F465709
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 306 | 574 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100822873|Ga0068864_1008228733 |
| Length | 81 |
| Sequence | MKAADIRLMTSDQQVEEIDRLKKEQFNLRFQRASGQLENTARVRQVRRDIARLTTIASQDAKKPKTAAPAKAAPKKKTKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 2 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 54 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 55 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 85 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 95 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 139 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 140 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 141 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 142 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 144 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 145 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 146 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 149 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 188 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 189 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 190 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 191 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 236 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 243 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 267 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 268 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 269 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 270 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 271 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 272 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 276 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 280 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 281 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 305 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 306 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.97 |
| Metatranscriptomes | 9.34 |
| Isolates | 0.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.86 |
| Nodule | 0.87 |
| Rhizoplane | 3.11 |
| Rhizosphere | 81.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 2 | JGI25405J52794_10041760 | 3300003911 | Bacteria | 971 |
| 3 | Ga0065704_10114286 | 3300005289 | Bacteria | 1894 |
| 4 | Ga0070680_100099273 | 3300005336 | Bacteria | 2416 |
| 5 | Ga0070680_100254677 | 3300005336 | Bacteria | 1485 |
| 6 | Ga0070680_100552650 | 3300005336 | Bacteria | 987 |
| 7 | Ga0070680_101985014 | 3300005336 | Bacteria | 504 |
| 8 | Ga0070689_101321229 | 3300005340 | Bacteria | 650 |
| 9 | Ga0070692_10860787 | 3300005345 | Bacteria | 624 |
| 10 | Ga0070668_101457376 | 3300005347 | Bacteria | 625 |
| 11 | Ga0070668_102099616 | 3300005347 | Bacteria | 522 |
| 12 | Ga0070705_100586427 | 3300005440 | Bacteria | 860 |
| 13 | Ga0070663_100001615 | 3300005455 | Bacteria | 12447 |
| 14 | Ga0070678_100961198 | 3300005456 | Bacteria | 783 |
| 15 | Ga0070681_10238328 | 3300005458 | Bacteria | 1733 |
| 16 | Ga0070681_10666110 | 3300005458 | Bacteria | 956 |
| 17 | Ga0070681_10810161 | 3300005458 | Bacteria | 854 |
