F465709

General Info

Members Datasets Scaffolds Average Seq Length
578 306 574 68

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100822873|Ga0068864_1008228733
Length 81
Sequence MKAADIRLMTSDQQVEEIDRLKKEQFNLRFQRASGQLENTARVRQVRRDIARLTTIASQDAKKPKTAAPAKAAPKKKTKGK

Samples

Sample ID Description Type Environment
1 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
2 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
236 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
237 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
266 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
267 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
268 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
269 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
270 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
305 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
306 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.97
Metatranscriptomes 9.34
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0.87
Rhizoplane 3.11
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000961 3300003214 Bacteria 19619
2 JGI25405J52794_10041760 3300003911 Bacteria 971
3 Ga0065704_10114286 3300005289 Bacteria 1894
4 Ga0070680_100099273 3300005336 Bacteria 2416
5 Ga0070680_100254677 3300005336 Bacteria 1485
6 Ga0070680_100552650 3300005336 Bacteria 987
7 Ga0070680_101985014 3300005336 Bacteria 504
8 Ga0070689_101321229 3300005340 Bacteria 650
9 Ga0070692_10860787 3300005345 Bacteria 624
10 Ga0070668_101457376 3300005347 Bacteria 625
11 Ga0070668_102099616 3300005347 Bacteria 522
12 Ga0070705_100586427 3300005440 Bacteria 860
13 Ga0070663_100001615 3300005455 Bacteria 12447
14 Ga0070678_100961198 3300005456 Bacteria 783
15 Ga0070681_10238328 3300005458 Bacteria 1733
16 Ga0070681_10666110 3300005458 Bacteria 956
17 Ga0070681_10810161 3300005458 Bacteria 854
18 Ga0070681_11291366 3300005458 Bacteria 653
19 Ga0070698_101707381 3300005471 Bacteria 582
20 Ga0070679_100049286 3300005530 Bacteria 4194
21 Ga0068853_100013375 3300005539 Bacteria 6698
22 Ga0070695_100893997 3300005545 Bacteria 717
23 Ga0070693_101108505 3300005547 Bacteria 604
24 Ga0070665_100006166 3300005548 Bacteria 12264
25 Ga0070665_100319540 3300005548 Bacteria 1557
26 Ga0070665_101021496 3300005548 Bacteria 839
27 Ga0070665_102085774 3300005548 Bacteria 572
28 Ga0070704_101816982 3300005549 Bacteria 564
29 Ga0068856_100200510 3300005614 Bacteria 2010
30 Ga0068864_100822873 3300005618 Bacteria 914
31 Ga0068864_101815125 3300005618 Bacteria 615
32 Ga0068861_101161149 3300005719 Bacteria 745
33 Ga0068861_102240121 3300005719 Bacteria 548
34 Ga0068862_100749614 3300005844 Bacteria 950
35 Ga0068862_100988724 3300005844 Bacteria 831
36 Ga0068862_101214985 3300005844 Bacteria 753
37 Ga0068862_101379067 3300005844 Bacteria 708
38 Ga0081455_10001008 3300005937 Bacteria 35646
39 Ga0081455_10019145 3300005937 Bacteria 6487
40 Ga0081538_10003741 3300005981 Bacteria 14245
41 Ga0081538_10043084 3300005981 Bacteria 2840
42 Ga0081538_10152960 3300005981 Bacteria 1041
43 Ga0081540_1008438 3300005983 Bacteria 7199
44 Ga0081540_1043521 3300005983 Bacteria 2302
45 Ga0075365_10210208 3300006038 Bacteria 1364
46 Ga0075365_10431230 3300006038 Bacteria 931
47 Ga0075363_100397590 3300006048 Bacteria 809
48 Ga0075364_10067532 3300006051 Bacteria 2350
49 Ga0075364_10359037 3300006051 Bacteria 993
50 Ga0075364_10517391 3300006051 Bacteria 816
51 Ga0075432_10376983 3300006058 Bacteria 607
52 Ga0075367_10314485 3300006178 Bacteria 986
53 Ga0075367_10323469 3300006178 Bacteria 972
54 Ga0075369_10048331 3300006186 Bacteria 1836
55 Ga0075369_10423656 3300006186 Bacteria 629
56 Ga0075366_10042037 3300006195 Bacteria 2706
57 Ga0075366_10316635 3300006195 Bacteria 955
58 Ga0097621_101991995 3300006237 Bacteria 555
59 Ga0075430_100740905 3300006846 Bacteria 810
60 Ga0075430_101707119 3300006846 Bacteria 517
61 Ga0075431_100769041 3300006847 Bacteria 938
62 Ga0075431_101131764 3300006847 Bacteria 747
63 Ga0075433_10418300 3300006852 Bacteria 1182
64 Ga0075434_100237438 3300006871 Bacteria 1843
65 Ga0075434_100252710 3300006871 Bacteria 1782
66 Ga0075429_100197579 3300006880 Bacteria 1762
67 Ga0075436_101365257 3300006914 Bacteria 537
68 Ga0079104_1000547 3300006946 Bacteria 39191
69 Ga0075435_100763996 3300007076 Bacteria 841
70 Ga0075435_101374118 3300007076 Bacteria 619
71 Ga0105250_10572582 3300009092 Bacteria 520
72 Ga0111539_10092029 3300009094 Bacteria 3563
73 Ga0111539_10682184 3300009094 Bacteria 1196
74 Ga0105245_10327906 3300009098 Bacteria 1510
75 Ga0114129_10079719 3300009147 Bacteria 4552
76 Ga0114129_10778840 3300009147 Bacteria 1222
77 Ga0105243_11232115 3300009148 Bacteria 763
78 Ga0105243_11721412 3300009148 Bacteria 656
79 Ga0105243_12682766 3300009148 Bacteria 538
80 Ga0105248_10723019 3300009177 Bacteria 1123
81 Ga0105248_10983695 3300009177 Bacteria 953
82 Ga0105237_10586873 3300009545 Bacteria 1121
83 Ga0105237_10747504 3300009545 Bacteria 984
84 Ga0105237_10822763 3300009545 Bacteria 935
85 Ga0105238_12377522 3300009551 Bacteria 565
86 Ga0105249_10014071 3300009553 Bacteria 7073
87 Ga0105249_10410828 3300009553 Bacteria 1386
88 Ga0105249_11347390 3300009553 Bacteria 785
89 Ga0105249_11425620 3300009553 Bacteria 765
90 Ga0105249_12411574 3300009553 Bacteria 599
91 Ga0105249_13431225 3300009553 Bacteria 510
92 Ga0105030_128379 3300009987 Bacteria 517
93 Ga0105028_109128 3300009993 Bacteria 1038
94 Ga0099796_10576206 3300010159 Bacteria 507
95 Ga0105239_10984974 3300010375 Bacteria 969
96 Ga0105239_12407305 3300010375 Bacteria 613
97 Ga0157347_1037009 3300012502 Bacteria 632
98 Ga0157373_11139525 3300013100 Bacteria 586
99 Ga0157369_11151176 3300013105 Bacteria 792
100 Ga0157374_11492341 3300013296 Bacteria 699
101 Ga0157378_10464731 3300013297 Bacteria 1258
102 Ga0157378_10639748 3300013297 Bacteria 1078
103 Ga0163163_11740043 3300014325 Bacteria 684
104 Ga0157380_10310935 3300014326 Bacteria 1456
105 Ga0157380_10398047 3300014326 Bacteria 1306
106 Ga0182008_10408056 3300014497 Bacteria 731
107 Ga0182005_1002173 3300015265 Bacteria 7236
108 Ga0206350_10535392 3300020080 Bacteria 534
109 Ga0206353_11323013 3300020082 Bacteria 1333
110 Ga0209025_1041276 3300025294 Bacteria 1979
111 Ga0207707_10357488 3300025912 Bacteria 1258
112 Ga0207707_10863067 3300025912 Bacteria 750
113 Ga0207662_11096961 3300025918 Bacteria 566
114 Ga0207681_10084218 3300025923 Bacteria 2253
115 Ga0207694_11678532 3300025924 Bacteria 535
116 Ga0207659_11027428 3300025926 Bacteria 709
117 Ga0207687_10977447 3300025927 Bacteria 726
118 Ga0207709_10969606 3300025935 Bacteria 694
119 Ga0207709_11043522 3300025935 Bacteria 669
120 Ga0207670_10553176 3300025936 Bacteria 940
121 Ga0207711_10140909 3300025941 Bacteria 2169
122 Ga0207711_11132271 3300025941 Bacteria 724
123 Ga0207712_10273112 3300025961 Bacteria 1376
124 Ga0207712_11127724 3300025961 Bacteria 699
125 Ga0207668_10714327 3300025972 Bacteria 882
126 Ga0207668_10917752 3300025972 Bacteria 780
127 Ga0207668_11307576 3300025972 Bacteria 653
128 Ga0207678_10548627 3300026067 Bacteria 1011
129 Ga0207678_11372282 3300026067 Bacteria 625
130 Ga0207708_11768763 3300026075 Bacteria 542
131 Ga0207675_101467341 3300026118 Bacteria 703
132 Ga0207675_101592654 3300026118 Bacteria 674
133 Ga0207683_10815670 3300026121 Bacteria 866
134 Ga0209281_1000573 3300027111 Bacteria 43668
135 Ga0209179_1030741 3300027512 Bacteria 1099
136 Ga0209813_10225347 3300027866 Bacteria 703
137 Ga0209974_10185273 3300027876 Bacteria 764
138 Ga0209974_10210068 3300027876 Bacteria 721
139 Ga0209974_10258863 3300027876 Bacteria 657
140 Ga0207428_10020203 3300027907 Bacteria 5663
141 Ga0207428_10185324 3300027907 Bacteria 1571
142 Ga0268266_10036033 3300028379 Bacteria 4209
143 Ga0265318_10015702 3300028577 Bacteria 3142
144 Ga0265318_10361672 3300028577 Bacteria 530
145 Ga0307515_10058447 3300028794 Bacteria 5553
146 Ga0265338_10609169 3300028800 Bacteria 760
147 Ga0265338_11085278 3300028800 Bacteria 540
148 Ga0265324_10220715 3300029957 Bacteria 644
149 Ga0314311_1193439 3300030733 Bacteria 619
150 Ga0265760_10077843 3300031090 Bacteria 1024
