Bacteria 535
168 Ga0157369_10215265 3300013105 Bacteria 2012
169 Ga0157369_10313250 3300013105 Bacteria 1632
170 Ga0157369_10313251 3300013105 Bacteria 1632
171 Ga0157374_10386651 3300013296 Bacteria 1394
172 Ga0157378_10257574 3300013297 Bacteria 1673
173 Ga0163162_10002879 3300013306 Bacteria 16380
174 Ga0163162_10090807 3300013306 Bacteria 3136
175 Ga0163162_10138830 3300013306 Bacteria 2542
176 Ga0163162_11362536 3300013306 Bacteria 807
177 Ga0157372_10210567 3300013307 Bacteria 2253
178 Ga0157375_11111792 3300013308 Bacteria 925
179 Ga0157375_12621750 3300013308 Bacteria 602
180 Ga0163163_10675384 3300014325 Bacteria 1096
181 Ga0163163_10742123 3300014325 Bacteria 1045
182 Ga0157380_10001483 3300014326 Bacteria 15349
183 Ga0182008_10296491 3300014497 Bacteria 845
184 Ga0157379_11289623 3300014968 Bacteria 705
185 Ga0157376_10892582 3300014969 Bacteria 907
186 Ga0157376_11920924 3300014969 Bacteria 629
187 Ga0183360_11696 3300015689 Bacteria 789
188 Ga0183363_1007 3300015690 Bacteria 315687
189 Ga0163161_10839692 3300017792 Bacteria 774
190 Ga0206356_10597583 3300020070 Bacteria 2754
191 Ga0213875_10293205 3300021388 Bacteria 769
192 Ga0207672_1000207 3300025223 Bacteria 8253
193 Ga0209674_108501 3300025226 Bacteria 1209
194 Ga0207425_1000005 3300025245 Bacteria 900502
195 Ga0207425_1021754 3300025245 Bacteria 1357
196 Ga0209026_1011925 3300025250 Bacteria 1536
197 Ga0209148_1000008 3300025254 Bacteria 1504371
198 Ga0209129_1003733 3300025258 Bacteria 6443
199 Ga0209565_1000029 3300025263 Bacteria 340335
200 Ga0209565_1000251 3300025263 Bacteria 57054
201 Ga0209455_1000002 3300025272 Bacteria 1505459
202 Ga0209673_1003715 3300025273 Bacteria 8742
203 Ga0209673_1038797 3300025273 Bacteria 1382
204 Ga0209675_1020012 3300025291 Bacteria 1826
205 Ga0209676_1007848 3300025292 Bacteria 4906
206 Ga0209025_1000477 3300025294 Bacteria 77692
207 Ga0209564_1002600 3300025295 Bacteria 13840
208 Ga0209564_1035825 3300025295 Bacteria 1429
209 Ga0209758_1000002 3300025297 Bacteria 1400310
210 Ga0209758_1000017 3300025297 Bacteria 754393
211 Ga0209758_1008577 3300025297 Bacteria 6580
212 Ga0209050_1000001 3300025298 Bacteria 3563507
213 Ga0209050_1000213 3300025298 Bacteria 129359
214 Ga0209050_1002327 3300025298 Bacteria 16704
215 Ga0209256_1000008 3300025299 Bacteria 975723
216 Ga0209051_1000360 3300025303 Bacteria 67080
217 Ga0209257_1002435 3300025304 Bacteria 18508
218 Ga0209257_1017280 3300025304 Bacteria 2853
219 Ga0209257_1031355 3300025304 Bacteria 1701
220 Ga0207697_10029816 3300025315 Bacteria 2233
221 Ga0207697_10278433 3300025315 Bacteria 741
222 Ga0207656_10001313 3300025321 Bacteria 8183
223 Ga0207688_10052344 3300025901 Bacteria 2287
224 Ga0207680_10012515 3300025903 Bacteria 4324
225 Ga0207647_10012841 3300025904 Bacteria 5818
226 Ga0207705_10000014 3300025909 Bacteria 434286
227 Ga0207705_10000145 3300025909 Bacteria 76141
228 Ga0207705_10000175 3300025909 Bacteria 68190
229 Ga0207654_10001453 3300025911 Bacteria 12567
230 Ga0207695_10007837 3300025913 Bacteria 13512
231 Ga0207695_10124923 3300025913 Bacteria 2537
232 Ga0207695_10514781 3300025913 Bacteria 1078
233 Ga0207671_10012962 3300025914 Bacteria 6671
234 Ga0207671_10124184 3300025914 Bacteria 1976
235 Ga0207662_10301226 3300025918 Bacteria 1066
236 Ga0207657_10001736 3300025919 Bacteria 23488
237 Ga0207657_10010116 3300025919 Bacteria 9428
238 Ga0207657_10111605 3300025919 Bacteria 2257
239 Ga0207649_10000356 3300025920 Bacteria 34254
240 Ga0207649_10072319 3300025920 Bacteria 2206
241 Ga0207649_10349233 3300025920 Bacteria 1094
242 Ga0207649_11497616 3300025920 Bacteria 534
243 Ga0207646_10829703 3300025922 Bacteria 822
244 Ga0207681_10010518 3300025923 Bacteria 5667
245 Ga0207681_10256885 3300025923 Bacteria 1366
246 Ga0207681_10533001 3300025923 Bacteria 965
247 Ga0207681_11154288 3300025923 Bacteria 651
248 Ga0207694_10032950 3300025924 Bacteria 3968
249 Ga0207694_10129540 3300025924 Bacteria 2022
250 Ga0207694_10175151 3300025924 Bacteria 1738
251 Ga0207650_10017523 3300025925 Bacteria 5018
252 Ga0207650_10264172 3300025925 Bacteria 1397
253 Ga0207659_10199359 3300025926 Bacteria 1597
254 Ga0207687_10107527 3300025927 Bacteria 2064
255 Ga0207644_11806421 3300025931 Bacteria 511
256 Ga0207690_10000740 3300025932 Bacteria 21050
257 Ga0207690_10902023 3300025932 Bacteria 733
258 Ga0207690_11782033 3300025932 Bacteria 514
259 Ga0207706_10027462 3300025933 Bacteria 5088
260 Ga0207706_10157746 3300025933 Bacteria 1995
261 Ga0207706_11143824 3300025933 Bacteria 649
262 Ga0207709_10000110 3300025935 Bacteria 127725
263 Ga0207669_10000180 3300025937 Bacteria 29217
264 Ga0207669_10004008 3300025937 Bacteria 6438
265 Ga0207669_10875886 3300025937 Bacteria 749
266 Ga0207691_10146371 3300025940 Bacteria 2079
267 Ga0207691_10237993 3300025940 Bacteria 1575
268 Ga0207711_10006235 3300025941 Bacteria 10061
269 Ga0207711_10154354 3300025941 Bacteria 2074
270 Ga0207711_10947418 3300025941 Bacteria 800
271 Ga0207689_10111078 3300025942 Bacteria 2253
272 Ga0207661_10107178 3300025944 Bacteria 2357
273 Ga0207661_11576007 3300025944 Bacteria 601
274 Ga0207679_10248378 3300025945 Bacteria 1511
275 Ga0207667_10000006 3300025949 Bacteria 679876
276 Ga0207667_10000007 3300025949 Bacteria 630590
277 Ga0207667_10030786 3300025949 Bacteria 5800
278 Ga0207651_11265471 3300025960 Bacteria 663
279 Ga0207668_10000142 3300025972 Bacteria 48783
280 Ga0207668_10167392 3300025972 Bacteria 1720
281 Ga0207668_10446666 3300025972 Bacteria 1102
282 Ga0207640_11609093 3300025981 Bacteria 585
283 Ga0207658_10000309 3300025986 Bacteria 49982
284 Ga0207658_10093098 3300025986 Bacteria 2343
285 Ga0207677_10079560 3300026023 Bacteria 2344
286 Ga0207703_10000499 3300026035 Bacteria 40585
287 Ga0207703_10873846 3300026035 Bacteria 860
288 Ga0207639_10006283 3300026041 Bacteria 8068
289 Ga0207639_10477193 3300026041 Bacteria 1136
290 Ga0207678_10026444 3300026067 Bacteria 5061
291 Ga0207678_11341710 3300026067 Bacteria 633
292 Ga0207702_10009788 3300026078 Bacteria 8041
293 Ga0207702_10277187 3300026078 Bacteria 1584
294 Ga0207702_11961022 3300026078 Bacteria 576
295 Ga0207641_10000239 3300026088 Bacteria 71088
296 Ga0207641_10000263 3300026088 Bacteria 66525
297 Ga0207641_10036160 3300026088 Bacteria 4121
298 Ga0207648_10056611 3300026089 Bacteria 3421
299 Ga0207676_10000462 3300026095 Bacteria 34094
300 Ga0207674_10095289 3300026116 Bacteria 2962
301 Ga0207675_100000131 3300026118 Bacteria 62791
302 Ga0207675_100173025 3300026118 Bacteria 2065
303 Ga0207683_10002356 3300026121 Bacteria 16533
304 Ga0207698_10118919 3300026142 Bacteria 2232
305 Ga0207698_10344540 3300026142 Bacteria 1405
306 Ga0207698_11318135 3300026142 Bacteria 737
307 Ga0207698_11694738 3300026142 Bacteria 647
308 Ga0207698_11860258 3300026142 Bacteria 617