| 18 | Ga0070681_11291366 | 3300005458 | Bacteria | 653 |
| 19 | Ga0070698_101707381 | 3300005471 | Bacteria | 582 |
| 20 | Ga0070679_100049286 | 3300005530 | Bacteria | 4194 |
| 21 | Ga0068853_100013375 | 3300005539 | Bacteria | 6698 |
| 22 | Ga0070695_100893997 | 3300005545 | Bacteria | 717 |
| 23 | Ga0070693_101108505 | 3300005547 | Bacteria | 604 |
| 24 | Ga0070665_100006166 | 3300005548 | Bacteria | 12264 |
| 25 | Ga0070665_100319540 | 3300005548 | Bacteria | 1557 |
| 26 | Ga0070665_101021496 | 3300005548 | Bacteria | 839 |
| 27 | Ga0070665_102085774 | 3300005548 | Bacteria | 572 |
| 28 | Ga0070704_101816982 | 3300005549 | Bacteria | 564 |
| 29 | Ga0068856_100200510 | 3300005614 | Bacteria | 2010 |
| 30 | Ga0068864_100822873 | 3300005618 | Bacteria | 914 |
| 31 | Ga0068864_101815125 | 3300005618 | Bacteria | 615 |
| 32 | Ga0068861_101161149 | 3300005719 | Bacteria | 745 |
| 33 | Ga0068861_102240121 | 3300005719 | Bacteria | 548 |
| 34 | Ga0068862_100749614 | 3300005844 | Bacteria | 950 |
| 35 | Ga0068862_100988724 | 3300005844 | Bacteria | 831 |
| 36 | Ga0068862_101214985 | 3300005844 | Bacteria | 753 |
| 37 | Ga0068862_101379067 | 3300005844 | Bacteria | 708 |
| 38 | Ga0081455_10001008 | 3300005937 | Bacteria | 35646 |
| 39 | Ga0081455_10019145 | 3300005937 | Bacteria | 6487 |
| 40 | Ga0081538_10003741 | 3300005981 | Bacteria | 14245 |
| 41 | Ga0081538_10043084 | 3300005981 | Bacteria | 2840 |
| 42 | Ga0081538_10152960 | 3300005981 | Bacteria | 1041 |
| 43 | Ga0081540_1008438 | 3300005983 | Bacteria | 7199 |
| 44 | Ga0081540_1043521 | 3300005983 | Bacteria | 2302 |
| 45 | Ga0075365_10210208 | 3300006038 | Bacteria | 1364 |
| 46 | Ga0075365_10431230 | 3300006038 | Bacteria | 931 |
| 47 | Ga0075363_100397590 | 3300006048 | Bacteria | 809 |
| 48 | Ga0075364_10067532 | 3300006051 | Bacteria | 2350 |
| 49 | Ga0075364_10359037 | 3300006051 | Bacteria | 993 |
| 50 | Ga0075364_10517391 | 3300006051 | Bacteria | 816 |
| 51 | Ga0075432_10376983 | 3300006058 | Bacteria | 607 |
| 52 | Ga0075367_10314485 | 3300006178 | Bacteria | 986 |
| 53 | Ga0075367_10323469 | 3300006178 | Bacteria | 972 |
| 54 | Ga0075369_10048331 | 3300006186 | Bacteria | 1836 |
| 55 | Ga0075369_10423656 | 3300006186 | Bacteria | 629 |
| 56 | Ga0075366_10042037 | 3300006195 | Bacteria | 2706 |
| 57 | Ga0075366_10316635 | 3300006195 | Bacteria | 955 |
| 58 | Ga0097621_101991995 | 3300006237 | Bacteria | 555 |
| 59 | Ga0075430_100740905 | 3300006846 | Bacteria | 810 |
| 60 | Ga0075430_101707119 | 3300006846 | Bacteria | 517 |
| 61 | Ga0075431_100769041 | 3300006847 | Bacteria | 938 |
| 62 | Ga0075431_101131764 | 3300006847 | Bacteria | 747 |
| 63 | Ga0075433_10418300 | 3300006852 | Bacteria | 1182 |
| 64 | Ga0075434_100237438 | 3300006871 | Bacteria | 1843 |
| 65 | Ga0075434_100252710 | 3300006871 | Bacteria | 1782 |
| 66 | Ga0075429_100197579 | 3300006880 | Bacteria | 1762 |
| 67 | Ga0075436_101365257 | 3300006914 | Bacteria | 537 |
| 68 | Ga0079104_1000547 | 3300006946 | Bacteria | 39191 |
| 69 | Ga0075435_100763996 | 3300007076 | Bacteria | 841 |
| 70 | Ga0075435_101374118 | 3300007076 | Bacteria | 619 |
| 71 | Ga0105250_10572582 | 3300009092 | Bacteria | 520 |