151 Ga0265330_10125296 3300031235 Bacteria 1094
152 Ga0265328_10009346 3300031239 Bacteria 3996
153 Ga0265328_10407638 3300031239 Bacteria 534
154 Ga0265320_10357585 3300031240 Bacteria 645
155 Ga0265320_10551472 3300031240 Bacteria 510
156 Ga0265325_10016753 3300031241 Bacteria 4090
157 Ga0265325_10196517 3300031241 Bacteria 932
158 Ga0265329_10024967 3300031242 Bacteria 1981
159 Ga0265329_10185270 3300031242 Bacteria 682
160 Ga0265340_10045117 3300031247 Bacteria 2154
161 Ga0265340_10065829 3300031247 Bacteria 1725
162 Ga0265340_10097663 3300031247 Bacteria 1367
163 Ga0265340_10398266 3300031247 Bacteria 607
164 Ga0265339_10002105 3300031249 Bacteria 14517
165 Ga0265339_10045403 3300031249 Bacteria 2418
166 Ga0265339_10074118 3300031249 Bacteria 1809
167 Ga0265339_10085133 3300031249 Bacteria 1665
168 Ga0265339_10150396 3300031249 Bacteria 1178
169 Ga0265339_10436794 3300031249 Bacteria 609
170 Ga0265331_10037674 3300031250 Bacteria 2366
171 Ga0265331_10087123 3300031250 Bacteria 1446
172 Ga0265316_10015933 3300031344 Bacteria 6544
173 Ga0265316_10030464 3300031344 Bacteria 4422
174 Ga0265316_10407169 3300031344 Bacteria 979
175 Ga0265316_10561013 3300031344 Bacteria 812
176 Ga0265316_10883304 3300031344 Bacteria 625
177 Ga0307408_101310200 3300031548 Bacteria 679
178 Ga0265313_10000031 3300031595 Bacteria 128981
179 Ga0265313_10052060 3300031595 Bacteria 1956
180 Ga0265313_10053734 3300031595 Bacteria 1916
181 Ga0265313_10273582 3300031595 Bacteria 684
182 Ga0265313_10275639 3300031595 Bacteria 680
183 Ga0265313_10419109 3300031595 Bacteria 523
184 Ga0265314_10008857 3300031711 Bacteria 8590
185 Ga0265314_10028299 3300031711 Bacteria 4180
186 Ga0265314_10398931 3300031711 Bacteria 744
187 Ga0265314_10458770 3300031711 Bacteria 677
188 Ga0265314_10700573 3300031711 Bacteria 512
189 Ga0265342_10004137 3300031712 Bacteria 11550
190 Ga0265342_10038280 3300031712 Bacteria 2921
191 Ga0265342_10078306 3300031712 Bacteria 1913
192 Ga0265342_10357588 3300031712 Bacteria 759
193 Ga0265342_10587936 3300031712 Bacteria 562
194 Ga0307405_10536335 3300031731 Bacteria 944
195 Ga0307413_10302467 3300031824 Bacteria 1213
196 Ga0307413_11325543 3300031824 Bacteria 631
197 Ga0307410_11695408 3300031852 Bacteria 560
198 Ga0307410_11938016 3300031852 Bacteria 525
199 Ga0307406_10268077 3300031901 Bacteria 1296
200 Ga0307406_10614112 3300031901 Bacteria 898
201 Ga0307407_11472189 3300031903 Bacteria 538
202 Ga0307412_10813782 3300031911 Bacteria 812
203 Ga0307409_100224075 3300031995 Bacteria 1700
204 Ga0307409_100227836 3300031995 Bacteria 1687
205 Ga0307409_100472547 3300031995 Bacteria 1215
206 Ga0307409_101958854 3300031995 Bacteria 615
207 Ga0307416_100537909 3300032002 Bacteria 1240
208 Ga0307416_101625458 3300032002 Bacteria 751
209 Ga0307416_102505778 3300032002 Bacteria 614
210 Ga0307416_103492446 3300032002 Bacteria 526
211 Ga0307414_10741124 3300032004 Bacteria 892
212 Ga0307411_11316798 3300032005 Bacteria 659
213 Ga0307415_100377700 3300032126 Bacteria 1202
214 Ga0307415_100611652 3300032126 Bacteria 971
215 Ga0307415_100898907 3300032126 Bacteria 816
216 Ga0316593_10001189 3300032168 Bacteria 5568
217 Ga0316596_1011427 3300033541 Bacteria 2169
218 Ga0373944_0089856 3300035089 Bacteria 1025
219 Ga0373932_0289120 3300035112 Bacteria 608
220 Ga0373945_0173574 3300035116 Bacteria 884
221 Ga0373956_0610592 3300035119 Bacteria 521
222 Ga0373931_0213407 3300035691 Bacteria 1159
223 Ga0373931_0284553 3300035691 Bacteria 1016
224 Ga0373931_0306281 3300035691 Bacteria 982
225 Ga0373935_0254180 3300035692 Bacteria 1230
226 Ga0373947_0085526 3300035725 Bacteria 1959
227 Ga0373925_0144587 3300037068 Bacteria 1863
228 Ga0395899_0000073 3300037312 Bacteria 181387
229 Ga0395900_0000027 3300037418 Bacteria 285957
230 Ga0395898_0000255 3300037466 Bacteria 131017
231 Ga0395905_0000032 3300037471 Bacteria 285932
232 Ga0436364_0607066 3300037853 Bacteria 517
233 Ga0395901_0000110 3300038443 Bacteria 112682
234 Ga0400483_059010 3300039062 Bacteria 5318
235 Ga0400483_165422 3300039062 Bacteria 6949
236 Ga0400483_217885 3300039062 Bacteria 12374
237 Ga0400483_243738 3300039062 Bacteria 5430
238 Ga0400483_281008 3300039062 Bacteria 2348
239 Ga0436365_0527365 3300039437 Bacteria 739
240 Ga0436360_0566130 3300039438 Bacteria 781
241 Ga0436360_0590269 3300039438 Bacteria 513
242 Ga0436363_1377737 3300039450 Unclassified 556
243 Ga0436362_0004730 3300039453 Bacteria 1043
244 Ga0439465_0119634 3300041413 Bacteria 922
245 Ga0451802_1457526 3300041460 Bacteria 535
246 Ga0451833_1093358 3300041491 Bacteria 597
247 Ga0451855_0574687 3300041511 Bacteria 786
248 Ga0439431_0103480 3300041997 Bacteria 784
249 Ga0439432_032485 3300042006 Bacteria 1683
250 Ga0439449_0092967 3300042007 Bacteria 1114
251 Ga0439456_070050 3300042013 Bacteria 777
252 Ga0439462_0152722 3300042015 Bacteria 649
253 Ga0439434_0254475 3300042435 Bacteria 601
254 Ga0466963_0250593 3300044694 Bacteria 1243
255 Ga0466967_1115804 3300045976 Bacteria 786
256 Ga0495603_0312515 3300046455 Bacteria 902
257 Ga0495638_0006964 3300046460 Bacteria 8163
258 Ga0495638_0040593 3300046460 Bacteria 2948
259 Ga0495638_0118029 3300046460 Bacteria 1570
260 Ga0495638_0240762 3300046460 Bacteria 1002
261 Ga0495605_0476168 3300046474 Bacteria 512
262 Ga0495639_0214279 3300046475 Bacteria 945
263 Ga0495584_0188772 3300046491 Bacteria 1047
264 Ga0495610_0018183 3300046512 Bacteria 3978
265 Ga0495643_0103412 3300046522 Bacteria 1457
266 Ga0495643_0120493 3300046522 Bacteria 1326
267 Ga0495597_0190693 3300046542 Bacteria 825
268 Ga0495656_0105356 3300046615 Bacteria 1311
269 Ga0495656_0517149 3300046615 Bacteria 634
270 Ga0495611_0467739 3300046648 Bacteria 574
271 Ga0495625_0084671 3300046660 Bacteria 2202
272 Ga0495625_0292882 3300046660 Bacteria 1044
273 Ga0495625_0294702 3300046660 Bacteria 1040
274 Ga0495625_0659591 3300046660 Bacteria 622
275 Ga0495669_0572117 3300046684 Bacteria 550
276 Ga0495670_0071023 3300046691 Bacteria 1762
277 Ga0495671_0122761 3300046692 Bacteria 1267
278 Ga0495649_0291237 3300046694 Bacteria 833
279 Ga0495589_0221442 3300046794 Bacteria 889
280 Ga0495660_0497900 3300046810 Bacteria 521
281 Ga0495636_0461249 3300047318 Bacteria 611
282 Ga0495672_0117241 3300047320 Bacteria 1421
283 Ga0495672_0303828 3300047320 Bacteria 755
284 Ga0495673_0135193 3300047469 Bacteria 966
285 Ga0495686_0189107 3300047472 Bacteria 1188
286 Ga0495593_0401814 3300047673 Bacteria 685
287 Ga0496101_0010556 3300048904 Bacteria 6102
288 Ga0496101_0659266 3300048904 Bacteria 827
289 Ga0496101_1458155 3300048904 Bacteria 533
290 Ga0496102_0426059 3300048905 Bacteria 1246
291 Ga0496102_1551203 3300048905 Bacteria 581
292 Ga0496104_0070384 3300048907 Bacteria 3325
293 Ga0496104_0564312 3300048907 Bacteria 1049
294 Ga0496105_0005504 3300048908 Bacteria 9611
295 Ga0496108_0129057 3300048911 Bacteria 2172
296 Ga0496109_0294169 3300048912 Bacteria 1531
297 Ga0496110_0008141 3300048913 Bacteria 8422
298 Ga0496111_0023962 3300048914 Bacteria 4291
299 Ga0496112_0034695 3300048915 Bacteria 4910
300 Ga0496113_0004259 3300048916 Bacteria 8765
301 Ga0496114_0445680 3300048917 Bacteria 1146
302 Ga0496114_1602423 3300048917 Bacteria 539
303 Ga0496115_0878597 3300048918 Bacteria 692
304 Ga0496119_0000372 3300048922 Bacteria 62094
305 Ga0496119_0004353 3300048922 Bacteria 14129
306 Ga0496119_0019758 3300048922 Bacteria 4942
307 Ga0496120_0099786 3300048923 Bacteria 1536
308 Ga0496120_0184638 3300048923 Bacteria 1021
309 Ga0496121_0246048 3300048924 Bacteria 1243
310 Ga0496121_0459977 3300048924 Bacteria 818
311 Ga0496122_0135780 3300048925 Bacteria 1550
312 Ga0496123_0017503 3300048926 Bacteria 5761
313 Ga0496123_0502510 3300048926 Bacteria 529
314 Ga0496124_0698119 3300048927 Bacteria 644
315 Ga0496124_0707630 3300048927 Bacteria 637
316 Ga0496125_0017448 3300048928 Bacteria 6842
317 Ga0496125_0064883 3300048928 Bacteria 2897
318 Ga0496126_0344898 3300048929 Bacteria 1219
319 Ga0501306_000381 3300049127 Bacteria 3282
320 Ga0501308_001458 3300049128 Bacteria 1896
321 Ga0501308_002805 3300049128 Bacteria 1562
322 Ga0501310_018342 3300049130 Bacteria 853