309 Ga0209281_1013547 3300027111 Bacteria 1756
310 Ga0209971_1012838 3300027682 Bacteria 1985
311 Ga0268265_10000347 3300028380 Bacteria 50038
312 Ga0268265_11064554 3300028380 Bacteria 801
313 Ga0268264_10081868 3300028381 Bacteria 2760
314 Ga0307517_10010535 3300028786 Bacteria 12933
315 Ga0307513_10013397 3300031456 Bacteria 10063
316 Ga0307513_10056040 3300031456 Bacteria 4212
317 Ga0307408_100291702 3300031548 Bacteria 1362
318 Ga0307405_10019245 3300031731 Bacteria 3787
319 Ga0307406_10143174 3300031901 Bacteria 1695
320 Ga0307407_10078246 3300031903 Bacteria 1992
321 Ga0307412_10008992 3300031911 Bacteria 5724
322 Ga0307412_10080016 3300031911 Bacteria 2256
323 Ga0307412_10219688 3300031911 Bacteria 1456
324 Ga0307409_100236548 3300031995 Bacteria 1660
325 Ga0307416_100014503 3300032002 Bacteria 5406
326 Ga0307414_10093964 3300032004 Bacteria 2237
327 Ga0307411_10194422 3300032005 Bacteria 1552
328 Ga0307510_10002511 3300033180 Bacteria 20892
329 Ga0307510_10034976 3300033180 Bacteria 5616
330 Ga0373954_0136606 3300035118 Bacteria 1195
331 Ga0436364_0376551 3300037853 Bacteria 945
332 Ga0436365_0623759 3300039437 Bacteria 1289
333 Ga0436365_1719205 3300039437 Bacteria 1440
334 Ga0436363_0066076 3300039450 Bacteria 2967
335 Ga0436363_0878797 3300039450 Bacteria 1342
336 Ga0439439_0062767 3300041406 Bacteria 988
337 Ga0439447_171077 3300041407 Bacteria 501
338 Ga0439461_0000016 3300041410 Bacteria 22235
339 Ga0439461_0024660 3300041410 Bacteria 1217
340 Ga0439466_0043324 3300041411 Bacteria 1495
341 Ga0439465_0000383 3300041413 Bacteria 12773
342 Ga0439465_0235968 3300041413 Bacteria 673
343 Ga0451789_0191616 3300041443 Bacteria 602
344 Ga0451795_1493436 3300041456 Bacteria 731
345 Ga0451804_1081906 3300041463 Bacteria 564
346 Ga0451853_0928386 3300041512 Bacteria 1027
347 Ga0439431_0074304 3300041997 Bacteria 909
348 Ga0439433_0151568 3300041999 Bacteria 597
349 Ga0439442_011840 3300042002 Bacteria 1780
350 Ga0439445_0000596 3300042004 Bacteria 7408
351 Ga0439445_0010152 3300042004 Bacteria 2224
352 Ga0439448_0082116 3300042005 Bacteria 1083
353 Ga0439432_025619 3300042006 Bacteria 1933
354 Ga0439449_0226626 3300042007 Bacteria 701
355 Ga0439452_047965 3300042010 Bacteria 986
356 Ga0439457_015805 3300042014 Bacteria 1684
357 Ga0439462_0011139 3300042015 Bacteria 2285
358 Ga0450890_006555 3300042127 Bacteria 1488
359 Ga0450908_037927 3300042184 Bacteria 835
360 Ga0439434_0000681 3300042435 Bacteria 9802
361 Ga0439434_0007685 3300042435 Bacteria 3159
362 Ga0439459_0198010 3300042438 Bacteria 547
363 Ga0466971_0001334 3300044719 Bacteria 10314
364 Ga0466970_0041610 3300044765 Bacteria 2442
365 Ga0495627_016344 3300046453 Bacteria 2542
366 Ga0495638_0000051 3300046460 Bacteria 206003
367 Ga0495638_0000253 3300046460 Bacteria 72446
368 Ga0495638_0149484 3300046460 Bacteria 1356
369 Ga0495638_0274181 3300046460 Bacteria 919
370 Ga0495650_0000364 3300046471 Bacteria 79811
371 Ga0495650_0000861 3300046471 Bacteria 36461
372 Ga0495584_0031870 3300046491 Bacteria 2668
373 Ga0495584_0032605 3300046491 Bacteria 2636
374 Ga0495585_0059085 3300046492 Bacteria 2114
375 Ga0495585_0087333 3300046492 Bacteria 1683
376 Ga0495596_0011775 3300046500 Bacteria 3757
377 Ga0495583_0000311 3300046506 Bacteria 76925
378 Ga0495583_0000422 3300046506 Bacteria 64011
379 Ga0495583_0006357 3300046506 Bacteria 7745
380 Ga0495583_0009032 3300046506 Bacteria 6005
381 Ga0495606_0000071 3300046507 Bacteria 175933
382 Ga0495606_0009784 3300046507 Bacteria 8056
383 Ga0495616_0000013 3300046513 Bacteria 202334
384 Ga0495616_0109386 3300046513 Bacteria 1285
385 Ga0495632_0000359 3300046519 Bacteria 43288
386 Ga0495637_0013302 3300046520 Bacteria 3908
387 Ga0495643_0005960 3300046522 Bacteria 8134
388 Ga0495643_0059810 3300046522 Bacteria 2024
389 Ga0495648_0000032 3300046524 Bacteria 205970
390 Ga0495648_0004148 3300046524 Bacteria 12456
391 Ga0495648_0011410 3300046524 Bacteria 6693
392 Ga0495648_0011503 3300046524 Bacteria 6658
393 Ga0495663_0005078 3300046525 Bacteria 3676
394 Ga0495663_0024185 3300046525 Bacteria 1764
395 Ga0495663_0095737 3300046525 Bacteria 972
396 Ga0495642_0002920 3300046528 Bacteria 6808
397 Ga0495642_0129605 3300046528 Bacteria 1085
398 Ga0495654_0001078 3300046530 Bacteria 19876
399 Ga0495654_0173140 3300046530 Bacteria 940
400 Ga0495609_0116761 3300046538 Bacteria 1149
401 Ga0495597_0043979 3300046542 Bacteria 1987
402 Ga0495622_0026294 3300046557 Bacteria 2718
403 Ga0495622_0064688 3300046557 Bacteria 1691
404 Ga0495633_0000102 3300046558 Bacteria 115655
405 Ga0495633_0015197 3300046558 Bacteria 3999
406 Ga0495633_0091476 3300046558 Bacteria 1414
407 Ga0495633_0245384 3300046558 Bacteria 817
408 Ga0495668_0000335 3300046616 Bacteria 64094
409 Ga0495668_0003028 3300046616 Bacteria 13087
410 Ga0495668_0004587 3300046616 Bacteria 9720
411 Ga0495668_0010516 3300046616 Bacteria 5596
412 Ga0495668_0013888 3300046616 Bacteria 4736
413 Ga0495668_0543449 3300046616 Bacteria 641
414 Ga0495668_0772829 3300046616 Bacteria 532
415 Ga0495611_0011045 3300046648 Bacteria 3824
416 Ga0495611_0365635 3300046648 Bacteria 661
417 Ga0495625_0000031 3300046660 Bacteria 238193
418 Ga0495625_0000212 3300046660 Bacteria 91883
419 Ga0495625_0012733 3300046660 Bacteria 6802
420 Ga0495625_0032342 3300046660 Bacteria 3880
421 Ga0495625_0049982 3300046660 Bacteria 3003
422 Ga0495625_0095060 3300046660 Bacteria 2055
423 Ga0495625_0104248 3300046660 Bacteria 1944
424 Ga0495625_0110302 3300046660 Bacteria 1881
425 Ga0495625_0121079 3300046660 Bacteria 1780
426 Ga0495625_0272424 3300046660 Bacteria 1092
427 Ga0495625_0835857 3300046660 Bacteria 533
428 Ga0495661_0378506 3300046665 Bacteria 692
429 Ga0495661_0593238 3300046665 Bacteria 521
430 Ga0495669_0000016 3300046684 Bacteria 135096
431 Ga0495613_0210665 3300046689 Bacteria 1367
432 Ga0495670_0002841 3300046691 Bacteria 8561
433 Ga0495670_0166050 3300046691 Bacteria 1161
434 Ga0495670_0194420 3300046691 Bacteria 1073
435 Ga0495670_0234624 3300046691 Bacteria 976
436 Ga0495671_0000020 3300046692 Bacteria 268306
437 Ga0495671_0001468 3300046692 Bacteria 15811
438 Ga0495671_0646683 3300046692 Bacteria 502
439 Ga0495649_0045366 3300046694 Bacteria 2396
440 Ga0495649_0067080 3300046694 Bacteria 1925
441 Ga0495589_0007669 3300046794 Bacteria 5653
442 Ga0495600_0341717 3300046809 Bacteria 938
443 Ga0495660_0100344 3300046810 Bacteria 1491
444 Ga0495660_0404959 3300046810 Bacteria 597
445 Ga0495660_0517350 3300046810 Bacteria 508
446 Ga0495604_0968883 3300047317 Bacteria 528
447 Ga0495683_0015856 3300047323 Bacteria 3913
448 Ga0495687_000076 3300047443 Bacteria 149259
449 Ga0495687_007447 3300047443 Bacteria 6443
450 Ga0495677_0002869 3300047445 Bacteria 6717
451 Ga0495677_0012258 3300047445 Bacteria 3128