| 72 | Ga0111539_10092029 | 3300009094 | Bacteria | 3563 |
| 73 | Ga0111539_10682184 | 3300009094 | Bacteria | 1196 |
| 74 | Ga0105245_10327906 | 3300009098 | Bacteria | 1510 |
| 75 | Ga0114129_10079719 | 3300009147 | Bacteria | 4552 |
| 76 | Ga0114129_10778840 | 3300009147 | Bacteria | 1222 |
| 77 | Ga0105243_11232115 | 3300009148 | Bacteria | 763 |
| 78 | Ga0105243_11721412 | 3300009148 | Bacteria | 656 |
| 79 | Ga0105243_12682766 | 3300009148 | Bacteria | 538 |
| 80 | Ga0105248_10723019 | 3300009177 | Bacteria | 1123 |
| 81 | Ga0105248_10983695 | 3300009177 | Bacteria | 953 |
| 82 | Ga0105237_10586873 | 3300009545 | Bacteria | 1121 |
| 83 | Ga0105237_10747504 | 3300009545 | Bacteria | 984 |
| 84 | Ga0105237_10822763 | 3300009545 | Bacteria | 935 |
| 85 | Ga0105238_12377522 | 3300009551 | Bacteria | 565 |
| 86 | Ga0105249_10014071 | 3300009553 | Bacteria | 7073 |
| 87 | Ga0105249_10410828 | 3300009553 | Bacteria | 1386 |
| 88 | Ga0105249_11347390 | 3300009553 | Bacteria | 785 |
| 89 | Ga0105249_11425620 | 3300009553 | Bacteria | 765 |
| 90 | Ga0105249_12411574 | 3300009553 | Bacteria | 599 |
| 91 | Ga0105249_13431225 | 3300009553 | Bacteria | 510 |
| 92 | Ga0105030_128379 | 3300009987 | Bacteria | 517 |
| 93 | Ga0105028_109128 | 3300009993 | Bacteria | 1038 |
| 94 | Ga0099796_10576206 | 3300010159 | Bacteria | 507 |
| 95 | Ga0105239_10984974 | 3300010375 | Bacteria | 969 |
| 96 | Ga0105239_12407305 | 3300010375 | Bacteria | 613 |
| 97 | Ga0157347_1037009 | 3300012502 | Bacteria | 632 |
| 98 | Ga0157373_11139525 | 3300013100 | Bacteria | 586 |
| 99 | Ga0157369_11151176 | 3300013105 | Bacteria | 792 |
| 100 | Ga0157374_11492341 | 3300013296 | Bacteria | 699 |
| 101 | Ga0157378_10464731 | 3300013297 | Bacteria | 1258 |
| 102 | Ga0157378_10639748 | 3300013297 | Bacteria | 1078 |
| 103 | Ga0163163_11740043 | 3300014325 | Bacteria | 684 |
| 104 | Ga0157380_10310935 | 3300014326 | Bacteria | 1456 |
| 105 | Ga0157380_10398047 | 3300014326 | Bacteria | 1306 |
| 106 | Ga0182008_10408056 | 3300014497 | Bacteria | 731 |
| 107 | Ga0182005_1002173 | 3300015265 | Bacteria | 7236 |
| 108 | Ga0206350_10535392 | 3300020080 | Bacteria | 534 |
| 109 | Ga0206353_11323013 | 3300020082 | Bacteria | 1333 |
| 110 | Ga0209025_1041276 | 3300025294 | Bacteria | 1979 |
| 111 | Ga0207707_10357488 | 3300025912 | Bacteria | 1258 |
| 112 | Ga0207707_10863067 | 3300025912 | Bacteria | 750 |
| 113 | Ga0207662_11096961 | 3300025918 | Bacteria | 566 |
| 114 | Ga0207681_10084218 | 3300025923 | Bacteria | 2253 |
| 115 | Ga0207694_11678532 | 3300025924 | Bacteria | 535 |
| 116 | Ga0207659_11027428 | 3300025926 | Bacteria | 709 |
| 117 | Ga0207687_10977447 | 3300025927 | Bacteria | 726 |
| 118 | Ga0207709_10969606 | 3300025935 | Bacteria | 694 |
| 119 | Ga0207709_11043522 | 3300025935 | Bacteria | 669 |
| 120 | Ga0207670_10553176 | 3300025936 | Bacteria | 940 |
| 121 | Ga0207711_10140909 | 3300025941 | Bacteria | 2169 |
| 122 | Ga0207711_11132271 | 3300025941 | Bacteria | 724 |
| 123 | Ga0207712_10273112 | 3300025961 | Bacteria | 1376 |
| 124 | Ga0207712_11127724 | 3300025961 | Bacteria | 699 |
| 125 | Ga0207668_10714327 | 3300025972 | Bacteria | 882 |