323 Ga0501310_033789 3300049130 Bacteria 689
324 Ga0501310_080386 3300049130 Bacteria 511
325 Ga0501304_004606 3300049160 Bacteria 1052
326 Ga0501304_011395 3300049160 Bacteria 790
327 Ga0501305_001751 3300049161 Bacteria 2205
328 Ga0501305_018020 3300049161 Bacteria 1019
329 Ga0501307_000876 3300049162 Bacteria 2303
330 Ga0501307_017944 3300049162 Bacteria 895
331 Ga0501311_002631 3300049527 Bacteria 1743
332 Ga0501312_053243 3300049528 Bacteria 687
333 Ga0501313_001406 3300049529 Bacteria 2081
334 Ga0501313_003461 3300049529 Bacteria 1571
335 Ga0501314_001822 3300049530 Bacteria 1586
336 Ga0501314_023558 3300049530 Bacteria 653
337 Ga0501314_031084 3300049530 Bacteria 594
338 Ga0501315_000060 3300049531 Bacteria 4828
339 Ga0501315_023393 3300049531 Bacteria 848
340 Ga0501317_025997 3300049533 Bacteria 823
341 Ga0501317_026503 3300049533 Bacteria 818
342 Ga0501317_059311 3300049533 Bacteria 625
343 Ga0501318_085348 3300049534 Bacteria 517
344 Ga0501320_003890 3300049536 Bacteria 1290
345 Ga0501335_001588 3300049551 Bacteria 1759
346 Ga0501031_0000651 3300049568 Bacteria 20547
347 Ga0501031_0016670 3300049568 Bacteria 4771
348 Ga0501031_0359462 3300049568 Bacteria 942
349 Ga0501032_0000111 3300049569 Bacteria 69802
350 Ga0501032_0119107 3300049569 Bacteria 1746
351 Ga0501032_0188536 3300049569 Bacteria 1348
352 Ga0501032_0305998 3300049569 Bacteria 1027
353 Ga0501032_0319352 3300049569 Bacteria 1002
354 Ga0501032_0552056 3300049569 Bacteria 734
355 Ga0501033_0011172 3300049570 Bacteria 6877
356 Ga0501033_0059135 3300049570 Bacteria 2830
357 Ga0501033_0139684 3300049570 Bacteria 1751
358 Ga0501033_1122607 3300049570 Bacteria 522
359 Ga0501034_0026519 3300049571 Bacteria 5901
360 Ga0501034_0035212 3300049571 Bacteria 5076
361 Ga0501034_0078177 3300049571 Bacteria 3313
362 Ga0501034_0234612 3300049571 Bacteria 1782
363 Ga0501034_0961905 3300049571 Bacteria 739
364 Ga0501036_0002605 3300049572 Bacteria 14223
365 Ga0501036_0230566 3300049572 Bacteria 1554
366 Ga0501036_0452590 3300049572 Bacteria 1069
367 Ga0501036_0583788 3300049572 Bacteria 928
368 Ga0501036_1235235 3300049572 Bacteria 608
369 Ga0501037_0000131 3300049573 Bacteria 69802
370 Ga0501037_0208097 3300049573 Bacteria 1380
371 Ga0501038_0000109 3300049574 Bacteria 69802
372 Ga0501038_0039812 3300049574 Bacteria 4110
373 Ga0501038_0131427 3300049574 Bacteria 2055
374 Ga0501038_0169820 3300049574 Bacteria 1766
375 Ga0501039_0002279 3300049575 Bacteria 14235
376 Ga0501039_0240450 3300049575 Bacteria 1423
377 Ga0501040_0107203 3300049576 Bacteria 1952
378 Ga0501041_0523920 3300049577 Bacteria 755
379 Ga0501042_0099109 3300049578 Bacteria 2095
380 Ga0501043_0038138 3300049579 Bacteria 3779
381 Ga0501043_0047851 3300049579 Bacteria 3362
382 Ga0501043_0099954 3300049579 Bacteria 2280
383 Ga0501043_0808824 3300049579 Bacteria 677
384 Ga0501043_1011885 3300049579 Bacteria 591
385 Ga0501046_0126860 3300049580 Bacteria 1938
386 Ga0501046_0312805 3300049580 Bacteria 1145
387 Ga0501046_0493855 3300049580 Bacteria 877
388 Ga0501047_0152453 3300049581 Bacteria 2186
389 Ga0501047_0206504 3300049581 Bacteria 1823
390 Ga0501047_0414952 3300049581 Bacteria 1178
391 Ga0501047_0672906 3300049581 Bacteria 853
392 Ga0501047_0782101 3300049581 Bacteria 770
393 Ga0501047_0975116 3300049581 Bacteria 661
394 Ga0501048_0186294 3300049582 Bacteria 1471
395 Ga0501048_0280029 3300049582 Bacteria 1186
396 Ga0501048_1331934 3300049582 Bacteria 516
397 Ga0501067_0091010 3300049583 Bacteria 1693
398 Ga0501067_0140339 3300049583 Bacteria 1345
399 Ga0501067_0175550 3300049583 Bacteria 1193
400 Ga0501067_0286359 3300049583 Bacteria 917
401 Ga0501068_0298881 3300049584 Bacteria 1030
402 Ga0501068_1176173 3300049584 Bacteria 508
403 Ga0501069_0004122 3300049585 Bacteria 7502
404 Ga0501069_0138940 3300049585 Bacteria 1393
405 Ga0501069_0201430 3300049585 Bacteria 1154
406 Ga0501070_0006301 3300049586 Bacteria 10097
407 Ga0501070_0060281 3300049586 Bacteria 3145
408 Ga0501070_0171551 3300049586 Bacteria 1786
409 Ga0501070_0180101 3300049586 Bacteria 1739
410 Ga0501070_0190795 3300049586 Bacteria 1684
411 Ga0501071_0625049 3300049587 Bacteria 828
412 Ga0501072_0008088 3300049588 Bacteria 7980
413 Ga0501072_0490060 3300049588 Bacteria 972
414 Ga0501072_1145878 3300049588 Bacteria 605
415 Ga0501073_0015881 3300049589 Bacteria 5456
416 Ga0501073_0058581 3300049589 Bacteria 2691
417 Ga0501073_0103607 3300049589 Bacteria 1975
418 Ga0501073_0456227 3300049589 Bacteria 883
419 Ga0501073_0625539 3300049589 Bacteria 743
420 Ga0501073_1160906 3300049589 Bacteria 530
421 Ga0501074_0035107 3300049590 Bacteria 3633
422 Ga0501074_0187163 3300049590 Bacteria 1476
423 Ga0501074_0215216 3300049590 Bacteria 1369
424 Ga0501074_0565311 3300049590 Bacteria 805
425 Ga0501074_0599280 3300049590 Bacteria 779
426 Ga0501076_0185791 3300049592 Bacteria 1695
427 Ga0501076_0185876 3300049592 Bacteria 1695
428 Ga0501076_0516025 3300049592 Bacteria 985
429 Ga0501076_1059084 3300049592 Bacteria 668
430 Ga0501077_0020871 3300049593 Bacteria 4147
431 Ga0501077_0087032 3300049593 Bacteria 1980
432 Ga0501077_0511652 3300049593 Bacteria 770
433 Ga0501077_0831726 3300049593 Bacteria 594
434 Ga0501238_007181 3300049671 Bacteria 1443
435 Ga0501242_052263 3300049674 Bacteria 603
436 Ga0501245_110671 3300049708 Bacteria 568
437 Ga0501079_0197908 3300049741 Bacteria 1569
438 Ga0501079_0718271 3300049741 Bacteria 786
439 Ga0501079_0942056 3300049741 Bacteria 680
440 Ga0501080_0010339 3300049742 Bacteria 8535
441 Ga0501080_0017194 3300049742 Bacteria 6681
442 Ga0501080_0084954 3300049742 Bacteria 2941
443 Ga0501080_0102533 3300049742 Bacteria 2654
444 Ga0501080_0363496 3300049742 Bacteria 1305
445 Ga0501080_0669241 3300049742 Bacteria 917
446 Ga0501080_1611351 3300049742 Bacteria 549
447 Ga0501080_1752405 3300049742 Bacteria 523
448 Ga0501081_0302407 3300049743 Bacteria 1174
449 Ga0501081_0560162 3300049743 Bacteria 854
450 Ga0501083_0020957 3300049744 Bacteria 4543
451 Ga0501083_0030622 3300049744 Bacteria 3695
452 Ga0501083_0190312 3300049744 Bacteria 1339
453 Ga0501083_0457552 3300049744 Bacteria 830
454 Ga0501083_0506726 3300049744 Bacteria 786
455 Ga0501083_0545104 3300049744 Bacteria 755
456 Ga0501083_0988170 3300049744 Bacteria 548
457 Ga0501083_1087249 3300049744 Bacteria 520
458 Ga0501280_005024 3300049776 Bacteria 1908
459 Ga0501035_0009166 3300049822 Bacteria 9204
460 Ga0501035_0043204 3300049822 Bacteria 4062
461 Ga0501035_0115964 3300049822 Bacteria 2344
462 Ga0501035_0618150 3300049822 Bacteria 881
463 Ga0501044_0000234 3300049823 Bacteria 69802
464 Ga0501044_0033457 3300049823 Bacteria 5402
465 Ga0501044_0052796 3300049823 Bacteria 4185
466 Ga0501044_0191494 3300049823 Bacteria 2007
467 Ga0501044_1107833 3300049823 Bacteria 661
468 Ga0501045_0820129 3300049824 Bacteria 685
469 nmdc:mga03683_421963_c1 3300050489 Bacteria 639
470 nmdc:mga03n38_161849_c1 3300050490 Bacteria 1134
471 nmdc:mga00v17_1284_c1 3300050491 Bacteria 13184
472 nmdc:mga00v17_512278_c1 3300050491 Bacteria 777
473 nmdc:mga0yw44_625040_c1 3300050492 Bacteria 732
474 nmdc:mga0yw44_669865_c1 3300050492 Bacteria 705
475 nmdc:mga0k408_102085_c1 3300050493 Bacteria 1692
476 nmdc:mga0k408_312241_c1 3300050493 Bacteria 938
477 nmdc:mga06z11_119069_c1 3300050494 Bacteria 1471
478 nmdc:mga06z11_296619_c1 3300050494 Bacteria 960
479 nmdc:mga06z11_296640_c1 3300050494 Bacteria 960
480 nmdc:mga07m45_672954_c1 3300050496 Bacteria 596
481 nmdc:mga05p37_235686_c1 3300050507 Bacteria 2203
482 nmdc:mga05p37_568202_c1 3300050507 Bacteria 1287
483 nmdc:mga05p37_58409_c1 3300050507 Bacteria 4751
484 nmdc:mga09592_1159694_c1 3300050508 Bacteria 640
485 nmdc:mga09592_724683_c1 3300050508 Bacteria 845
486 nmdc:mga09592_888430_c1 3300050508 Bacteria 750
487 nmdc:mga0qj67_1562554_c1 3300050509 Bacteria 507
488 nmdc:mga0qj67_794079_c1 3300050509 Bacteria 750
489 nmdc:mga06r32_1083615_c1 3300050510 Bacteria 751
490 nmdc:mga06r32_551432_c1 3300050510 Bacteria 1127
491 nmdc:mga06r32_779416_c1 3300050510 Bacteria 918
492 nmdc:mga08y16_100818_c1 3300050511 Bacteria 3006
493 nmdc:mga08y16_37233_c1 3300050511 Bacteria 5110
494 nmdc:mga08y16_9879_c2 3300050511 Bacteria 6288