452 Ga0495685_082289 3300047447 Bacteria 1072
453 Ga0495673_0000076 3300047469 Bacteria 205985
454 Ga0495673_0066082 3300047469 Bacteria 1534
455 Ga0495681_0011962 3300047470 Bacteria 5126
456 Ga0495681_0012432 3300047470 Bacteria 5001
457 Ga0495686_0206804 3300047472 Bacteria 1123
458 Ga0496101_0448668 3300048904 Bacteria 1018
459 Ga0496101_0752839 3300048904 Bacteria 769
460 Ga0496102_0000218 3300048905 Bacteria 75909
461 Ga0496103_0000045 3300048906 Bacteria 165828
462 Ga0496103_0004526 3300048906 Bacteria 8422
463 Ga0496103_0286144 3300048906 Bacteria 1060
464 Ga0496103_0952809 3300048906 Bacteria 536
465 Ga0496104_0061903 3300048907 Bacteria 3548
466 Ga0496104_0115782 3300048907 Bacteria 2572
467 Ga0496105_0000559 3300048908 Bacteria 24579
468 Ga0496105_0045019 3300048908 Bacteria 3641
469 Ga0496106_0210081 3300048909 Bacteria 1550
470 Ga0496108_0462648 3300048911 Bacteria 1108
471 Ga0496109_0048777 3300048912 Bacteria 3853
472 Ga0496111_0004043 3300048914 Bacteria 9212
473 Ga0496112_0195922 3300048915 Bacteria 1981
474 Ga0496114_0015728 3300048917 Bacteria 6088
475 Ga0496115_0000136 3300048918 Bacteria 67646
476 Ga0496115_0000310 3300048918 Bacteria 41423
477 Ga0496116_0001537 3300048919 Bacteria 25567
478 Ga0496117_0000046 3300048920 Bacteria 300879
479 Ga0496117_0005707 3300048920 Bacteria 12955
480 Ga0496117_0024874 3300048920 Bacteria 4719
481 Ga0496117_0117256 3300048920 Bacteria 1644
482 Ga0496118_0000036 3300048921 Bacteria 318213
483 Ga0496118_0000873 3300048921 Bacteria 47650
484 Ga0496118_0044754 3300048921 Bacteria 3462
485 Ga0496118_0342565 3300048921 Bacteria 800
486 Ga0496119_0016658 3300048922 Bacteria 5578
487 Ga0496119_0167459 3300048922 Bacteria 1163
488 Ga0496120_0012993 3300048923 Bacteria 5631
489 Ga0496120_0211205 3300048923 Bacteria 933
490 Ga0496121_0000163 3300048924 Bacteria 145648
491 Ga0496121_0000267 3300048924 Bacteria 109129
492 Ga0496121_0191252 3300048924 Bacteria 1467
493 Ga0496122_0000176 3300048925 Bacteria 152190
494 Ga0496122_0030656 3300048925 Bacteria 4499
495 Ga0496122_0334226 3300048925 Bacteria 799
496 Ga0496123_0000220 3300048926 Bacteria 115824
497 Ga0496123_0008373 3300048926 Bacteria 9508
498 Ga0496123_0138332 3300048926 Bacteria 1336
499 Ga0496123_0349080 3300048926 Bacteria 689
500 Ga0496124_0000011 3300048927 Bacteria 524145
501 Ga0496124_0088150 3300048927 Bacteria 2537
502 Ga0496125_0000919 3300048928 Bacteria 46303
503 Ga0496125_0244802 3300048928 Bacteria 1136
504 Ga0496126_0000440 3300048929 Bacteria 82896
505 Ga0496126_0132521 3300048929 Bacteria 2152
506 Ga0501223_000068 3300049663 Bacteria 31779
507 Ga0501225_0032185 3300049705 Bacteria 1443
508 Ga0501241_020003 3300049758 Bacteria 1230
509 Ga0501263_033744 3300049760 Bacteria 731
510 Ga0501035_0469616 3300049822 Bacteria 1039
511 nmdc:mga0k408_680189_c1 3300050493 Bacteria 604
512 nmdc:mga0n895_283835_c1 3300050512 Bacteria 1679
513 Ga0500610_0000177 3300053079 Bacteria 19233
514 Ga0495619_0385739 3300053085 Bacteria 968
515 Ga0500643_000198 3300053087 Bacteria 57293
516 Ga0500643_004388 3300053087 Bacteria 6401
517 Ga0500643_019936 3300053087 Bacteria 2201
518 Ga0500644_0042264 3300053088 Bacteria 1519
519 Ga0500646_0013617 3300053090 Bacteria 2106
520 Ga0500646_0051018 3300053090 Bacteria 1194
521 Ga0500647_0085607 3300053091 Bacteria 1511
522 Ga0500583_0471968 3300053092 Bacteria 593
523 Ga0500651_0469138 3300053093 Bacteria 698
524 Ga0500566_0000390 3300053094 Bacteria 24310
525 Ga0500641_0022767 3300053096 Bacteria 2403
526 Ga0500556_0023742 3300053104 Bacteria 2007
527 Ga0500562_000641 3300053108 Bacteria 8461
528 Ga0500562_016888 3300053108 Bacteria 1878
529 Ga0500562_135535 3300053108 Bacteria 671
530 Ga0500594_0009535 3300053118 Bacteria 2237
531 Ga0500595_000561 3300053119 Bacteria 22169
532 Ga0500595_003380 3300053119 Bacteria 7474
533 Ga0500626_070579 3300053128 Bacteria 1555
534 Ga0500642_0000820 3300053130 Bacteria 9091
535 Ga0500652_094110 3300053131 Bacteria 1251
536 Ga0500658_0000712 3300053134 Bacteria 13753
537 Ga0500658_0003978 3300053134 Bacteria 5547
538 Ga0500658_0050036 3300053134 Bacteria 1705
539 Ga0500559_0001109 3300053136 Bacteria 16234
540 Ga0500559_0035224 3300053136 Bacteria 2161
541 Ga0500559_0044255 3300053136 Bacteria 1947
542 Ga0500559_0051515 3300053136 Bacteria 1818
543 Ga0500559_0221315 3300053136 Bacteria 892
544 Ga0500564_235322 3300053138 Bacteria 734
545 Ga0500568_0005082 3300053139 Bacteria 6882
546 Ga0500568_0020938 3300053139 Bacteria 2821
547 Ga0500573_0000010 3300053140 Bacteria 210704
548 Ga0500573_0056822 3300053140 Bacteria 2247
549 Ga0500604_0000209 3300053151 Bacteria 16814
550 Ga0500604_0001692 3300053151 Bacteria 6195
551 Ga0500604_0322580 3300053151 Bacteria 536
552 Ga0500604_0331370 3300053151 Bacteria 528
553 Ga0500616_0002626 3300053153 Bacteria 14669
554 Ga0500619_002987 3300053154 Bacteria 3372
555 Ga0500622_0081920 3300053156 Bacteria 1615
556 Ga0500627_0003617 3300053158 Bacteria 4819
557 Ga0500627_0023169 3300053158 Bacteria 2528
558 Ga0500636_0005235 3300053177 Bacteria 7384
559 Ga0500645_000003 3300053730 Bacteria 305887
560 Ga0500645_004247 3300053730 Bacteria 5558
561 Ga0500645_009030 3300053730 Bacteria 3367
562 Ga0500609_005248 3300053731 Bacteria 1771
563 Ga0500596_000564 3300053735 Bacteria 7057
564 Ga0500661_000242 3300055283 Bacteria 9826
565 Ga0500661_015226 3300055283 Bacteria 1380
566 Ga0466962_0106486 3300061719 Bacteria 1348

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100470951 Ga0075434_1004709511 89
2 3300050512 nmdc:mga0n895_283835_c1 nmdc:mga0n895_283835_c1_914_1261 89
3 3300005617 Ga0068859_102105870 Ga0068859_1021058702 93
4 3300006931 Ga0097620_102106191 Ga0097620_1021061912 93
5 3300025918 Ga0207662_10301226 Ga0207662_103012262 93
6 3300005539 Ga0068853_100489210 Ga0068853_1004892102 96
7 3300013104 Ga0157370_10083238 Ga0157370_100832383 96
8 3300044719 Ga0466971_0001334 Ga0466971_0001334_8274_8648 97
9 3300044765 Ga0466970_0041610 Ga0466970_0041610_1644_2018 97
10 3300048923 Ga0496120_0211205 Ga0496120_0211205_585_905 97
11 3300061719 Ga0466962_0106486 Ga0466962_0106486_777_1151 97
12 3300005327 Ga0070658_10000057 Ga0070658_1000005780 98
13 3300025909 Ga0207705_10000145 Ga0207705_1000014543 98
14 3300025919 Ga0207657_10001736 Ga0207657_1000173612 98
15 3300025932 Ga0207690_10902023 Ga0207690_109020232 98
16 3300003322 rootL2_10086552 rootL2_100865521 99
17 3300049822 Ga0501035_0469616 Ga0501035_0469616_61_432 99
18 3300053108 Ga0500562_000641 Ga0500562_000641_864_1211 99
19 3300005471 Ga0070698_101008150 Ga0070698_1010081502 100
20 3300013307 Ga0157372_10210567 Ga0157372_102105673 100
21 3300013308 Ga0157375_12621750 Ga0157375_126217501 100
22 3300027682 Ga0209971_1012838 Ga0209971_10128382 100
23 3300037853 Ga0436364_0376551 Ga0436364_0376551_27_350 100