| 126 | Ga0207668_10917752 | 3300025972 | Bacteria | 780 |
| 127 | Ga0207668_11307576 | 3300025972 | Bacteria | 653 |
| 128 | Ga0207678_10548627 | 3300026067 | Bacteria | 1011 |
| 129 | Ga0207678_11372282 | 3300026067 | Bacteria | 625 |
| 130 | Ga0207708_11768763 | 3300026075 | Bacteria | 542 |
| 131 | Ga0207675_101467341 | 3300026118 | Bacteria | 703 |
| 132 | Ga0207675_101592654 | 3300026118 | Bacteria | 674 |
| 133 | Ga0207683_10815670 | 3300026121 | Bacteria | 866 |
| 134 | Ga0209281_1000573 | 3300027111 | Bacteria | 43668 |
| 135 | Ga0209179_1030741 | 3300027512 | Bacteria | 1099 |
| 136 | Ga0209813_10225347 | 3300027866 | Bacteria | 703 |
| 137 | Ga0209974_10185273 | 3300027876 | Bacteria | 764 |
| 138 | Ga0209974_10210068 | 3300027876 | Bacteria | 721 |
| 139 | Ga0209974_10258863 | 3300027876 | Bacteria | 657 |
| 140 | Ga0207428_10020203 | 3300027907 | Bacteria | 5663 |
| 141 | Ga0207428_10185324 | 3300027907 | Bacteria | 1571 |
| 142 | Ga0268266_10036033 | 3300028379 | Bacteria | 4209 |
| 143 | Ga0265318_10015702 | 3300028577 | Bacteria | 3142 |
| 144 | Ga0265318_10361672 | 3300028577 | Bacteria | 530 |
| 145 | Ga0307515_10058447 | 3300028794 | Bacteria | 5553 |
| 146 | Ga0265338_10609169 | 3300028800 | Bacteria | 760 |
| 147 | Ga0265338_11085278 | 3300028800 | Bacteria | 540 |
| 148 | Ga0265324_10220715 | 3300029957 | Bacteria | 644 |
| 149 | Ga0314311_1193439 | 3300030733 | Bacteria | 619 |
| 150 | Ga0265760_10077843 | 3300031090 | Bacteria | 1024 |
| 151 | Ga0265330_10125296 | 3300031235 | Bacteria | 1094 |
| 152 | Ga0265328_10009346 | 3300031239 | Bacteria | 3996 |
| 153 | Ga0265328_10407638 | 3300031239 | Bacteria | 534 |
| 154 | Ga0265320_10357585 | 3300031240 | Bacteria | 645 |
| 155 | Ga0265320_10551472 | 3300031240 | Bacteria | 510 |
| 156 | Ga0265325_10016753 | 3300031241 | Bacteria | 4090 |
| 157 | Ga0265325_10196517 | 3300031241 | Bacteria | 932 |
| 158 | Ga0265329_10024967 | 3300031242 | Bacteria | 1981 |
| 159 | Ga0265329_10185270 | 3300031242 | Bacteria | 682 |
| 160 | Ga0265340_10045117 | 3300031247 | Bacteria | 2154 |
| 161 | Ga0265340_10065829 | 3300031247 | Bacteria | 1725 |
| 162 | Ga0265340_10097663 | 3300031247 | Bacteria | 1367 |
| 163 | Ga0265340_10398266 | 3300031247 | Bacteria | 607 |
| 164 | Ga0265339_10002105 | 3300031249 | Bacteria | 14517 |
| 165 | Ga0265339_10045403 | 3300031249 | Bacteria | 2418 |
| 166 | Ga0265339_10074118 | 3300031249 | Bacteria | 1809 |
| 167 | Ga0265339_10085133 | 3300031249 | Bacteria | 1665 |
| 168 | Ga0265339_10150396 | 3300031249 | Bacteria | 1178 |
| 169 | Ga0265339_10436794 | 3300031249 | Bacteria | 609 |
| 170 | Ga0265331_10037674 | 3300031250 | Bacteria | 2366 |
| 171 | Ga0265331_10087123 | 3300031250 | Bacteria | 1446 |
| 172 | Ga0265316_10015933 | 3300031344 | Bacteria | 6544 |
| 173 | Ga0265316_10030464 | 3300031344 | Bacteria | 4422 |
| 174 | Ga0265316_10407169 | 3300031344 | Bacteria | 979 |
| 175 | Ga0265316_10561013 | 3300031344 | Bacteria | 812 |
| 176 | Ga0265316_10883304 | 3300031344 | Bacteria | 625 |
| 177 | Ga0307408_101310200 | 3300031548 | Bacteria | 679 |
| 178 | Ga0265313_10000031 | 3300031595 | Bacteria | 128981 |
| 179 | Ga0265313_10052060 | 3300031595 | Bacteria | 1956 |