495 nmdc:mga0n895_423292_c1 3300050512 Bacteria 1346
496 nmdc:mga0n895_47595_c1 3300050512 Bacteria 4193
497 nmdc:mga0n895_483706_c1 3300050512 Bacteria 1248
498 nmdc:mga0rr50_223414_c1 3300050513 Bacteria 1556
499 nmdc:mga0rr50_444944_c1 3300050513 Bacteria 1098
500 nmdc:mga0a205_525966_c1 3300050515 Bacteria 1039
501 nmdc:mga0a205_79259_c1 3300050515 Bacteria 3173
502 nmdc:mga0sz30_170332_c1 3300050516 Bacteria 965
503 nmdc:mga0sz30_549993_c1 3300050516 Bacteria 521
504 Ga0495619_1099174 3300053085 Bacteria 529
505 Ga0500643_091036 3300053087 Bacteria 831
506 Ga0500643_168855 3300053087 Bacteria 587
507 Ga0500651_0224729 3300053093 Bacteria 1100
508 Ga0500555_063991 3300053103 Bacteria 983
509 Ga0500556_0000009 3300053104 Bacteria 288111
510 Ga0500562_019707 3300053108 Bacteria 1747
511 Ga0500569_090116 3300053109 Bacteria 992
512 Ga0500608_085894 3300053122 Bacteria 1478
513 Ga0500652_116740 3300053131 Bacteria 1115
514 Ga0500655_132156 3300053133 Bacteria 533
515 Ga0500658_0258922 3300053134 Bacteria 800
516 Ga0500561_0013973 3300053137 Bacteria 1752
517 Ga0500568_0281560 3300053139 Bacteria 604
518 Ga0500577_0043076 3300053142 Bacteria 1656
519 Ga0500588_0004535 3300053146 Bacteria 3018
520 Ga0500604_0291867 3300053151 Bacteria 565
521 Ga0500616_0024839 3300053153 Bacteria 3326
522 Ga0500616_0042639 3300053153 Bacteria 2429
523 Ga0500622_0001277 3300053156 Bacteria 20505
524 Ga0500622_0008990 3300053156 Bacteria 5552
525 Ga0500622_0269252 3300053156 Bacteria 739
526 Ga0500624_029853 3300053157 Bacteria 931
527 Ga0500627_0147216 3300053158 Bacteria 1064
528 Ga0500627_0415870 3300053158 Bacteria 570
529 Ga0500634_0068159 3300053161 Bacteria 1869
530 Ga0500636_0009188 3300053177 Bacteria 5746
531 Ga0500645_074069 3300053730 Bacteria 975
532 Ga0500645_201468 3300053730 Bacteria 537
533 Ga0501084_0023050 3300054114 Bacteria 5196
534 Ga0501084_0218577 3300054114 Bacteria 1608
535 Ga0501084_0381809 3300054114 Bacteria 1190
536 Ga0501084_0565365 3300054114 Bacteria 961
537 Ga0587070_024864 3300059491 Bacteria 1040
538 Ga0587077_011314 3300059493 Bacteria 1400
539 Ga0587077_013322 3300059493 Bacteria 1332
540 Ga0587080_009823 3300059503 Bacteria 1400
541 Ga0587085_021949 3300059506 Bacteria 980
542 Ga0587086_080249 3300059507 Bacteria 574
543 Ga0587089_113809 3300059509 Bacteria 502
544 Ga0587090_003741 3300059510 Bacteria 1792
545 Ga0587106_000771 3300059605 Bacteria 2500
546 Ga0587125_061066 3300059607 Bacteria 551
547 Ga0587101_003961 3300059623 Bacteria 1548
548 Ga0587101_097169 3300059623 Bacteria 581
549 Ga0587062_015009 3300059639 Bacteria 1030
550 Ga0587062_087362 3300059639 Bacteria 589
551 Ga0587068_002490 3300059641 Bacteria 2244
552 Ga0587069_027693 3300059642 Bacteria 896
553 Ga0587072_072792 3300059643 Bacteria 729
554 Ga0587076_006671 3300059645 Bacteria 1548
555 Ga0587107_075120 3300059652 Bacteria 625
556 Ga0587111_0000057 3300060346 Bacteria 6907
557 Ga0587111_0017505 3300060346 Bacteria 1336
558 Ga0587111_0177517 3300060346 Bacteria 590
559 Ga0501082_0017998 3300060353 Bacteria 6085
560 Ga0501082_0049749 3300060353 Bacteria 3614
561 Ga0501082_0084660 3300060353 Bacteria 2734
562 Ga0501082_0325161 3300060353 Bacteria 1340
563 Ga0501082_0348793 3300060353 Bacteria 1290
564 Ga0501082_0447594 3300060353 Bacteria 1128
565 Ga0501082_0676492 3300060353 Bacteria 903
566 Ga0501082_0835902 3300060353 Bacteria 805
567 Ga0501082_0848015 3300060353 Bacteria 799
568 Ga0501082_1444350 3300060353 Bacteria 601
569 Ga0530510_0056862 3300061734 Bacteria 2827
570 Ga0530510_0373431 3300061734 Bacteria 1073
571 Ga0530510_0378904 3300061734 Bacteria 1065
572 Ga0530510_0526569 3300061734 Bacteria 897
573 Ga0530510_1007502 3300061734 Bacteria 637
574 Ga0530510_1306601 3300061734 Bacteria 556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005455 Ga0070663_100001615 Ga0070663_1000016152 57
2 3300006847 Ga0075431_100769041 Ga0075431_1007690413 57
3 3300020082 Ga0206353_11323013 Ga0206353_113230132 63
4 3300025923 Ga0207681_10084218 Ga0207681_100842186 63
5 3300029957 Ga0265324_10220715 Ga0265324_102207152 63
6 3300031240 Ga0265320_10357585 Ga0265320_103575851 63
7 3300031249 Ga0265339_10436794 Ga0265339_104367942 63
8 3300031344 Ga0265316_10407169 Ga0265316_104071692 63
9 3300031595 Ga0265313_10053734 Ga0265313_100537343 63
10 3300031712 Ga0265342_10587936 Ga0265342_105879362 63
11 3300032168 Ga0316593_10001189 Ga0316593_100011895 63
12 3300033541 Ga0316596_1011427 Ga0316596_10114274 63
13 3300005336 Ga0070680_101985014 Ga0070680_1019850141 64
14 3300005440 Ga0070705_100586427 Ga0070705_1005864272 64
15 3300005548 Ga0070665_100006166 Ga0070665_10000616611 64
16 3300005549 Ga0070704_101816982 Ga0070704_1018169822 64
17 3300006048 Ga0075363_100397590 Ga0075363_1003975902 64
18 3300009094 Ga0111539_10682184 Ga0111539_106821844 64
19 3300009545 Ga0105237_10747504 Ga0105237_107475044 64
20 3300009553 Ga0105249_10014071 Ga0105249_1001407111 64
21 3300009553 Ga0105249_13431225 Ga0105249_134312252 64
22 3300013100 Ga0157373_11139525 Ga0157373_111395252 64
23 3300013296 Ga0157374_11492341 Ga0157374_114923412 64
24 3300025935 Ga0207709_11043522 Ga0207709_110435221 64
25 3300026067 Ga0207678_11372282 Ga0207678_113722821 64
26 3300031247 Ga0265340_10045117 Ga0265340_100451173 64
27 3300031824 Ga0307413_11325543 Ga0307413_113255432 64
28 3300031995 Ga0307409_100472547 Ga0307409_1004725473 64
29 3300039437 Ga0436365_0527365 Ga0436365_0527365_186_389 64
30 3300046491 Ga0495584_0188772 Ga0495584_0188772_247_450 64
31 3300046615 Ga0495656_0105356 Ga0495656_0105356_813_1016 64
32 3300046684 Ga0495669_0572117 Ga0495669_0572117_156_359 64
33 3300049568 Ga0501031_0016670 Ga0501031_0016670_3763_3963 64
34 3300049569 Ga0501032_0188536 Ga0501032_0188536_463_663 64
35 3300049570 Ga0501033_1122607 Ga0501033_1122607_135_335 64
36 3300049571 Ga0501034_0035212 Ga0501034_0035212_1375_1575 64
37 3300049572 Ga0501036_0452590 Ga0501036_0452590_623_823 64
38 3300049573 Ga0501037_0208097 Ga0501037_0208097_666_866 64
39 3300049574 Ga0501038_0039812 Ga0501038_0039812_1240_1440 64
40 3300049575 Ga0501039_0240450 Ga0501039_0240450_305_505 64
41 3300049579 Ga0501043_0808824 Ga0501043_0808824_384_584 64
42 3300049583 Ga0501067_0286359 Ga0501067_0286359_192_392 64
43 3300049585 Ga0501069_0138940 Ga0501069_0138940_517_717 64
44 3300049586 Ga0501070_0171551 Ga0501070_0171551_915_1115 64
45 3300049589 Ga0501073_0058581 Ga0501073_0058581_1963_2163 64
46 3300049590 Ga0501074_0215216 Ga0501074_0215216_544_744 64
47 3300049590 Ga0501074_0565311 Ga0501074_0565311_134_373 64
48 3300049590 Ga0501074_0599280 Ga0501074_0599280_34_237 64
49 3300049742 Ga0501080_0363496 Ga0501080_0363496_622_822 64
50 3300049742 Ga0501080_1752405 Ga0501080_1752405_204_404 64
51 3300049823 Ga0501044_0191494 Ga0501044_0191494_495_695 64
52 3300053103 Ga0500555_063991 Ga0500555_063991_289_492 64
53 3300060353 Ga0501082_0848015 Ga0501082_0848015_219_419 64
54 3300061734 Ga0530510_0526569 Ga0530510_0526569_414_701 64
55 3300061734 Ga0530510_1007502 Ga0530510_1007502_184_387 64
56 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096120 65
57 3300003911 JGI25405J52794_10041760 JGI25405J52794_100417602 65
58 3300005289 Ga0065704_10114286 Ga0065704_101142863 65
59 3300005336 Ga0070680_100099273 Ga0070680_1000992736 65
60 3300005336 Ga0070680_100254677 Ga0070680_1002546773 65
61 3300005336 Ga0070680_100552650 Ga0070680_1005526502 65
62 3300005340 Ga0070689_101321229 Ga0070689_1013212291 65
63 3300005345 Ga0070692_10860787 Ga0070692_108607871 65
64 3300005347 Ga0070668_101457376 Ga0070668_1014573762 65
65 3300005347 Ga0070668_102099616 Ga0070668_1020996162 65
66 3300005456 Ga0070678_100961198 Ga0070678_1009611982 65
67 3300005458 Ga0070681_10238328 Ga0070681_102383282 65
68 3300005458 Ga0070681_10666110 Ga0070681_106661102 65
69 3300005458 Ga0070681_10810161 Ga0070681_108101613 65
70 3300005458 Ga0070681_11291366 Ga0070681_112913661 65
71 3300005471 Ga0070698_101707381 Ga0070698_1017073811 65
72 3300005530 Ga0070679_100049286 Ga0070679_1000492863 65
73 3300005539 Ga0068853_100013375 Ga0068853_1000133759 65
74 3300005545 Ga0070695_100893997 Ga0070695_1008939972 65