24 3300046558 Ga0495633_0000102 Ga0495633_0000102_29882_30241 100
25 3300048926 Ga0496123_0349080 Ga0496123_0349080_13_333 100
26 3300001979 JGI24740J21852_10013488 JGI24740J21852_100134883 101
27 3300005339 Ga0070660_100002838 Ga0070660_1000028383 101
28 3300005563 Ga0068855_100357824 Ga0068855_1003578242 101
29 3300005577 Ga0068857_100646853 Ga0068857_1006468532 101
30 3300005834 Ga0068851_10299820 Ga0068851_102998202 101
31 3300009545 Ga0105237_10125704 Ga0105237_101257042 101
32 3300010375 Ga0105239_10474026 Ga0105239_104740262 101
33 3300013105 Ga0157369_10215265 Ga0157369_102152652 101
34 3300025914 Ga0207671_10124184 Ga0207671_101241842 101
35 3300025919 Ga0207657_10010116 Ga0207657_1001011611 101
36 3300025949 Ga0207667_10030786 Ga0207667_100307862 101
37 3300046460 Ga0495638_0000051 Ga0495638_0000051_86615_86974 101
38 3300046506 Ga0495583_0000422 Ga0495583_0000422_28621_28980 101
39 3300046519 Ga0495632_0000359 Ga0495632_0000359_11881_12240 101
40 3300046524 Ga0495648_0000032 Ga0495648_0000032_119010_119369 101
41 3300046558 Ga0495633_0245384 Ga0495633_0245384_446_805 101
42 3300046692 Ga0495671_0000020 Ga0495671_0000020_86003_86362 101
43 3300046810 Ga0495660_0517350 Ga0495660_0517350_15_335 101
44 3300047469 Ga0495673_0000076 Ga0495673_0000076_119111_119470 101
45 3300053108 Ga0500562_016888 Ga0500562_016888_990_1340 101
46 3300049663 Ga0501223_000068 Ga0501223_000068_3206_3565 102
47 3300049705 Ga0501225_0032185 Ga0501225_0032185_210_569 102
48 3300005347 Ga0070668_102066056 Ga0070668_1020660562 103
49 3300005563 Ga0068855_100008205 Ga0068855_1000082051 103
50 3300005578 Ga0068854_100001318 Ga0068854_10000131817 103
51 3300006846 Ga0075430_101037875 Ga0075430_1010378751 103
52 3300009551 Ga0105238_10196334 Ga0105238_101963342 103
53 3300014969 Ga0157376_11920924 Ga0157376_119209242 103
54 3300017792 Ga0163161_10839692 Ga0163161_108396922 103
55 3300025923 Ga0207681_11154288 Ga0207681_111542882 103
56 3300025924 Ga0207694_10175151 Ga0207694_101751512 103
57 3300025949 Ga0207667_10000007 Ga0207667_10000007521 103
58 3300031456 Ga0307513_10056040 Ga0307513_100560402 103
59 3300041443 Ga0451789_0191616 Ga0451789_0191616_262_585 103
60 3300041463 Ga0451804_1081906 Ga0451804_1081906_20_343 103
61 3300003771 Ga0055526_1008606 Ga0055526_10086063 104
62 3300003773 Ga0055537_1003695 Ga0055537_10036954 104
63 3300003781 Ga0055536_1009513 Ga0055536_10095132 104
64 3300003791 Ga0055530_10017873 Ga0055530_100178733 104
65 3300003792 Ga0055540_1001397 Ga0055540_10013979 104
66 3300005262 Ga0065165_1070188 Ga0065165_10701881 104
67 3300005518 Ga0070699_101796619 Ga0070699_1017966191 104
68 3300010375 Ga0105239_10528868 Ga0105239_105288682 104
69 3300025263 Ga0209565_1000251 Ga0209565_10002512 104
70 3300025273 Ga0209673_1038797 Ga0209673_10387972 104
71 3300025292 Ga0209676_1007848 Ga0209676_10078483 104
72 3300025298 Ga0209050_1000001 Ga0209050_1000001599 104
73 3300025298 Ga0209050_1000213 Ga0209050_100021332 104
74 3300025303 Ga0209051_1000360 Ga0209051_100036025 104
75 3300025304 Ga0209257_1017280 Ga0209257_10172803 104
76 3300025920 Ga0207649_10072319 Ga0207649_100723192 104
77 3300031911 Ga0307412_10080016 Ga0307412_100800162 104
78 3300031911 Ga0307412_10219688 Ga0307412_102196882 104
79 3300046616 Ga0495668_0013888 Ga0495668_0013888_3674_4030 104
80 3300048920 Ga0496117_0117256 Ga0496117_0117256_950_1321 104
81 3300048921 Ga0496118_0342565 Ga0496118_0342565_150_521 104
82 3300048925 Ga0496122_0334226 Ga0496122_0334226_222_593 104
83 3300048926 Ga0496123_0138332 Ga0496123_0138332_106_477 104
84 3300053156 Ga0500622_0081920 Ga0500622_0081920_646_981 104
85 3300055283 Ga0500661_000242 Ga0500661_000242_8796_9152 104
86 iso_pu_bacteria 2919709256 2919710735 104
87 3300031548 Ga0307408_100291702 Ga0307408_1002917022 105
88 3300031731 Ga0307405_10019245 Ga0307405_100192451 105
89 3300031901 Ga0307406_10143174 Ga0307406_101431742 105
90 3300031911 Ga0307412_10008992 Ga0307412_100089921 105
91 3300032002 Ga0307416_100014503 Ga0307416_1000145035 105
92 3300032004 Ga0307414_10093964 Ga0307414_100939642 105
93 3300032005 Ga0307411_10194422 Ga0307411_101944222 105
94 3300046660 Ga0495625_0000031 Ga0495625_0000031_27867_28226 105
95 3300046660 Ga0495625_0272424 Ga0495625_0272424_119_457 105
96 3300048925 Ga0496122_0000176 Ga0496122_0000176_44303_44641 105
97 3300048926 Ga0496123_0000220 Ga0496123_0000220_12823_13161 105
98 3300048929 Ga0496126_0132521 Ga0496126_0132521_111_449 105
99 3300053088 Ga0500644_0042264 Ga0500644_0042264_659_997 105
100 3300053091 Ga0500647_0085607 Ga0500647_0085607_537_884 105
101 3300053136 Ga0500559_0035224 Ga0500559_0035224_11_349 105
102 3300053138 Ga0500564_235322 Ga0500564_235322_85_432 105
103 iso_pu_bacteria 2775507255 2778126222 105
104 3300002074 JGI24748J21848_1000023 JGI24748J21848_100002378 106
105 3300002076 JGI24749J21850_1000156 JGI24749J21850_10001566 106
106 3300002239 JGI24034J26672_10000010 JGI24034J26672_1000001030 106
107 3300002244 JGI24742J22300_10017402 JGI24742J22300_100174022 106
108 3300002459 JGI24751J29686_10049336 JGI24751J29686_100493362 106
109 3300005328 Ga0070676_10679270 Ga0070676_106792701 106
110 3300005329 Ga0070683_101059577 Ga0070683_1010595772 106
111 3300005331 Ga0070670_100303741 Ga0070670_1003037412 106
112 3300005331 Ga0070670_100346298 Ga0070670_1003462982 106
113 3300005335 Ga0070666_10019177 Ga0070666_100191772 106
114 3300005339 Ga0070660_100992365 Ga0070660_1009923651 106
115 3300005347 Ga0070668_100000119 Ga0070668_1000001193 106
116 3300005353 Ga0070669_100014398 Ga0070669_1000143982 106
117 3300005355 Ga0070671_101509784 Ga0070671_1015097842 106
118 3300005367 Ga0070667_100000357 Ga0070667_10000035764 106
119 3300005455 Ga0070663_100958709 Ga0070663_1009587092 106
120 3300005456 Ga0070678_101117160 Ga0070678_1011171602 106
121 3300005466 Ga0070685_11253676 Ga0070685_112536761 106
122 3300005468 Ga0070707_100778539 Ga0070707_1007785392 106
123 3300005535 Ga0070684_101665788 Ga0070684_1016657881 106
124 3300005544 Ga0070686_100002456 Ga0070686_1000024569 106
125 3300005547 Ga0070693_100187501 Ga0070693_1001875012 106
126 3300005564 Ga0070664_100179635 Ga0070664_1001796352 106
127 3300005577 Ga0068857_101325583 Ga0068857_1013255832 106
128 3300005578 Ga0068854_100545696 Ga0068854_1005456961 106
129 3300005614 Ga0068856_100910960 Ga0068856_1009109602 106
130 3300005616 Ga0068852_101152868 Ga0068852_1011528682 106
131 3300005616 Ga0068852_101346391 Ga0068852_1013463912 106
132 3300005719 Ga0068861_100323665 Ga0068861_1003236651 106
133 3300005841 Ga0068863_100000166 Ga0068863_10000016663 106
134 3300005841 Ga0068863_100005052 Ga0068863_1000050523 106
135 3300005841 Ga0068863_100349892 Ga0068863_1003498922 106
136 3300005843 Ga0068860_100101000 Ga0068860_1001010003 106