| 180 | Ga0265313_10053734 | 3300031595 | Bacteria | 1916 |
| 181 | Ga0265313_10273582 | 3300031595 | Bacteria | 684 |
| 182 | Ga0265313_10275639 | 3300031595 | Bacteria | 680 |
| 183 | Ga0265313_10419109 | 3300031595 | Bacteria | 523 |
| 184 | Ga0265314_10008857 | 3300031711 | Bacteria | 8590 |
| 185 | Ga0265314_10028299 | 3300031711 | Bacteria | 4180 |
| 186 | Ga0265314_10398931 | 3300031711 | Bacteria | 744 |
| 187 | Ga0265314_10458770 | 3300031711 | Bacteria | 677 |
| 188 | Ga0265314_10700573 | 3300031711 | Bacteria | 512 |
| 189 | Ga0265342_10004137 | 3300031712 | Bacteria | 11550 |
| 190 | Ga0265342_10038280 | 3300031712 | Bacteria | 2921 |
| 191 | Ga0265342_10078306 | 3300031712 | Bacteria | 1913 |
| 192 | Ga0265342_10357588 | 3300031712 | Bacteria | 759 |
| 193 | Ga0265342_10587936 | 3300031712 | Bacteria | 562 |
| 194 | Ga0307405_10536335 | 3300031731 | Bacteria | 944 |
| 195 | Ga0307413_10302467 | 3300031824 | Bacteria | 1213 |
| 196 | Ga0307413_11325543 | 3300031824 | Bacteria | 631 |
| 197 | Ga0307410_11695408 | 3300031852 | Bacteria | 560 |
| 198 | Ga0307410_11938016 | 3300031852 | Bacteria | 525 |
| 199 | Ga0307406_10268077 | 3300031901 | Bacteria | 1296 |
| 200 | Ga0307406_10614112 | 3300031901 | Bacteria | 898 |
| 201 | Ga0307407_11472189 | 3300031903 | Bacteria | 538 |
| 202 | Ga0307412_10813782 | 3300031911 | Bacteria | 812 |
| 203 | Ga0307409_100224075 | 3300031995 | Bacteria | 1700 |
| 204 | Ga0307409_100227836 | 3300031995 | Bacteria | 1687 |
| 205 | Ga0307409_100472547 | 3300031995 | Bacteria | 1215 |
| 206 | Ga0307409_101958854 | 3300031995 | Bacteria | 615 |
| 207 | Ga0307416_100537909 | 3300032002 | Bacteria | 1240 |
| 208 | Ga0307416_101625458 | 3300032002 | Bacteria | 751 |
| 209 | Ga0307416_102505778 | 3300032002 | Bacteria | 614 |
| 210 | Ga0307416_103492446 | 3300032002 | Bacteria | 526 |
| 211 | Ga0307414_10741124 | 3300032004 | Bacteria | 892 |
| 212 | Ga0307411_11316798 | 3300032005 | Bacteria | 659 |
| 213 | Ga0307415_100377700 | 3300032126 | Bacteria | 1202 |
| 214 | Ga0307415_100611652 | 3300032126 | Bacteria | 971 |
| 215 | Ga0307415_100898907 | 3300032126 | Bacteria | 816 |
| 216 | Ga0316593_10001189 | 3300032168 | Bacteria | 5568 |
| 217 | Ga0316596_1011427 | 3300033541 | Bacteria | 2169 |
| 218 | Ga0373944_0089856 | 3300035089 | Bacteria | 1025 |
| 219 | Ga0373932_0289120 | 3300035112 | Bacteria | 608 |
| 220 | Ga0373945_0173574 | 3300035116 | Bacteria | 884 |
| 221 | Ga0373956_0610592 | 3300035119 | Bacteria | 521 |
| 222 | Ga0373931_0213407 | 3300035691 | Bacteria | 1159 |
| 223 | Ga0373931_0284553 | 3300035691 | Bacteria | 1016 |
| 224 | Ga0373931_0306281 | 3300035691 | Bacteria | 982 |
| 225 | Ga0373935_0254180 | 3300035692 | Bacteria | 1230 |
| 226 | Ga0373947_0085526 | 3300035725 | Bacteria | 1959 |
| 227 | Ga0373925_0144587 | 3300037068 | Bacteria | 1863 |
| 228 | Ga0395899_0000073 | 3300037312 | Bacteria | 181387 |
| 229 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 230 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 231 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 232 | Ga0436364_0607066 | 3300037853 | Bacteria | 517 |
| 233 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 234 | Ga0400483_059010 | 3300039062 | Bacteria | 5318 |