75 3300005547 Ga0070693_101108505 Ga0070693_1011085052 65
76 3300005548 Ga0070665_100319540 Ga0070665_1003195404 65
77 3300005548 Ga0070665_101021496 Ga0070665_1010214962 65
78 3300005548 Ga0070665_102085774 Ga0070665_1020857742 65
79 3300005614 Ga0068856_100200510 Ga0068856_1002005105 65
80 3300005618 Ga0068864_100822873 Ga0068864_1008228733 65
81 3300005618 Ga0068864_101815125 Ga0068864_1018151252 65
82 3300005719 Ga0068861_101161149 Ga0068861_1011611493 65
83 3300005719 Ga0068861_102240121 Ga0068861_1022401212 65
84 3300005844 Ga0068862_100749614 Ga0068862_1007496143 65
85 3300005844 Ga0068862_100988724 Ga0068862_1009887242 65
86 3300005844 Ga0068862_101214985 Ga0068862_1012149853 65
87 3300005844 Ga0068862_101379067 Ga0068862_1013790671 65
88 3300005937 Ga0081455_10001008 Ga0081455_1000100834 65
89 3300005937 Ga0081455_10019145 Ga0081455_100191458 65
90 3300005981 Ga0081538_10003741 Ga0081538_1000374111 65
91 3300005981 Ga0081538_10043084 Ga0081538_100430846 65
92 3300005981 Ga0081538_10152960 Ga0081538_101529602 65
93 3300005983 Ga0081540_1008438 Ga0081540_100843810 65
94 3300005983 Ga0081540_1043521 Ga0081540_10435216 65
95 3300006038 Ga0075365_10210208 Ga0075365_102102082 65
96 3300006038 Ga0075365_10431230 Ga0075365_104312303 65
97 3300006051 Ga0075364_10067532 Ga0075364_100675324 65
98 3300006051 Ga0075364_10359037 Ga0075364_103590372 65
99 3300006051 Ga0075364_10517391 Ga0075364_105173912 65
100 3300006058 Ga0075432_10376983 Ga0075432_103769832 65
101 3300006178 Ga0075367_10314485 Ga0075367_103144853 65
102 3300006178 Ga0075367_10323469 Ga0075367_103234692 65
103 3300006186 Ga0075369_10048331 Ga0075369_100483313 65
104 3300006186 Ga0075369_10423656 Ga0075369_104236562 65
105 3300006195 Ga0075366_10042037 Ga0075366_100420372 65
106 3300006195 Ga0075366_10316635 Ga0075366_103166352 65
107 3300006237 Ga0097621_101991995 Ga0097621_1019919952 65
108 3300006846 Ga0075430_100740905 Ga0075430_1007409052 65
109 3300006846 Ga0075430_101707119 Ga0075430_1017071192 65
110 3300006847 Ga0075431_101131764 Ga0075431_1011317642 65
111 3300006852 Ga0075433_10418300 Ga0075433_104183003 65
112 3300006871 Ga0075434_100237438 Ga0075434_1002374382 65
113 3300006871 Ga0075434_100252710 Ga0075434_1002527103 65
114 3300006880 Ga0075429_100197579 Ga0075429_1001975793 65
115 3300006914 Ga0075436_101365257 Ga0075436_1013652572 65
116 3300006946 Ga0079104_1000547 Ga0079104_100054747 65
117 3300007076 Ga0075435_100763996 Ga0075435_1007639963 65
118 3300007076 Ga0075435_101374118 Ga0075435_1013741182 65
119 3300009092 Ga0105250_10572582 Ga0105250_105725822 65
120 3300009094 Ga0111539_10092029 Ga0111539_100920294 65
121 3300009098 Ga0105245_10327906 Ga0105245_103279062 65
122 3300009147 Ga0114129_10079719 Ga0114129_100797199 65
123 3300009147 Ga0114129_10778840 Ga0114129_107788403 65
124 3300009148 Ga0105243_11232115 Ga0105243_112321152 65
125 3300009148 Ga0105243_11721412 Ga0105243_117214123 65
126 3300009148 Ga0105243_12682766 Ga0105243_126827662 65
127 3300009177 Ga0105248_10723019 Ga0105248_107230192 65
128 3300009177 Ga0105248_10983695 Ga0105248_109836952 65
129 3300009545 Ga0105237_10586873 Ga0105237_105868733 65
130 3300009545 Ga0105237_10822763 Ga0105237_108227633 65
131 3300009551 Ga0105238_12377522 Ga0105238_123775222 65
132 3300009553 Ga0105249_10410828 Ga0105249_104108283 65
133 3300009553 Ga0105249_11347390 Ga0105249_113473902 65
134 3300009553 Ga0105249_11425620 Ga0105249_114256201 65
135 3300009553 Ga0105249_12411574 Ga0105249_124115742 65
136 3300009987 Ga0105030_128379 Ga0105030_1283791 65
137 3300009993 Ga0105028_109128 Ga0105028_1091281 65
138 3300010159 Ga0099796_10576206 Ga0099796_105762062 65
139 3300010375 Ga0105239_10984974 Ga0105239_109849743 65
140 3300010375 Ga0105239_12407305 Ga0105239_124073052 65
141 3300012502 Ga0157347_1037009 Ga0157347_10370092 65
142 3300013105 Ga0157369_11151176 Ga0157369_111511761 65
143 3300013297 Ga0157378_10464731 Ga0157378_104647314 65
144 3300013297 Ga0157378_10639748 Ga0157378_106397483 65
145 3300014325 Ga0163163_11740043 Ga0163163_117400433 65
146 3300014326 Ga0157380_10310935 Ga0157380_103109353 65
147 3300014326 Ga0157380_10398047 Ga0157380_103980473 65
148 3300014497 Ga0182008_10408056 Ga0182008_104080562 65
149 3300015265 Ga0182005_1002173 Ga0182005_100217314 65
150 3300020080 Ga0206350_10535392 Ga0206350_105353922 65
151 3300025294 Ga0209025_1041276 Ga0209025_10412763 65
152 3300025912 Ga0207707_10357488 Ga0207707_103574882 65
153 3300025912 Ga0207707_10863067 Ga0207707_108630672 65
154 3300025918 Ga0207662_11096961 Ga0207662_110969612 65
155 3300025924 Ga0207694_11678532 Ga0207694_116785322 65
156 3300025926 Ga0207659_11027428 Ga0207659_110274282 65
157 3300025927 Ga0207687_10977447 Ga0207687_109774472 65
158 3300025935 Ga0207709_10969606 Ga0207709_109696062 65
159 3300025936 Ga0207670_10553176 Ga0207670_105531762 65
160 3300025941 Ga0207711_10140909 Ga0207711_101409092 65
161 3300025941 Ga0207711_11132271 Ga0207711_111322712 65
162 3300025961 Ga0207712_10273112 Ga0207712_102731122 65
163 3300025961 Ga0207712_11127724 Ga0207712_111277242 65
164 3300025972 Ga0207668_10714327 Ga0207668_107143271 65
165 3300025972 Ga0207668_10917752 Ga0207668_109177522 65
166 3300025972 Ga0207668_11307576 Ga0207668_113075762 65
167 3300026067 Ga0207678_10548627 Ga0207678_105486272 65
168 3300026075 Ga0207708_11768763 Ga0207708_117687631 65
169 3300026118 Ga0207675_101467341 Ga0207675_1014673411 65
170 3300026118 Ga0207675_101592654 Ga0207675_1015926542 65
171 3300026121 Ga0207683_10815670 Ga0207683_108156702 65
172 3300027111 Ga0209281_1000573 Ga0209281_100057311 65
173 3300027512 Ga0209179_1030741 Ga0209179_10307413 65
174 3300027866 Ga0209813_10225347 Ga0209813_102253472 65
175 3300027876 Ga0209974_10185273 Ga0209974_101852733 65
176 3300027876 Ga0209974_10210068 Ga0209974_102100681 65
177 3300027876 Ga0209974_10258863 Ga0209974_102588632 65
178 3300027907 Ga0207428_10020203 Ga0207428_1002020310 65
179 3300027907 Ga0207428_10185324 Ga0207428_101853242 65
180 3300028379 Ga0268266_10036033 Ga0268266_100360331 65
181 3300028577 Ga0265318_10015702 Ga0265318_100157028 65
182 3300028577 Ga0265318_10361672 Ga0265318_103616722 65
183 3300028794 Ga0307515_10058447 Ga0307515_100584478 65
184 3300028800 Ga0265338_10609169 Ga0265338_106091692 65
185 3300028800 Ga0265338_11085278 Ga0265338_110852782 65
186 3300030733 Ga0314311_1193439 Ga0314311_11934392 65
187 3300031090 Ga0265760_10077843 Ga0265760_100778434 65
188 3300031235 Ga0265330_10125296 Ga0265330_101252962 65
189 3300031239 Ga0265328_10009346 Ga0265328_100093467 65
190 3300031239 Ga0265328_10407638 Ga0265328_104076382 65
191 3300031240 Ga0265320_10551472 Ga0265320_105514722 65
192 3300031241 Ga0265325_10016753 Ga0265325_100167534 65
193 3300031241 Ga0265325_10196517 Ga0265325_101965173 65
194 3300031242 Ga0265329_10024967 Ga0265329_100249672 65
195 3300031242 Ga0265329_10185270 Ga0265329_101852702 65
196 3300031247 Ga0265340_10065829 Ga0265340_100658292 65
197 3300031247 Ga0265340_10097663 Ga0265340_100976634 65
198 3300031247 Ga0265340_10398266 Ga0265340_103982662 65
199 3300031249 Ga0265339_10002105 Ga0265339_100021059 65
200 3300031249 Ga0265339_10045403 Ga0265339_100454035 65
201 3300031249 Ga0265339_10074118 Ga0265339_100741183 65
202 3300031249 Ga0265339_10085133 Ga0265339_100851332 65
203 3300031249 Ga0265339_10150396 Ga0265339_101503962 65
204 3300031250 Ga0265331_10037674 Ga0265331_100376746 65
205 3300031250 Ga0265331_10087123 Ga0265331_100871233 65
206 3300031344 Ga0265316_10015933 Ga0265316_1001593310 65
207 3300031344 Ga0265316_10030464 Ga0265316_100304645 65
208 3300031344 Ga0265316_10561013 Ga0265316_105610132 65
209 3300031344 Ga0265316_10883304 Ga0265316_108833042 65
210 3300031548 Ga0307408_101310200 Ga0307408_1013102002 65
211 3300031595 Ga0265313_10000031 Ga0265313_1000003187 65
212 3300031595 Ga0265313_10052060 Ga0265313_100520603 65
213 3300031595 Ga0265313_10273582 Ga0265313_102735822 65
214 3300031595 Ga0265313_10275639 Ga0265313_102756393 65
215 3300031595 Ga0265313_10419109 Ga0265313_104191092 65
216 3300031711 Ga0265314_10008857 Ga0265314_100088576 65