137 3300005844 Ga0068862_100007236 Ga0068862_1000072364 106
138 3300005844 Ga0068862_101095716 Ga0068862_1010957161 106
139 3300005937 Ga0081455_10000049 Ga0081455_1000004952 106
140 3300006358 Ga0068871_100722740 Ga0068871_1007227402 106
141 3300009092 Ga0105250_10027805 Ga0105250_100278052 106
142 3300009098 Ga0105245_10510539 Ga0105245_105105392 106
143 3300009101 Ga0105247_10054793 Ga0105247_100547932 106
144 3300009101 Ga0105247_11513283 Ga0105247_115132831 106
145 3300009148 Ga0105243_10981560 Ga0105243_109815602 106
146 3300009174 Ga0105241_10739271 Ga0105241_107392712 106
147 3300009177 Ga0105248_10932467 Ga0105248_109324672 106
148 3300011119 Ga0105246_10899178 Ga0105246_108991782 106
149 3300013104 Ga0157370_11894846 Ga0157370_118948462 106
150 3300013297 Ga0157378_10257574 Ga0157378_102575742 106
151 3300013306 Ga0163162_10090807 Ga0163162_100908072 106
152 3300013308 Ga0157375_11111792 Ga0157375_111117922 106
153 3300014325 Ga0163163_10742123 Ga0163163_107421232 106
154 3300014326 Ga0157380_10001483 Ga0157380_1000148317 106
155 3300014968 Ga0157379_11289623 Ga0157379_112896231 106
156 3300020070 Ga0206356_10597583 Ga0206356_105975832 106
157 3300025223 Ga0207672_1000207 Ga0207672_10002072 106
158 3300025903 Ga0207680_10012515 Ga0207680_100125152 106
159 3300025920 Ga0207649_10349233 Ga0207649_103492332 106
160 3300025920 Ga0207649_11497616 Ga0207649_114976161 106
161 3300025922 Ga0207646_10829703 Ga0207646_108297032 106
162 3300025923 Ga0207681_10010518 Ga0207681_100105185 106
163 3300025925 Ga0207650_10264172 Ga0207650_102641722 106
164 3300025927 Ga0207687_10107527 Ga0207687_101075272 106
165 3300025931 Ga0207644_11806421 Ga0207644_118064212 106
166 3300025933 Ga0207706_11143824 Ga0207706_111438242 106
167 3300025937 Ga0207669_10875886 Ga0207669_108758862 106
168 3300025940 Ga0207691_10146371 Ga0207691_101463712 106
169 3300025942 Ga0207689_10111078 Ga0207689_101110782 106
170 3300025944 Ga0207661_10107178 Ga0207661_101071782 106
171 3300025960 Ga0207651_11265471 Ga0207651_112654711 106
172 3300025972 Ga0207668_10000142 Ga0207668_1000014252 106
173 3300025981 Ga0207640_11609093 Ga0207640_116090931 106
174 3300025986 Ga0207658_10000309 Ga0207658_1000030954 106
175 3300026035 Ga0207703_10873846 Ga0207703_108738462 106
176 3300026041 Ga0207639_10477193 Ga0207639_104771932 106
177 3300026078 Ga0207702_11961022 Ga0207702_119610222 106
178 3300026088 Ga0207641_10000239 Ga0207641_1000023953 106
179 3300026088 Ga0207641_10000263 Ga0207641_1000026340 106
180 3300026088 Ga0207641_10036160 Ga0207641_100361602 106
181 3300026118 Ga0207675_100000131 Ga0207675_10000013138 106
182 3300026142 Ga0207698_10344540 Ga0207698_103445402 106
183 3300026142 Ga0207698_11318135 Ga0207698_113181352 106
184 3300026142 Ga0207698_11694738 Ga0207698_116947382 106
185 3300026142 Ga0207698_11860258 Ga0207698_118602582 106
186 3300028380 Ga0268265_10000347 Ga0268265_100003475 106
187 3300028380 Ga0268265_11064554 Ga0268265_110645541 106
188 3300028381 Ga0268264_10081868 Ga0268264_100818681 106
189 3300039437 Ga0436365_0623759 Ga0436365_0623759_328_675 106
190 3300039450 Ga0436363_0878797 Ga0436363_0878797_337_684 106
191 3300046471 Ga0495650_0000861 Ga0495650_0000861_25679_26035 106
192 3300046525 Ga0495663_0095737 Ga0495663_0095737_166_522 106
193 3300046528 Ga0495642_0129605 Ga0495642_0129605_561_908 106
194 3300046530 Ga0495654_0001078 Ga0495654_0001078_17177_17533 106
195 3300046542 Ga0495597_0043979 Ga0495597_0043979_104_457 106
196 3300046557 Ga0495622_0026294 Ga0495622_0026294_1512_1865 106
197 3300046616 Ga0495668_0003028 Ga0495668_0003028_406_762 106
198 3300046660 Ga0495625_0049982 Ga0495625_0049982_944_1297 106
199 3300046692 Ga0495671_0001468 Ga0495671_0001468_9641_9994 106
200 3300046794 Ga0495589_0007669 Ga0495589_0007669_1510_1866 106
201 3300048904 Ga0496101_0752839 Ga0496101_0752839_334_687 106
202 3300048906 Ga0496103_0004526 Ga0496103_0004526_6042_6395 106
203 3300048907 Ga0496104_0115782 Ga0496104_0115782_1331_1684 106
204 3300048908 Ga0496105_0045019 Ga0496105_0045019_2722_3075 106
205 3300048909 Ga0496106_0210081 Ga0496106_0210081_452_805 106
206 3300048911 Ga0496108_0462648 Ga0496108_0462648_694_1047 106
207 3300048920 Ga0496117_0024874 Ga0496117_0024874_2649_3002 106
208 3300048921 Ga0496118_0044754 Ga0496118_0044754_3059_3412 106
209 3300048922 Ga0496119_0167459 Ga0496119_0167459_91_444 106
210 3300048924 Ga0496121_0191252 Ga0496121_0191252_634_987 106
211 3300053118 Ga0500594_0009535 Ga0500594_0009535_1806_2159 106
212 3300053151 Ga0500604_0322580 Ga0500604_0322580_159_515 106
213 3300053158 Ga0500627_0023169 Ga0500627_0023169_1158_1514 106
214 3300005327 Ga0070658_10000050 Ga0070658_1000005015 107
215 3300005457 Ga0070662_100160946 Ga0070662_1001609462 107
216 3300006353 Ga0075370_10704382 Ga0075370_107043821 107
217 3300025909 Ga0207705_10000014 Ga0207705_10000014387 107
218 3300025933 Ga0207706_10027462 Ga0207706_100274623 107
219 3300041406 Ga0439439_0062767 Ga0439439_0062767_553_903 107
220 3300041413 Ga0439465_0235968 Ga0439465_0235968_58_408 107
221 3300041997 Ga0439431_0074304 Ga0439431_0074304_184_534 107
222 3300042002 Ga0439442_011840 Ga0439442_011840_376_726 107
223 3300042004 Ga0439445_0010152 Ga0439445_0010152_52_402 107
224 3300042014 Ga0439457_015805 Ga0439457_015805_1036_1386 107
225 3300042184 Ga0450908_037927 Ga0450908_037927_374_724 107
226 3300042435 Ga0439434_0007685 Ga0439434_0007685_1075_1425 107
227 3300046513 Ga0495616_0000013 Ga0495616_0000013_182648_183007 107
228 3300046616 Ga0495668_0010516 Ga0495668_0010516_3993_4352 107
229 3300046616 Ga0495668_0772829 Ga0495668_0772829_15_365 107
230 3300046648 Ga0495611_0365635 Ga0495611_0365635_192_548 107
231 3300046691 Ga0495670_0194420 Ga0495670_0194420_376_732 107
232 3300047472 Ga0495686_0206804 Ga0495686_0206804_595_948 107
233 3300053087 Ga0500643_000198 Ga0500643_000198_200_556 107
234 3300053134 Ga0500658_0000712 Ga0500658_0000712_12899_13249 107
235 3300053136 Ga0500559_0001109 Ga0500559_0001109_8729_9085 107
236 3300053139 Ga0500568_0020938 Ga0500568_0020938_1735_2085 107
237 3300053151 Ga0500604_0001692 Ga0500604_0001692_2011_2370 107
238 3300053151 Ga0500604_0331370 Ga0500604_0331370_50_400 107
239 3300053158 Ga0500627_0003617 Ga0500627_0003617_3182_3541 107
240 3300005844 Ga0068862_101455734 Ga0068862_1014557342 108
241 3300006946 Ga0079104_1019212 Ga0079104_10192122 108
242 3300025315 Ga0207697_10278433 Ga0207697_102784332 108
243 3300027111 Ga0209281_1013547 Ga0209281_10135472 108
244 3300046524 Ga0495648_0011410 Ga0495648_0011410_4590_4937 108
245 3300046660 Ga0495625_0835857 Ga0495625_0835857_37_390 108
246 3300053090 Ga0500646_0051018 Ga0500646_0051018_492_845 108
247 3300053139 Ga0500568_0005082 Ga0500568_0005082_1003_1356 108