| 235 | Ga0400483_165422 | 3300039062 | Bacteria | 6949 |
| 236 | Ga0400483_217885 | 3300039062 | Bacteria | 12374 |
| 237 | Ga0400483_243738 | 3300039062 | Bacteria | 5430 |
| 238 | Ga0400483_281008 | 3300039062 | Bacteria | 2348 |
| 239 | Ga0436365_0527365 | 3300039437 | Bacteria | 739 |
| 240 | Ga0436360_0566130 | 3300039438 | Bacteria | 781 |
| 241 | Ga0436360_0590269 | 3300039438 | Bacteria | 513 |
| 242 | Ga0436363_1377737 | 3300039450 | Unclassified | 556 |
| 243 | Ga0436362_0004730 | 3300039453 | Bacteria | 1043 |
| 244 | Ga0439465_0119634 | 3300041413 | Bacteria | 922 |
| 245 | Ga0451802_1457526 | 3300041460 | Bacteria | 535 |
| 246 | Ga0451833_1093358 | 3300041491 | Bacteria | 597 |
| 247 | Ga0451855_0574687 | 3300041511 | Bacteria | 786 |
| 248 | Ga0439431_0103480 | 3300041997 | Bacteria | 784 |
| 249 | Ga0439432_032485 | 3300042006 | Bacteria | 1683 |
| 250 | Ga0439449_0092967 | 3300042007 | Bacteria | 1114 |
| 251 | Ga0439456_070050 | 3300042013 | Bacteria | 777 |
| 252 | Ga0439462_0152722 | 3300042015 | Bacteria | 649 |
| 253 | Ga0439434_0254475 | 3300042435 | Bacteria | 601 |
| 254 | Ga0466963_0250593 | 3300044694 | Bacteria | 1243 |
| 255 | Ga0466967_1115804 | 3300045976 | Bacteria | 786 |
| 256 | Ga0495603_0312515 | 3300046455 | Bacteria | 902 |
| 257 | Ga0495638_0006964 | 3300046460 | Bacteria | 8163 |
| 258 | Ga0495638_0040593 | 3300046460 | Bacteria | 2948 |
| 259 | Ga0495638_0118029 | 3300046460 | Bacteria | 1570 |
| 260 | Ga0495638_0240762 | 3300046460 | Bacteria | 1002 |
| 261 | Ga0495605_0476168 | 3300046474 | Bacteria | 512 |
| 262 | Ga0495639_0214279 | 3300046475 | Bacteria | 945 |
| 263 | Ga0495584_0188772 | 3300046491 | Bacteria | 1047 |
| 264 | Ga0495610_0018183 | 3300046512 | Bacteria | 3978 |
| 265 | Ga0495643_0103412 | 3300046522 | Bacteria | 1457 |
| 266 | Ga0495643_0120493 | 3300046522 | Bacteria | 1326 |
| 267 | Ga0495597_0190693 | 3300046542 | Bacteria | 825 |
| 268 | Ga0495656_0105356 | 3300046615 | Bacteria | 1311 |
| 269 | Ga0495656_0517149 | 3300046615 | Bacteria | 634 |
| 270 | Ga0495611_0467739 | 3300046648 | Bacteria | 574 |
| 271 | Ga0495625_0084671 | 3300046660 | Bacteria | 2202 |
| 272 | Ga0495625_0292882 | 3300046660 | Bacteria | 1044 |
| 273 | Ga0495625_0294702 | 3300046660 | Bacteria | 1040 |
| 274 | Ga0495625_0659591 | 3300046660 | Bacteria | 622 |
| 275 | Ga0495669_0572117 | 3300046684 | Bacteria | 550 |
| 276 | Ga0495670_0071023 | 3300046691 | Bacteria | 1762 |
| 277 | Ga0495671_0122761 | 3300046692 | Bacteria | 1267 |
| 278 | Ga0495649_0291237 | 3300046694 | Bacteria | 833 |
| 279 | Ga0495589_0221442 | 3300046794 | Bacteria | 889 |
| 280 | Ga0495660_0497900 | 3300046810 | Bacteria | 521 |
| 281 | Ga0495636_0461249 | 3300047318 | Bacteria | 611 |
| 282 | Ga0495672_0117241 | 3300047320 | Bacteria | 1421 |
| 283 | Ga0495672_0303828 | 3300047320 | Bacteria | 755 |
| 284 | Ga0495673_0135193 | 3300047469 | Bacteria | 966 |
| 285 | Ga0495686_0189107 | 3300047472 | Bacteria | 1188 |
| 286 | Ga0495593_0401814 | 3300047673 | Bacteria | 685 |
| 287 | Ga0496101_0010556 | 3300048904 | Bacteria | 6102 |
| 288 | Ga0496101_0659266 | 3300048904 | Bacteria | 827 |