217 3300031711 Ga0265314_10028299 Ga0265314_100282998 65
218 3300031711 Ga0265314_10398931 Ga0265314_103989312 65
219 3300031711 Ga0265314_10458770 Ga0265314_104587702 65
220 3300031711 Ga0265314_10700573 Ga0265314_107005731 65
221 3300031712 Ga0265342_10004137 Ga0265342_1000413711 65
222 3300031712 Ga0265342_10038280 Ga0265342_100382803 65
223 3300031712 Ga0265342_10078306 Ga0265342_100783065 65
224 3300031712 Ga0265342_10357588 Ga0265342_103575882 65
225 3300031731 Ga0307405_10536335 Ga0307405_105363353 65
226 3300031824 Ga0307413_10302467 Ga0307413_103024671 65
227 3300031852 Ga0307410_11695408 Ga0307410_116954082 65
228 3300031852 Ga0307410_11938016 Ga0307410_119380161 65
229 3300031901 Ga0307406_10268077 Ga0307406_102680772 65
230 3300031901 Ga0307406_10614112 Ga0307406_106141121 65
231 3300031903 Ga0307407_11472189 Ga0307407_114721892 65
232 3300031911 Ga0307412_10813782 Ga0307412_108137822 65
233 3300031995 Ga0307409_100224075 Ga0307409_1002240752 65
234 3300031995 Ga0307409_100227836 Ga0307409_1002278363 65
235 3300031995 Ga0307409_101958854 Ga0307409_1019588542 65
236 3300032002 Ga0307416_100537909 Ga0307416_1005379093 65
237 3300032002 Ga0307416_101625458 Ga0307416_1016254582 65
238 3300032002 Ga0307416_102505778 Ga0307416_1025057781 65
239 3300032002 Ga0307416_103492446 Ga0307416_1034924462 65
240 3300032004 Ga0307414_10741124 Ga0307414_107411243 65
241 3300032005 Ga0307411_11316798 Ga0307411_113167981 65
242 3300032126 Ga0307415_100377700 Ga0307415_1003777003 65
243 3300032126 Ga0307415_100611652 Ga0307415_1006116521 65
244 3300032126 Ga0307415_100898907 Ga0307415_1008989073 65
245 3300035089 Ga0373944_0089856 Ga0373944_0089856_51_263 65
246 3300035112 Ga0373932_0289120 Ga0373932_0289120_25_357 65
247 3300035116 Ga0373945_0173574 Ga0373945_0173574_125_457 65
248 3300035119 Ga0373956_0610592 Ga0373956_0610592_244_459 65
249 3300035691 Ga0373931_0213407 Ga0373931_0213407_467_667 65
250 3300035691 Ga0373931_0284553 Ga0373931_0284553_528_734 65
251 3300035691 Ga0373931_0306281 Ga0373931_0306281_284_616 65
252 3300035692 Ga0373935_0254180 Ga0373935_0254180_249_581 65
253 3300035725 Ga0373947_0085526 Ga0373947_0085526_889_1221 65
254 3300037068 Ga0373925_0144587 Ga0373925_0144587_406_738 65
255 3300037312 Ga0395899_0000073 Ga0395899_0000073_73621_73821 65
256 3300037418 Ga0395900_0000027 Ga0395900_0000027_178191_178391 65
257 3300037466 Ga0395898_0000255 Ga0395898_0000255_23251_23451 65
258 3300037471 Ga0395905_0000032 Ga0395905_0000032_107542_107742 65
259 3300037853 Ga0436364_0607066 Ga0436364_0607066_150_350 65
260 3300038443 Ga0395901_0000110 Ga0395901_0000110_107567_107767 65
261 3300039062 Ga0400483_059010 Ga0400483_059010_5074_5280 65
262 3300039062 Ga0400483_165422 Ga0400483_165422_1948_2154 65
263 3300039062 Ga0400483_217885 Ga0400483_217885_11540_11746 65
264 3300039062 Ga0400483_243738 Ga0400483_243738_3564_3770 65
265 3300039062 Ga0400483_281008 Ga0400483_281008_1077_1283 65
266 3300039438 Ga0436360_0566130 Ga0436360_0566130_295_498 65
267 3300039438 Ga0436360_0590269 Ga0436360_0590269_251_466 65
268 3300039450 Ga0436363_1377737 Ga0436363_1377737_30_233 65
269 3300039453 Ga0436362_0004730 Ga0436362_0004730_41_256 65
270 3300041413 Ga0439465_0119634 Ga0439465_0119634_668_868 65
271 3300041460 Ga0451802_1457526 Ga0451802_1457526_300_500 65
272 3300041491 Ga0451833_1093358 Ga0451833_1093358_264_467 65
273 3300041511 Ga0451855_0574687 Ga0451855_0574687_72_272 65
274 3300041997 Ga0439431_0103480 Ga0439431_0103480_271_471 65
275 3300042006 Ga0439432_032485 Ga0439432_032485_393_599 65
276 3300042007 Ga0439449_0092967 Ga0439449_0092967_860_1060 65
277 3300042013 Ga0439456_070050 Ga0439456_070050_98_298 65
278 3300042015 Ga0439462_0152722 Ga0439462_0152722_300_500 65
279 3300042435 Ga0439434_0254475 Ga0439434_0254475_306_506 65
280 3300044694 Ga0466963_0250593 Ga0466963_0250593_77_283 65
281 3300045976 Ga0466967_1115804 Ga0466967_1115804_159_365 65
282 3300046455 Ga0495603_0312515 Ga0495603_0312515_273_488 65
283 3300046460 Ga0495638_0006964 Ga0495638_0006964_2933_3133 65
284 3300046460 Ga0495638_0040593 Ga0495638_0040593_2046_2246 65
285 3300046460 Ga0495638_0118029 Ga0495638_0118029_689_901 65
286 3300046460 Ga0495638_0240762 Ga0495638_0240762_223_423 65
287 3300046474 Ga0495605_0476168 Ga0495605_0476168_246_446 65
288 3300046475 Ga0495639_0214279 Ga0495639_0214279_175_390 65
289 3300046512 Ga0495610_0018183 Ga0495610_0018183_3626_3838 65
290 3300046522 Ga0495643_0103412 Ga0495643_0103412_874_1101 65
291 3300046522 Ga0495643_0120493 Ga0495643_0120493_220_432 65
292 3300046542 Ga0495597_0190693 Ga0495597_0190693_423_623 65
293 3300046615 Ga0495656_0517149 Ga0495656_0517149_411_614 65
294 3300046648 Ga0495611_0467739 Ga0495611_0467739_135_341 65
295 3300046660 Ga0495625_0084671 Ga0495625_0084671_958_1185 65
296 3300046660 Ga0495625_0292882 Ga0495625_0292882_534_734 65
297 3300046660 Ga0495625_0294702 Ga0495625_0294702_599_799 65
298 3300046660 Ga0495625_0659591 Ga0495625_0659591_25_225 65
299 3300046691 Ga0495670_0071023 Ga0495670_0071023_89_298 65
300 3300046692 Ga0495671_0122761 Ga0495671_0122761_253_465 65
301 3300046694 Ga0495649_0291237 Ga0495649_0291237_569_769 65
302 3300046794 Ga0495589_0221442 Ga0495589_0221442_99_314 65
303 3300046810 Ga0495660_0497900 Ga0495660_0497900_114_326 65
304 3300047318 Ga0495636_0461249 Ga0495636_0461249_269_469 65
305 3300047320 Ga0495672_0117241 Ga0495672_0117241_624_833 65
306 3300047320 Ga0495672_0303828 Ga0495672_0303828_419_625 65
307 3300047469 Ga0495673_0135193 Ga0495673_0135193_664_873 65
308 3300047472 Ga0495686_0189107 Ga0495686_0189107_713_925 65
309 3300047673 Ga0495593_0401814 Ga0495593_0401814_252_467 65
310 3300048904 Ga0496101_0010556 Ga0496101_0010556_5845_6057 65
311 3300048904 Ga0496101_0659266 Ga0496101_0659266_582_782 65
312 3300048904 Ga0496101_1458155 Ga0496101_1458155_50_256 65
313 3300048905 Ga0496102_0426059 Ga0496102_0426059_24_224 65
314 3300048905 Ga0496102_1551203 Ga0496102_1551203_197_418 65
315 3300048907 Ga0496104_0070384 Ga0496104_0070384_2509_2721 65
316 3300048907 Ga0496104_0564312 Ga0496104_0564312_570_776 65
317 3300048908 Ga0496105_0005504 Ga0496105_0005504_4413_4625 65
318 3300048911 Ga0496108_0129057 Ga0496108_0129057_936_1148 65
319 3300048912 Ga0496109_0294169 Ga0496109_0294169_894_1106 65
320 3300048913 Ga0496110_0008141 Ga0496110_0008141_5941_6153 65
321 3300048914 Ga0496111_0023962 Ga0496111_0023962_2044_2256 65
322 3300048915 Ga0496112_0034695 Ga0496112_0034695_3335_3547 65
323 3300048916 Ga0496113_0004259 Ga0496113_0004259_5020_5232 65
324 3300048917 Ga0496114_0445680 Ga0496114_0445680_268_480 65
325 3300048917 Ga0496114_1602423 Ga0496114_1602423_252_458 65
326 3300048918 Ga0496115_0878597 Ga0496115_0878597_386_598 65
327 3300048922 Ga0496119_0000372 Ga0496119_0000372_36712_36921 65
328 3300048922 Ga0496119_0004353 Ga0496119_0004353_8907_9119 65
329 3300048922 Ga0496119_0019758 Ga0496119_0019758_233_433 65
330 3300048923 Ga0496120_0099786 Ga0496120_0099786_1165_1365 65
331 3300048923 Ga0496120_0184638 Ga0496120_0184638_100_312 65
332 3300048924 Ga0496121_0246048 Ga0496121_0246048_415_615 65
333 3300048924 Ga0496121_0459977 Ga0496121_0459977_326_526 65
334 3300048925 Ga0496122_0135780 Ga0496122_0135780_189_389 65
335 3300048926 Ga0496123_0017503 Ga0496123_0017503_4976_5176 65
336 3300048926 Ga0496123_0502510 Ga0496123_0502510_195_395 65
337 3300048927 Ga0496124_0698119 Ga0496124_0698119_239_439 65
338 3300048927 Ga0496124_0707630 Ga0496124_0707630_40_240 65
339 3300048928 Ga0496125_0017448 Ga0496125_0017448_2653_2865 65
340 3300048928 Ga0496125_0064883 Ga0496125_0064883_2381_2581 65
341 3300048929 Ga0496126_0344898 Ga0496126_0344898_555_755 65
342 3300049127 Ga0501306_000381 Ga0501306_000381_2302_2502 65
343 3300049128 Ga0501308_001458 Ga0501308_001458_728_928 65
344 3300049128 Ga0501308_002805 Ga0501308_002805_225_425 65
345 3300049130 Ga0501310_018342 Ga0501310_018342_114_314 65
346 3300049130 Ga0501310_033789 Ga0501310_033789_376_576 65
347 3300049130 Ga0501310_080386 Ga0501310_080386_50_250 65
348 3300049160 Ga0501304_004606 Ga0501304_004606_160_360 65
349 3300049160 Ga0501304_011395 Ga0501304_011395_313_513 65