248 3300053151 Ga0500604_0000209 Ga0500604_0000209_11523_11876 108
249 3300053153 Ga0500616_0002626 Ga0500616_0002626_8697_9050 108
250 3300053730 Ga0500645_009030 Ga0500645_009030_2057_2386 108
251 3300005347 Ga0070668_100002467 Ga0070668_10000246711 109
252 3300005353 Ga0070669_100131635 Ga0070669_1001316352 109
253 3300005844 Ga0068862_100018449 Ga0068862_1000184494 109
254 3300009551 Ga0105238_10019274 Ga0105238_100192745 109
255 3300009978 Ga0105148_102161 Ga0105148_1021612 109
256 3300010375 Ga0105239_10575524 Ga0105239_105755242 109
257 3300025923 Ga0207681_10256885 Ga0207681_102568852 109
258 3300025924 Ga0207694_10129540 Ga0207694_101295402 109
259 3300025941 Ga0207711_10154354 Ga0207711_101543542 109
260 3300025972 Ga0207668_10446666 Ga0207668_104466662 109
261 3300031903 Ga0307407_10078246 Ga0307407_100782462 109
262 3300046460 Ga0495638_0274181 Ga0495638_0274181_557_904 109
263 3300046660 Ga0495625_0095060 Ga0495625_0095060_996_1334 109
264 3300046694 Ga0495649_0067080 Ga0495649_0067080_1239_1577 109
265 3300048920 Ga0496117_0005707 Ga0496117_0005707_8483_8851 109
266 3300048921 Ga0496118_0000873 Ga0496118_0000873_31300_31668 109
267 3300048927 Ga0496124_0088150 Ga0496124_0088150_1345_1713 109
268 iso_pu_bacteria 8057101203 8057105253 109
269 3300005262 Ga0065165_1021463 Ga0065165_10214632 110
270 3300005983 Ga0081540_1058834 Ga0081540_10588342 110
271 3300025295 Ga0209564_1002600 Ga0209564_100260015 110
272 3300053085 Ga0495619_0385739 Ga0495619_0385739_38_412 110
273 iso_pu_bacteria 2990265787 2990268958 110
274 iso_pu_bacteria 2993693658 2993697230 110
275 3300021388 Ga0213875_10293205 Ga0213875_102932051 111
276 3300053140 Ga0500573_0000010 Ga0500573_0000010_157044_157403 111
277 iso_pu_bacteria 2830075706 2830075917 111
278 3300039450 Ga0436363_0066076 Ga0436363_0066076_2035_2385 112
279 3300041456 Ga0451795_1493436 Ga0451795_1493436_58_417 112
280 3300046460 Ga0495638_0000253 Ga0495638_0000253_27324_27683 112
281 3300046522 Ga0495643_0059810 Ga0495643_0059810_708_1067 112
282 3300046525 Ga0495663_0005078 Ga0495663_0005078_1008_1367 112
283 3300046616 Ga0495668_0543449 Ga0495668_0543449_158_514 112
284 3300046660 Ga0495625_0110302 Ga0495625_0110302_1252_1611 112
285 3300046691 Ga0495670_0002841 Ga0495670_0002841_1687_2049 112
286 3300053093 Ga0500651_0469138 Ga0500651_0469138_216_590 112
287 3300053136 Ga0500559_0044255 Ga0500559_0044255_379_738 112
288 iso_pu_bacteria 2643221622 2644127309 112
289 3300005842 Ga0068858_100000288 Ga0068858_10000028826 113
290 3300009177 Ga0105248_11957901 Ga0105248_119579011 113
291 3300013102 Ga0157371_10091026 Ga0157371_100910262 113
292 3300013104 Ga0157370_10892119 Ga0157370_108921192 113
293 3300013306 Ga0163162_11362536 Ga0163162_113625362 113
294 3300014325 Ga0163163_10675384 Ga0163163_106753842 113
295 3300014497 Ga0182008_10296491 Ga0182008_102964912 113
296 3300025941 Ga0207711_10006235 Ga0207711_100062356 113
297 3300025941 Ga0207711_10947418 Ga0207711_109474181 113
298 3300026035 Ga0207703_10000499 Ga0207703_1000049933 113
299 3300035118 Ga0373954_0136606 Ga0373954_0136606_173_535 113
300 3300046665 Ga0495661_0593238 Ga0495661_0593238_120_482 113
301 3300053090 Ga0500646_0013617 Ga0500646_0013617_837_1196 113
302 3300053108 Ga0500562_135535 Ga0500562_135535_301_660 113
303 3300053119 Ga0500595_000561 Ga0500595_000561_5081_5440 113
304 3300053140 Ga0500573_0056822 Ga0500573_0056822_913_1269 113
305 iso_pu_bacteria 2885429604 2885432072 113
306 3300001915 JGI24741J21665_1002900 JGI24741J21665_10029005 114
307 3300001979 JGI24740J21852_10009356 JGI24740J21852_100093561 114
308 3300001979 JGI24740J21852_10023649 JGI24740J21852_100236491 114
309 3300001989 JGI24739J22299_10006986 JGI24739J22299_100069864 114
310 3300001990 JGI24737J22298_10031352 JGI24737J22298_100313522 114
311 3300002075 JGI24738J21930_10044854 JGI24738J21930_100448542 114
312 3300003215 JGI25153J46596_10000007 JGI25153J46596_1000000710 114
313 3300003322 rootL2_10291844 rootL2_102918442 114
314 3300003762 Ga0055542_1000353 Ga0055542_10003535 114
315 3300003763 Ga0055529_1000377 Ga0055529_10003775 114
316 3300005327 Ga0070658_10104586 Ga0070658_101045862 114
317 3300005338 Ga0068868_100627143 Ga0068868_1006271431 114
318 3300005344 Ga0070661_100013732 Ga0070661_1000137322 114
319 3300005347 Ga0070668_100524958 Ga0070668_1005249582 114
320 3300005354 Ga0070675_100106452 Ga0070675_1001064522 114
321 3300005355 Ga0070671_100292373 Ga0070671_1002923732 114
322 3300005364 Ga0070673_100568277 Ga0070673_1005682772 114
323 3300005366 Ga0070659_100049994 Ga0070659_1000499942 114
324 3300005366 Ga0070659_100632487 Ga0070659_1006324872 114
325 3300005367 Ga0070667_100113685 Ga0070667_1001136852 114
326 3300005455 Ga0070663_101557172 Ga0070663_1015571721 114
327 3300005456 Ga0070678_100063976 Ga0070678_1000639762 114
328 3300005457 Ga0070662_100171954 Ga0070662_1001719542 114
329 3300005459 Ga0068867_100190815 Ga0068867_1001908152 114
330 3300005535 Ga0070684_100501475 Ga0070684_1005014752 114
331 3300005539 Ga0068853_100156433 Ga0068853_1001564332 114
332 3300005543 Ga0070672_100271546 Ga0070672_1002715462 114
333 3300005563 Ga0068855_100563177 Ga0068855_1005631772 114
334 3300005564 Ga0070664_100127861 Ga0070664_1001278612 114
335 3300005577 Ga0068857_101358641 Ga0068857_1013586412 114
336 3300005614 Ga0068856_100192320 Ga0068856_1001923201 114
337 3300005614 Ga0068856_100362316 Ga0068856_1003623162 114
338 3300005614 Ga0068856_100373216 Ga0068856_1003732161 114
339 3300005616 Ga0068852_100154994 Ga0068852_1001549941 114
340 3300006177 Ga0075362_10230975 Ga0075362_102309752 114
341 3300006237 Ga0097621_100186209 Ga0097621_1001862092 114
342 3300006353 Ga0075370_10685878 Ga0075370_106858782 114
343 3300006358 Ga0068871_101111933 Ga0068871_1011119332 114
344 3300006881 Ga0068865_100465775 Ga0068865_1004657751 114
345 3300009093 Ga0105240_10493651 Ga0105240_104936512 114
346 3300009148 Ga0105243_10000077 Ga0105243_1000007730 114
347 3300009174 Ga0105241_10031269 Ga0105241_100312694 114
348 3300009176 Ga0105242_13041820 Ga0105242_130418202 114
349 3300009177 Ga0105248_10020187 Ga0105248_1002018711 114
350 3300009545 Ga0105237_10176343 Ga0105237_101763432 114
351 3300009545 Ga0105237_10537488 Ga0105237_105374881 114
352 3300009551 Ga0105238_10167642 Ga0105238_101676422 114
353 3300010375 Ga0105239_10265704 Ga0105239_102657042 114
354 3300010375 Ga0105239_13047003 Ga0105239_130470032 114
355 3300012475 Ga0157317_1002649 Ga0157317_10026492 114
356 3300012500 Ga0157314_1010565 Ga0157314_10105652 114
357 3300012503 Ga0157313_1002072 Ga0157313_10020722 114
358 3300013100 Ga0157373_10076123 Ga0157373_100761231 114
359 3300013100 Ga0157373_10093852 Ga0157373_100938521 114
360 3300013100 Ga0157373_11391634 Ga0157373_113916341 114