350 3300049161 Ga0501305_001751 Ga0501305_001751_1277_1477 65
351 3300049161 Ga0501305_018020 Ga0501305_018020_550_750 65
352 3300049162 Ga0501307_000876 Ga0501307_000876_751_951 65
353 3300049162 Ga0501307_017944 Ga0501307_017944_595_795 65
354 3300049527 Ga0501311_002631 Ga0501311_002631_596_796 65
355 3300049528 Ga0501312_053243 Ga0501312_053243_316_516 65
356 3300049529 Ga0501313_001406 Ga0501313_001406_603_803 65
357 3300049529 Ga0501313_003461 Ga0501313_003461_651_851 65
358 3300049530 Ga0501314_001822 Ga0501314_001822_539_739 65
359 3300049530 Ga0501314_023558 Ga0501314_023558_217_417 65
360 3300049530 Ga0501314_031084 Ga0501314_031084_210_422 65
361 3300049531 Ga0501315_000060 Ga0501315_000060_3899_4099 65
362 3300049531 Ga0501315_023393 Ga0501315_023393_333_533 65
363 3300049533 Ga0501317_025997 Ga0501317_025997_129_329 65
364 3300049533 Ga0501317_026503 Ga0501317_026503_304_504 65
365 3300049533 Ga0501317_059311 Ga0501317_059311_42_242 65
366 3300049534 Ga0501318_085348 Ga0501318_085348_98_304 65
367 3300049536 Ga0501320_003890 Ga0501320_003890_277_477 65
368 3300049551 Ga0501335_001588 Ga0501335_001588_829_1029 65
369 3300049568 Ga0501031_0000651 Ga0501031_0000651_15395_15595 65
370 3300049568 Ga0501031_0359462 Ga0501031_0359462_139_339 65
371 3300049569 Ga0501032_0000111 Ga0501032_0000111_4953_5153 65
372 3300049569 Ga0501032_0119107 Ga0501032_0119107_976_1179 65
373 3300049569 Ga0501032_0305998 Ga0501032_0305998_109_309 65
374 3300049569 Ga0501032_0319352 Ga0501032_0319352_289_495 65
375 3300049569 Ga0501032_0552056 Ga0501032_0552056_284_484 65
376 3300049570 Ga0501033_0011172 Ga0501033_0011172_812_1012 65
377 3300049570 Ga0501033_0059135 Ga0501033_0059135_1565_1765 65
378 3300049570 Ga0501033_0139684 Ga0501033_0139684_1005_1205 65
379 3300049571 Ga0501034_0026519 Ga0501034_0026519_4953_5153 65
380 3300049571 Ga0501034_0078177 Ga0501034_0078177_567_770 65
381 3300049571 Ga0501034_0234612 Ga0501034_0234612_1211_1417 65
382 3300049571 Ga0501034_0961905 Ga0501034_0961905_157_363 65
383 3300049572 Ga0501036_0002605 Ga0501036_0002605_9071_9271 65
384 3300049572 Ga0501036_0230566 Ga0501036_0230566_944_1144 65
385 3300049572 Ga0501036_0583788 Ga0501036_0583788_696_899 65
386 3300049572 Ga0501036_1235235 Ga0501036_1235235_336_542 65
387 3300049573 Ga0501037_0000131 Ga0501037_0000131_64650_64850 65
388 3300049574 Ga0501038_0000109 Ga0501038_0000109_64650_64850 65
389 3300049574 Ga0501038_0131427 Ga0501038_0131427_487_693 65
390 3300049574 Ga0501038_0169820 Ga0501038_0169820_777_977 65
391 3300049575 Ga0501039_0002279 Ga0501039_0002279_4953_5153 65
392 3300049576 Ga0501040_0107203 Ga0501040_0107203_1033_1233 65
393 3300049577 Ga0501041_0523920 Ga0501041_0523920_255_476 65
394 3300049578 Ga0501042_0099109 Ga0501042_0099109_427_627 65
395 3300049579 Ga0501043_0038138 Ga0501043_0038138_777_983 65
396 3300049579 Ga0501043_0047851 Ga0501043_0047851_1153_1353 65
397 3300049579 Ga0501043_0099954 Ga0501043_0099954_1512_1715 65
398 3300049579 Ga0501043_1011885 Ga0501043_1011885_32_232 65
399 3300049580 Ga0501046_0126860 Ga0501046_0126860_242_445 65
400 3300049580 Ga0501046_0312805 Ga0501046_0312805_633_833 65
401 3300049580 Ga0501046_0493855 Ga0501046_0493855_248_454 65
402 3300049581 Ga0501047_0152453 Ga0501047_0152453_1202_1402 65
403 3300049581 Ga0501047_0206504 Ga0501047_0206504_1144_1347 65
404 3300049581 Ga0501047_0414952 Ga0501047_0414952_861_1088 65
405 3300049581 Ga0501047_0672906 Ga0501047_0672906_433_633 65
406 3300049581 Ga0501047_0782101 Ga0501047_0782101_417_617 65
407 3300049581 Ga0501047_0975116 Ga0501047_0975116_86_292 65
408 3300049582 Ga0501048_0186294 Ga0501048_0186294_463_663 65
409 3300049582 Ga0501048_0280029 Ga0501048_0280029_230_433 65
410 3300049582 Ga0501048_1331934 Ga0501048_1331934_203_403 65
411 3300049583 Ga0501067_0091010 Ga0501067_0091010_328_528 65
412 3300049583 Ga0501067_0140339 Ga0501067_0140339_617_820 65
413 3300049583 Ga0501067_0175550 Ga0501067_0175550_119_319 65
414 3300049584 Ga0501068_0298881 Ga0501068_0298881_444_644 65
415 3300049584 Ga0501068_1176173 Ga0501068_1176173_158_358 65
416 3300049585 Ga0501069_0004122 Ga0501069_0004122_6959_7162 65
417 3300049585 Ga0501069_0201430 Ga0501069_0201430_160_366 65
418 3300049586 Ga0501070_0006301 Ga0501070_0006301_5019_5219 65
419 3300049586 Ga0501070_0060281 Ga0501070_0060281_2560_2763 65
420 3300049586 Ga0501070_0180101 Ga0501070_0180101_1300_1506 65
421 3300049586 Ga0501070_0190795 Ga0501070_0190795_1007_1207 65
422 3300049587 Ga0501071_0625049 Ga0501071_0625049_70_273 65
423 3300049588 Ga0501072_0008088 Ga0501072_0008088_2807_3010 65
424 3300049588 Ga0501072_0490060 Ga0501072_0490060_442_645 65
425 3300049588 Ga0501072_1145878 Ga0501072_1145878_200_403 65
426 3300049589 Ga0501073_0015881 Ga0501073_0015881_3477_3680 65
427 3300049589 Ga0501073_0103607 Ga0501073_0103607_1542_1748 65
428 3300049589 Ga0501073_0456227 Ga0501073_0456227_403_609 65
429 3300049589 Ga0501073_0625539 Ga0501073_0625539_32_238 65
430 3300049589 Ga0501073_1160906 Ga0501073_1160906_197_400 65
431 3300049590 Ga0501074_0035107 Ga0501074_0035107_985_1188 65
432 3300049590 Ga0501074_0187163 Ga0501074_0187163_962_1162 65
433 3300049592 Ga0501076_0185791 Ga0501076_0185791_1029_1235 65
434 3300049592 Ga0501076_0185876 Ga0501076_0185876_920_1120 65
435 3300049592 Ga0501076_0516025 Ga0501076_0516025_101_307 65
436 3300049592 Ga0501076_1059084 Ga0501076_1059084_90_293 65
437 3300049593 Ga0501077_0020871 Ga0501077_0020871_3554_3760 65
438 3300049593 Ga0501077_0087032 Ga0501077_0087032_1556_1786 65
439 3300049593 Ga0501077_0511652 Ga0501077_0511652_360_563 65
440 3300049593 Ga0501077_0831726 Ga0501077_0831726_184_402 65
441 3300049671 Ga0501238_007181 Ga0501238_007181_380_580 65
442 3300049674 Ga0501242_052263 Ga0501242_052263_150_350 65
443 3300049708 Ga0501245_110671 Ga0501245_110671_212_418 65
444 3300049741 Ga0501079_0197908 Ga0501079_0197908_896_1102 65
445 3300049741 Ga0501079_0718271 Ga0501079_0718271_78_281 65
446 3300049741 Ga0501079_0942056 Ga0501079_0942056_347_547 65
447 3300049742 Ga0501080_0010339 Ga0501080_0010339_6820_7023 65
448 3300049742 Ga0501080_0017194 Ga0501080_0017194_5112_5312 65
449 3300049742 Ga0501080_0084954 Ga0501080_0084954_2124_2333 65
450 3300049742 Ga0501080_0102533 Ga0501080_0102533_1855_2061 65
451 3300049742 Ga0501080_0669241 Ga0501080_0669241_299_505 65
452 3300049742 Ga0501080_1611351 Ga0501080_1611351_112_318 65
453 3300049743 Ga0501081_0302407 Ga0501081_0302407_574_795 65
454 3300049743 Ga0501081_0560162 Ga0501081_0560162_185_391 65
455 3300049744 Ga0501083_0020957 Ga0501083_0020957_1309_1512 65
456 3300049744 Ga0501083_0030622 Ga0501083_0030622_1657_1860 65
457 3300049744 Ga0501083_0190312 Ga0501083_0190312_317_526 65
458 3300049744 Ga0501083_0457552 Ga0501083_0457552_247_453 65
459 3300049744 Ga0501083_0506726 Ga0501083_0506726_263_469 65
460 3300049744 Ga0501083_0545104 Ga0501083_0545104_44_268 65
461 3300049744 Ga0501083_0988170 Ga0501083_0988170_73_273 65
462 3300049744 Ga0501083_1087249 Ga0501083_1087249_179_379 65
463 3300049776 Ga0501280_005024 Ga0501280_005024_1005_1205 65
464 3300049822 Ga0501035_0009166 Ga0501035_0009166_8158_8358 65
465 3300049822 Ga0501035_0043204 Ga0501035_0043204_3114_3314 65
466 3300049822 Ga0501035_0115964 Ga0501035_0115964_839_1045 65
467 3300049822 Ga0501035_0618150 Ga0501035_0618150_528_731 65
468 3300049823 Ga0501044_0000234 Ga0501044_0000234_64650_64850 65
469 3300049823 Ga0501044_0033457 Ga0501044_0033457_2323_2526 65
470 3300049823 Ga0501044_0052796 Ga0501044_0052796_314_520 65
471 3300049823 Ga0501044_1107833 Ga0501044_1107833_47_253 65
472 3300049824 Ga0501045_0820129 Ga0501045_0820129_419_619 65
473 3300050489 nmdc:mga03683_421963_c1 nmdc:mga03683_421963_c1_144_344 65
474 3300050490 nmdc:mga03n38_161849_c1 nmdc:mga03n38_161849_c1_897_1106 65
475 3300050491 nmdc:mga00v17_1284_c1 nmdc:mga00v17_1284_c1_7438_7638 65
476 3300050491 nmdc:mga00v17_512278_c1 nmdc:mga00v17_512278_c1_25_225 65
477 3300050492 nmdc:mga0yw44_625040_c1 nmdc:mga0yw44_625040_c1_116_316 65
478 3300050492 nmdc:mga0yw44_669865_c1 nmdc:mga0yw44_669865_c1_386_643 65
479 3300050493 nmdc:mga0k408_102085_c1 nmdc:mga0k408_102085_c1_1401_1607 65
480 3300050493 nmdc:mga0k408_312241_c1 nmdc:mga0k408_312241_c1_297_497 65
481 3300050494 nmdc:mga06z11_119069_c1 nmdc:mga06z11_119069_c1_682_882 65
482 3300050494 nmdc:mga06z11_296619_c1 nmdc:mga06z11_296619_c1_674_883 65
483 3300050494 nmdc:mga06z11_296640_c1 nmdc:mga06z11_296640_c1_561_767 65
484 3300050496 nmdc:mga07m45_672954_c1 nmdc:mga07m45_672954_c1_138_344 65
485 3300050507 nmdc:mga05p37_235686_c1 nmdc:mga05p37_235686_c1_1061_1264 65
486 3300050507 nmdc:mga05p37_568202_c1 nmdc:mga05p37_568202_c1_638_838 65
487 3300050507 nmdc:mga05p37_58409_c1 nmdc:mga05p37_58409_c1_767_988 65
488 3300050508 nmdc:mga09592_1159694_c1 nmdc:mga09592_1159694_c1_382_585 65
489 3300050508 nmdc:mga09592_724683_c1 nmdc:mga09592_724683_c1_66_287 65
490 3300050508 nmdc:mga09592_888430_c1 nmdc:mga09592_888430_c1_324_527 65
491 3300050509 nmdc:mga0qj67_1562554_c1 nmdc:mga0qj67_1562554_c1_169_372 65
492 3300050509 nmdc:mga0qj67_794079_c1 nmdc:mga0qj67_794079_c1_67_270 65
493 3300050510 nmdc:mga06r32_1083615_c1 nmdc:mga06r32_1083615_c1_227_448 65
494 3300050510 nmdc:mga06r32_551432_c1 nmdc:mga06r32_551432_c1_427_630 65
495 3300050510 nmdc:mga06r32_779416_c1 nmdc:mga06r32_779416_c1_673_879 65
496 3300050511 nmdc:mga08y16_100818_c1 nmdc:mga08y16_100818_c1_293_496 65
497 3300050511 nmdc:mga08y16_37233_c1 nmdc:mga08y16_37233_c1_3828_4049 65
498 3300050511 nmdc:mga08y16_9879_c2 nmdc:mga08y16_9879_c2_4925_5128 65
499 3300050512 nmdc:mga0n895_423292_c1 nmdc:mga0n895_423292_c1_674_877 65
500 3300050512 nmdc:mga0n895_47595_c1 nmdc:mga0n895_47595_c1_451_759 65
501 3300050512 nmdc:mga0n895_483706_c1 nmdc:mga0n895_483706_c1_269_469 65
502 3300050513 nmdc:mga0rr50_223414_c1 nmdc:mga0rr50_223414_c1_582_785 65
503 3300050513 nmdc:mga0rr50_444944_c1 nmdc:mga0rr50_444944_c1_579_887 65
504 3300050515 nmdc:mga0a205_525966_c1 nmdc:mga0a205_525966_c1_435_743 65
505 3300050515 nmdc:mga0a205_79259_c1 nmdc:mga0a205_79259_c1_2349_2552 65
506 3300050516 nmdc:mga0sz30_170332_c1 nmdc:mga0sz30_170332_c1_326_532 65
507 3300050516 nmdc:mga0sz30_549993_c1 nmdc:mga0sz30_549993_c1_26_238 65
508 3300053085 Ga0495619_1099174 Ga0495619_1099174_219_422 65
509 3300053087 Ga0500643_091036 Ga0500643_091036_457_657 65
510 3300053087 Ga0500643_168855 Ga0500643_168855_96_308 65
511 3300053093 Ga0500651_0224729 Ga0500651_0224729_283_495 65
512 3300053104 Ga0500556_0000009 Ga0500556_0000009_148328_148537 65
513 3300053108 Ga0500562_019707 Ga0500562_019707_790_1017 65
514 3300053109 Ga0500569_090116 Ga0500569_090116_78_290 65
515 3300053122 Ga0500608_085894 Ga0500608_085894_1078_1290 65
516 3300053131 Ga0500652_116740 Ga0500652_116740_13_213 65
517 3300053133 Ga0500655_132156 Ga0500655_132156_142_354 65
518 3300053134 Ga0500658_0258922 Ga0500658_0258922_414_614 65
519 3300053137 Ga0500561_0013973 Ga0500561_0013973_615_827 65
520 3300053139 Ga0500568_0281560 Ga0500568_0281560_130_330 65
521 3300053142 Ga0500577_0043076 Ga0500577_0043076_901_1113 65
522 3300053146 Ga0500588_0004535 Ga0500588_0004535_809_1021 65
523 3300053151 Ga0500604_0291867 Ga0500604_0291867_336_536 65
524 3300053153 Ga0500616_0024839 Ga0500616_0024839_1600_1800 65
525 3300053153 Ga0500616_0042639 Ga0500616_0042639_2138_2350 65
526 3300053156 Ga0500622_0001277 Ga0500622_0001277_19492_19692 65
527 3300053156 Ga0500622_0008990 Ga0500622_0008990_4996_5208 65
528 3300053156 Ga0500622_0269252 Ga0500622_0269252_187_396 65
529 3300053157 Ga0500624_029853 Ga0500624_029853_470_682 65
530 3300053158 Ga0500627_0147216 Ga0500627_0147216_445_657 65
531 3300053158 Ga0500627_0415870 Ga0500627_0415870_270_470 65
532 3300053161 Ga0500634_0068159 Ga0500634_0068159_566_778 65
533 3300053177 Ga0500636_0009188 Ga0500636_0009188_521_733 65
534 3300053730 Ga0500645_074069 Ga0500645_074069_193_402 65
535 3300053730 Ga0500645_201468 Ga0500645_201468_238_450 65
536 3300054114 Ga0501084_0023050 Ga0501084_0023050_2789_2992 65
537 3300054114 Ga0501084_0218577 Ga0501084_0218577_642_872 65
538 3300054114 Ga0501084_0381809 Ga0501084_0381809_887_1090 65
539 3300054114 Ga0501084_0565365 Ga0501084_0565365_566_772 65
540 3300059491 Ga0587070_024864 Ga0587070_024864_748_948 65
541 3300059493 Ga0587077_011314 Ga0587077_011314_757_957 65
542 3300059493 Ga0587077_013322 Ga0587077_013322_10_210 65
543 3300059503 Ga0587080_009823 Ga0587080_009823_461_661 65
544 3300059506 Ga0587085_021949 Ga0587085_021949_552_755 65
545 3300059507 Ga0587086_080249 Ga0587086_080249_213_416 65
546 3300059509 Ga0587089_113809 Ga0587089_113809_96_299 65
547 3300059510 Ga0587090_003741 Ga0587090_003741_751_951 65
548 3300059605 Ga0587106_000771 Ga0587106_000771_701_901 65
549 3300059607 Ga0587125_061066 Ga0587125_061066_278_481 65
550 3300059623 Ga0587101_003961 Ga0587101_003961_161_361 65
551 3300059623 Ga0587101_097169 Ga0587101_097169_257_457 65
552 3300059639 Ga0587062_015009 Ga0587062_015009_296_496 65
553 3300059639 Ga0587062_087362 Ga0587062_087362_124_327 65
554 3300059641 Ga0587068_002490 Ga0587068_002490_1410_1610 65
555 3300059642 Ga0587069_027693 Ga0587069_027693_120_320 65
556 3300059643 Ga0587072_072792 Ga0587072_072792_391_594 65
557 3300059645 Ga0587076_006671 Ga0587076_006671_646_846 65
558 3300059652 Ga0587107_075120 Ga0587107_075120_324_524 65
559 3300060346 Ga0587111_0000057 Ga0587111_0000057_136_342 65
560 3300060346 Ga0587111_0017505 Ga0587111_0017505_804_1004 65
561 3300060346 Ga0587111_0177517 Ga0587111_0177517_205_408 65
562 3300060353 Ga0501082_0017998 Ga0501082_0017998_2106_2312 65
563 3300060353 Ga0501082_0049749 Ga0501082_0049749_1471_1674 65
564 3300060353 Ga0501082_0084660 Ga0501082_0084660_752_958 65
565 3300060353 Ga0501082_0325161 Ga0501082_0325161_1014_1244 65
566 3300060353 Ga0501082_0348793 Ga0501082_0348793_369_575 65
567 3300060353 Ga0501082_0447594 Ga0501082_0447594_602_805 65
568 3300060353 Ga0501082_0676492 Ga0501082_0676492_297_506 65
569 3300060353 Ga0501082_0835902 Ga0501082_0835902_217_417 65
570 3300060353 Ga0501082_1444350 Ga0501082_1444350_22_231 65
571 3300061734 Ga0530510_0056862 Ga0530510_0056862_1217_1423 65
572 3300061734 Ga0530510_0373431 Ga0530510_0373431_147_359 65
573 3300061734 Ga0530510_0378904 Ga0530510_0378904_673_879 65
574 3300061734 Ga0530510_1306601 Ga0530510_1306601_206_412 65
575 iso_pu_bacteria 2841911363 2841913387 65
576 iso_pu_bacteria 2841917233 2841919134 65
577 iso_pu_bacteria 8002060224 8002061405 65
578 iso_pu_bacteria 8004703790 8004710422 65

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

4

59

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a57-assembly1.cif.gz_2 cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.9883 4 60
5kcr-assembly1.cif.gz_12 cryo-em structure of the escherichia coli 70s ribosome in complex with antibiotic avilamycin c, mrna and p-site trna at 3.6a resolution 0.9869 2 62
4ybb-assembly1.cif.gz_DZ high-resolution structure of the escherichia coli ribosome 0.9865 2 62
8a63-assembly1.cif.gz_2 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9855 4 60
5gad-assembly1.cif.gz_Z rnc-srp-sr complex early state 0.985 2 62
ID Description Score Start End Superfamily
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.976 10 64 1.10.287.310
4wceV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9671 2 64 1.10.287.310
1vq8V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9625 1 61 1.10.287.310
3cclV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9625 1 61 1.10.287.310
3cc7V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9624 1 61 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A127EWI9-F1-model_v4 Large ribosomal subunit protein uL29 1.004 1 63 GO:0003735
GO:0006412
GO:0022625
AF-A0A2N5JX79-F1-model_v4 deleted 1.004 1 64
AF-A0A2G2GN20-F1-model_v4 Large ribosomal subunit protein uL29 1.003 1 64 GO:0003735
GO:0006412
GO:0022625
AF-A0A177QAN0-F1-model_v4 Large ribosomal subunit protein uL29 1.002 1 64 GO:0003735
GO:0006412
GO:0022625
AF-A0A424IU50-F1-model_v4 Large ribosomal subunit protein uL29 1.002 1 64 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
88.99 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map