361 3300013102 Ga0157371_10000376 Ga0157371_1000037618 114
362 3300013104 Ga0157370_10304804 Ga0157370_103048042 114
363 3300013105 Ga0157369_10313250 Ga0157369_103132502 114
364 3300013105 Ga0157369_10313251 Ga0157369_103132512 114
365 3300013296 Ga0157374_10386651 Ga0157374_103866512 114
366 3300014969 Ga0157376_10892582 Ga0157376_108925821 114
367 3300015689 Ga0183360_11696 Ga0183360_116962 114
368 3300015690 Ga0183363_1007 Ga0183363_1007261 114
369 3300025226 Ga0209674_108501 Ga0209674_1085011 114
370 3300025250 Ga0209026_1011925 Ga0209026_10119252 114
371 3300025254 Ga0209148_1000008 Ga0209148_1000008107 114
372 3300025272 Ga0209455_1000002 Ga0209455_10000021318 114
373 3300025297 Ga0209758_1000017 Ga0209758_100001710 114
374 3300025321 Ga0207656_10001313 Ga0207656_100013137 114
375 3300025901 Ga0207688_10052344 Ga0207688_100523442 114
376 3300025904 Ga0207647_10012841 Ga0207647_100128415 114
377 3300025909 Ga0207705_10000175 Ga0207705_1000017537 114
378 3300025911 Ga0207654_10001453 Ga0207654_1000145312 114
379 3300025913 Ga0207695_10007837 Ga0207695_1000783713 114
380 3300025913 Ga0207695_10124923 Ga0207695_101249233 114
381 3300025913 Ga0207695_10514781 Ga0207695_105147812 114
382 3300025914 Ga0207671_10012962 Ga0207671_100129622 114
383 3300025919 Ga0207657_10111605 Ga0207657_101116052 114
384 3300025920 Ga0207649_10000356 Ga0207649_1000035639 114
385 3300025923 Ga0207681_10533001 Ga0207681_105330012 114
386 3300025924 Ga0207694_10032950 Ga0207694_100329502 114
387 3300025925 Ga0207650_10017523 Ga0207650_100175234 114
388 3300025926 Ga0207659_10199359 Ga0207659_101993591 114
389 3300025932 Ga0207690_10000740 Ga0207690_1000074013 114
390 3300025932 Ga0207690_11782033 Ga0207690_117820331 114
391 3300025933 Ga0207706_10157746 Ga0207706_101577462 114
392 3300025935 Ga0207709_10000110 Ga0207709_1000011097 114
393 3300025937 Ga0207669_10000180 Ga0207669_1000018032 114
394 3300025937 Ga0207669_10004008 Ga0207669_100040085 114
395 3300025940 Ga0207691_10237993 Ga0207691_102379932 114
396 3300025945 Ga0207679_10248378 Ga0207679_102483782 114
397 3300025949 Ga0207667_10000006 Ga0207667_10000006191 114
398 3300025972 Ga0207668_10167392 Ga0207668_101673922 114
399 3300025986 Ga0207658_10093098 Ga0207658_100930982 114
400 3300026023 Ga0207677_10079560 Ga0207677_100795601 114
401 3300026041 Ga0207639_10006283 Ga0207639_100062835 114
402 3300026067 Ga0207678_10026444 Ga0207678_100264445 114
403 3300026067 Ga0207678_11341710 Ga0207678_113417102 114
404 3300026078 Ga0207702_10009788 Ga0207702_100097885 114
405 3300026078 Ga0207702_10277187 Ga0207702_102771872 114
406 3300026089 Ga0207648_10056611 Ga0207648_100566112 114
407 3300026116 Ga0207674_10095289 Ga0207674_100952892 114
408 3300026121 Ga0207683_10002356 Ga0207683_100023566 114
409 3300026142 Ga0207698_10118919 Ga0207698_101189191 114
410 3300028786 Ga0307517_10010535 Ga0307517_100105358 114
411 3300033180 Ga0307510_10034976 Ga0307510_100349763 114
412 3300041512 Ga0451853_0928386 Ga0451853_0928386_386_754 114
413 3300042005 Ga0439448_0082116 Ga0439448_0082116_285_653 114
414 3300046460 Ga0495638_0149484 Ga0495638_0149484_453_821 114
415 3300046471 Ga0495650_0000364 Ga0495650_0000364_15044_15412 114
416 3300046491 Ga0495584_0031870 Ga0495584_0031870_622_990 114
417 3300046491 Ga0495584_0032605 Ga0495584_0032605_529_897 114
418 3300046492 Ga0495585_0059085 Ga0495585_0059085_95_463 114
419 3300046492 Ga0495585_0087333 Ga0495585_0087333_431_799 114
420 3300046500 Ga0495596_0011775 Ga0495596_0011775_854_1222 114
421 3300046506 Ga0495583_0000311 Ga0495583_0000311_71536_71904 114
422 3300046506 Ga0495583_0009032 Ga0495583_0009032_3801_4169 114
423 3300046507 Ga0495606_0000071 Ga0495606_0000071_11696_12064 114
424 3300046507 Ga0495606_0009784 Ga0495606_0009784_1662_2030 114
425 3300046513 Ga0495616_0109386 Ga0495616_0109386_37_405 114
426 3300046520 Ga0495637_0013302 Ga0495637_0013302_3378_3746 114
427 3300046522 Ga0495643_0005960 Ga0495643_0005960_685_1053 114
428 3300046524 Ga0495648_0004148 Ga0495648_0004148_1900_2268 114
429 3300046525 Ga0495663_0024185 Ga0495663_0024185_897_1265 114
430 3300046528 Ga0495642_0002920 Ga0495642_0002920_4463_4831 114
431 3300046530 Ga0495654_0173140 Ga0495654_0173140_247_615 114
432 3300046538 Ga0495609_0116761 Ga0495609_0116761_504_872 114
433 3300046557 Ga0495622_0064688 Ga0495622_0064688_229_597 114
434 3300046558 Ga0495633_0015197 Ga0495633_0015197_2276_2644 114
435 3300046558 Ga0495633_0091476 Ga0495633_0091476_244_612 114
436 3300046616 Ga0495668_0000335 Ga0495668_0000335_21679_22047 114
437 3300046648 Ga0495611_0011045 Ga0495611_0011045_2174_2542 114
438 3300046660 Ga0495625_0000212 Ga0495625_0000212_82100_82468 114
439 3300046660 Ga0495625_0032342 Ga0495625_0032342_1802_2170 114
440 3300046660 Ga0495625_0104248 Ga0495625_0104248_158_526 114
441 3300046660 Ga0495625_0121079 Ga0495625_0121079_459_827 114
442 3300046665 Ga0495661_0378506 Ga0495661_0378506_100_468 114
443 3300046684 Ga0495669_0000016 Ga0495669_0000016_22276_22644 114
444 3300046689 Ga0495613_0210665 Ga0495613_0210665_956_1324 114
445 3300046691 Ga0495670_0166050 Ga0495670_0166050_423_791 114
446 3300046692 Ga0495671_0646683 Ga0495671_0646683_25_393 114
447 3300046694 Ga0495649_0045366 Ga0495649_0045366_240_608 114
448 3300046809 Ga0495600_0341717 Ga0495600_0341717_486_854 114
449 3300046810 Ga0495660_0100344 Ga0495660_0100344_287_655 114
450 3300047317 Ga0495604_0968883 Ga0495604_0968883_83_451 114
451 3300047323 Ga0495683_0015856 Ga0495683_0015856_2258_2626 114
452 3300047443 Ga0495687_000076 Ga0495687_000076_136645_137013 114
453 3300047443 Ga0495687_007447 Ga0495687_007447_2545_2913 114
454 3300047445 Ga0495677_0012258 Ga0495677_0012258_1540_1908 114
455 3300047447 Ga0495685_082289 Ga0495685_082289_402_770 114
456 3300047469 Ga0495673_0066082 Ga0495673_0066082_802_1170 114
457 3300047470 Ga0495681_0011962 Ga0495681_0011962_4544_4912 114
458 3300048904 Ga0496101_0448668 Ga0496101_0448668_628_996 114
459 3300048905 Ga0496102_0000218 Ga0496102_0000218_18859_19227 114
460 3300048906 Ga0496103_0000045 Ga0496103_0000045_58279_58647 114
461 3300048906 Ga0496103_0952809 Ga0496103_0952809_145_504 114
462 3300048907 Ga0496104_0061903 Ga0496104_0061903_2974_3342 114
463 3300048908 Ga0496105_0000559 Ga0496105_0000559_3590_3958 114
464 3300048912 Ga0496109_0048777 Ga0496109_0048777_1310_1678 114
465 3300048914 Ga0496111_0004043 Ga0496111_0004043_2287_2655 114
466 3300048915 Ga0496112_0195922 Ga0496112_0195922_995_1363 114
467 3300048917 Ga0496114_0015728 Ga0496114_0015728_2777_3145 114
468 3300048918 Ga0496115_0000136 Ga0496115_0000136_9477_9845 114
469 3300048919 Ga0496116_0001537 Ga0496116_0001537_19629_19997 114
470 3300048920 Ga0496117_0000046 Ga0496117_0000046_217081_217449 114
471 3300048921 Ga0496118_0000036 Ga0496118_0000036_83431_83799 114
472 3300048922 Ga0496119_0016658 Ga0496119_0016658_1631_1999 114
473 3300048923 Ga0496120_0012993 Ga0496120_0012993_395_763 114
474 3300048924 Ga0496121_0000163 Ga0496121_0000163_31116_31475 114
475 3300048924 Ga0496121_0000267 Ga0496121_0000267_56683_57051 114
476 3300048925 Ga0496122_0030656 Ga0496122_0030656_1190_1558 114
477 3300048926 Ga0496123_0008373 Ga0496123_0008373_3547_3915 114
478 3300048927 Ga0496124_0000011 Ga0496124_0000011_370316_370684 114
479 3300048928 Ga0496125_0000919 Ga0496125_0000919_27393_27761 114
480 3300048929 Ga0496126_0000440 Ga0496126_0000440_25710_26078 114
481 3300050493 nmdc:mga0k408_680189_c1 nmdc:mga0k408_680189_c1_32_400 114
482 3300053079 Ga0500610_0000177 Ga0500610_0000177_13923_14291 114
483 3300053092 Ga0500583_0471968 Ga0500583_0471968_91_459 114
484 3300053096 Ga0500641_0022767 Ga0500641_0022767_1635_1997 114
485 3300053119 Ga0500595_003380 Ga0500595_003380_3533_3901 114
486 3300053130 Ga0500642_0000820 Ga0500642_0000820_7691_8059 114
487 3300053134 Ga0500658_0003978 Ga0500658_0003978_990_1361 114
488 3300053154 Ga0500619_002987 Ga0500619_002987_2119_2487 114
489 3300053177 Ga0500636_0005235 Ga0500636_0005235_3514_3882 114
490 3300053730 Ga0500645_000003 Ga0500645_000003_238802_239170 114
491 3300053731 Ga0500609_005248 Ga0500609_005248_522_890 114
492 3300053735 Ga0500596_000564 Ga0500596_000564_3074_3442 114
493 3300055283 Ga0500661_015226 Ga0500661_015226_47_415 114
494 iso_pu_bacteria 2928027323 2928028850 114
495 iso_pu_bacteria 2984555340 2984556388 114
496 iso_pu_bacteria 2984564862 2984565423 114
497 iso_pu_bacteria 2993356040 2993356515 114
498 3300005329 Ga0070683_101048199 Ga0070683_1010481991 115
499 3300025944 Ga0207661_11576007 Ga0207661_115760072 115
500 3300039437 Ga0436365_1719205 Ga0436365_1719205_981_1340 115
501 3300042438 Ga0439459_0198010 Ga0439459_0198010_45_416 115
502 3300048918 Ga0496115_0000310 Ga0496115_0000310_24401_24766 115
503 3300053104 Ga0500556_0023742 Ga0500556_0023742_1601_1963 115
504 3300053730 Ga0500645_004247 Ga0500645_004247_4400_4762 115
505 3300000041 ARcpr5oldR_c014582 ARcpr5oldR_0145822 116
506 3300000043 ARcpr5yngRDRAFT_c001077 ARcpr5yngRDRAFT_0010772 116
507 3300000652 ARCol0yngRDRAFT_1015786 ARCol0yngRDRAFT_10157862 116
508 3300002774 JGI25150J39212_1000135 JGI25150J39212_100013522 116
509 3300003187 JGI25151J46595_10063231 JGI25151J46595_100632312 116
510 3300003215 JGI25153J46596_10000073 JGI25153J46596_1000007393 116
511 3300003215 JGI25153J46596_10004475 JGI25153J46596_100044752 116
512 3300003773 Ga0055537_1000896 Ga0055537_10008963 116
513 3300003775 Ga0055524_1000244 Ga0055524_100024422 116
514 3300003790 Ga0055528_1034524 Ga0055528_10345242 116
515 3300003791 Ga0055530_10014066 Ga0055530_100140662 116
516 3300003794 Ga0055531_10001111 Ga0055531_100011117 116
517 3300004625 Ga0055543_1007973 Ga0055543_10079732 116
518 3300005262 Ga0065165_1007527 Ga0065165_10075273 116
519 3300005618 Ga0068864_100000512 Ga0068864_10000051238 116
520 3300005719 Ga0068861_100132553 Ga0068861_1001325532 116
521 3300006353 Ga0075370_10032663 Ga0075370_100326633 116
522 3300009553 Ga0105249_10664199 Ga0105249_106641992 116
523 3300013306 Ga0163162_10002879 Ga0163162_100028792 116
524 3300013306 Ga0163162_10138830 Ga0163162_101388302 116
525 3300025245 Ga0207425_1000005 Ga0207425_1000005727 116
526 3300025245 Ga0207425_1021754 Ga0207425_10217542 116
527 3300025258 Ga0209129_1003733 Ga0209129_10037334 116
528 3300025263 Ga0209565_1000029 Ga0209565_100002990 116
529 3300025273 Ga0209673_1003715 Ga0209673_10037154 116
530 3300025291 Ga0209675_1020012 Ga0209675_10200122 116
531 3300025294 Ga0209025_1000477 Ga0209025_100047712 116
532 3300025295 Ga0209564_1035825 Ga0209564_10358252 116
533 3300025297 Ga0209758_1000002 Ga0209758_1000002618 116
534 3300025297 Ga0209758_1008577 Ga0209758_10085772 116
535 3300025298 Ga0209050_1002327 Ga0209050_10023272 116
536 3300025299 Ga0209256_1000008 Ga0209256_1000008699 116
537 3300025304 Ga0209257_1002435 Ga0209257_10024354 116
538 3300025304 Ga0209257_1031355 Ga0209257_10313552 116
539 3300025315 Ga0207697_10029816 Ga0207697_100298162 116
540 3300026095 Ga0207676_10000462 Ga0207676_100004625 116
541 3300026118 Ga0207675_100173025 Ga0207675_1001730252 116
542 3300031456 Ga0307513_10013397 Ga0307513_100133975 116
543 3300031995 Ga0307409_100236548 Ga0307409_1002365481 116
544 3300033180 Ga0307510_10002511 Ga0307510_1000251119 116
545 3300041407 Ga0439447_171077 Ga0439447_171077_113_463 116
546 3300041410 Ga0439461_0000016 Ga0439461_0000016_4700_5050 116
547 3300041410 Ga0439461_0024660 Ga0439461_0024660_18_368 116
548 3300041411 Ga0439466_0043324 Ga0439466_0043324_943_1293 116
549 3300041413 Ga0439465_0000383 Ga0439465_0000383_3423_3773 116
550 3300041999 Ga0439433_0151568 Ga0439433_0151568_125_475 116
551 3300042004 Ga0439445_0000596 Ga0439445_0000596_4013_4363 116
552 3300042006 Ga0439432_025619 Ga0439432_025619_888_1238 116
553 3300042007 Ga0439449_0226626 Ga0439449_0226626_307_657 116
554 3300042010 Ga0439452_047965 Ga0439452_047965_239_589 116
555 3300042015 Ga0439462_0011139 Ga0439462_0011139_1025_1375 116
556 3300042127 Ga0450890_006555 Ga0450890_006555_46_396 116
557 3300042435 Ga0439434_0000681 Ga0439434_0000681_6695_7045 116
558 3300046453 Ga0495627_016344 Ga0495627_016344_748_1098 116
559 3300046506 Ga0495583_0006357 Ga0495583_0006357_3382_3759 116
560 3300046524 Ga0495648_0011503 Ga0495648_0011503_3248_3625 116
561 3300046616 Ga0495668_0004587 Ga0495668_0004587_2739_3116 116
562 3300046660 Ga0495625_0012733 Ga0495625_0012733_6286_6663 116
563 3300046691 Ga0495670_0234624 Ga0495670_0234624_510_887 116
564 3300046810 Ga0495660_0404959 Ga0495660_0404959_100_477 116
565 3300047445 Ga0495677_0002869 Ga0495677_0002869_1423_1800 116
566 3300047470 Ga0495681_0012432 Ga0495681_0012432_929_1279 116
567 3300048906 Ga0496103_0286144 Ga0496103_0286144_258_629 116
568 3300048928 Ga0496125_0244802 Ga0496125_0244802_611_961 116
569 3300049758 Ga0501241_020003 Ga0501241_020003_698_1048 116
570 3300049760 Ga0501263_033744 Ga0501263_033744_113_463 116
571 3300053087 Ga0500643_004388 Ga0500643_004388_3631_4008 116
572 3300053087 Ga0500643_019936 Ga0500643_019936_853_1203 116
573 3300053094 Ga0500566_0000390 Ga0500566_0000390_1236_1586 116
574 3300053128 Ga0500626_070579 Ga0500626_070579_844_1194 116
575 3300053131 Ga0500652_094110 Ga0500652_094110_115_492 116
576 3300053134 Ga0500658_0050036 Ga0500658_0050036_907_1257 116
577 3300053136 Ga0500559_0051515 Ga0500559_0051515_386_763 116
578 3300053136 Ga0500559_0221315 Ga0500559_0221315_179_529 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

36

125

0.94

Feature Viewer

pLDDT pTM Quality
66.2 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map