| 289 | Ga0496101_1458155 | 3300048904 | Bacteria | 533 |
| 290 | Ga0496102_0426059 | 3300048905 | Bacteria | 1246 |
| 291 | Ga0496102_1551203 | 3300048905 | Bacteria | 581 |
| 292 | Ga0496104_0070384 | 3300048907 | Bacteria | 3325 |
| 293 | Ga0496104_0564312 | 3300048907 | Bacteria | 1049 |
| 294 | Ga0496105_0005504 | 3300048908 | Bacteria | 9611 |
| 295 | Ga0496108_0129057 | 3300048911 | Bacteria | 2172 |
| 296 | Ga0496109_0294169 | 3300048912 | Bacteria | 1531 |
| 297 | Ga0496110_0008141 | 3300048913 | Bacteria | 8422 |
| 298 | Ga0496111_0023962 | 3300048914 | Bacteria | 4291 |
| 299 | Ga0496112_0034695 | 3300048915 | Bacteria | 4910 |
| 300 | Ga0496113_0004259 | 3300048916 | Bacteria | 8765 |
| 301 | Ga0496114_0445680 | 3300048917 | Bacteria | 1146 |
| 302 | Ga0496114_1602423 | 3300048917 | Bacteria | 539 |
| 303 | Ga0496115_0878597 | 3300048918 | Bacteria | 692 |
| 304 | Ga0496119_0000372 | 3300048922 | Bacteria | 62094 |
| 305 | Ga0496119_0004353 | 3300048922 | Bacteria | 14129 |
| 306 | Ga0496119_0019758 | 3300048922 | Bacteria | 4942 |
| 307 | Ga0496120_0099786 | 3300048923 | Bacteria | 1536 |
| 308 | Ga0496120_0184638 | 3300048923 | Bacteria | 1021 |
| 309 | Ga0496121_0246048 | 3300048924 | Bacteria | 1243 |
| 310 | Ga0496121_0459977 | 3300048924 | Bacteria | 818 |
| 311 | Ga0496122_0135780 | 3300048925 | Bacteria | 1550 |
| 312 | Ga0496123_0017503 | 3300048926 | Bacteria | 5761 |
| 313 | Ga0496123_0502510 | 3300048926 | Bacteria | 529 |
| 314 | Ga0496124_0698119 | 3300048927 | Bacteria | 644 |
| 315 | Ga0496124_0707630 | 3300048927 | Bacteria | 637 |
| 316 | Ga0496125_0017448 | 3300048928 | Bacteria | 6842 |
| 317 | Ga0496125_0064883 | 3300048928 | Bacteria | 2897 |
| 318 | Ga0496126_0344898 | 3300048929 | Bacteria | 1219 |
| 319 | Ga0501306_000381 | 3300049127 | Bacteria | 3282 |
| 320 | Ga0501308_001458 | 3300049128 | Bacteria | 1896 |
| 321 | Ga0501308_002805 | 3300049128 | Bacteria | 1562 |
| 322 | Ga0501310_018342 | 3300049130 | Bacteria | 853 |
| 323 | Ga0501310_033789 | 3300049130 | Bacteria | 689 |
| 324 | Ga0501310_080386 | 3300049130 | Bacteria | 511 |
| 325 | Ga0501304_004606 | 3300049160 | Bacteria | 1052 |
| 326 | Ga0501304_011395 | 3300049160 | Bacteria | 790 |
| 327 | Ga0501305_001751 | 3300049161 | Bacteria | 2205 |
| 328 | Ga0501305_018020 | 3300049161 | Bacteria | 1019 |
| 329 | Ga0501307_000876 | 3300049162 | Bacteria | 2303 |
| 330 | Ga0501307_017944 | 3300049162 | Bacteria | 895 |
| 331 | Ga0501311_002631 | 3300049527 | Bacteria | 1743 |
| 332 | Ga0501312_053243 | 3300049528 | Bacteria | 687 |
| 333 | Ga0501313_001406 | 3300049529 | Bacteria | 2081 |
| 334 | Ga0501313_003461 | 3300049529 | Bacteria | 1571 |
| 335 | Ga0501314_001822 | 3300049530 | Bacteria | 1586 |
| 336 | Ga0501314_023558 | 3300049530 | Bacteria | 653 |
| 337 | Ga0501314_031084 | 3300049530 | Bacteria | 594 |
| 338 | Ga0501315_000060 | 3300049531 | Bacteria | 4828 |
| 339 | Ga0501315_023393 | 3300049531 | Bacteria | 848 |
| 340 | Ga0501317_025997 | 3300049533 | Bacteria | 823 |
| 341 | Ga0501317_026503 | 3300049533 | Bacteria | 818 |
| 342 | Ga0501317_059311 | 3300049533 | Bacteria | 625 |
| 343 | Ga0501318_085348 | 3300049534 | Bacteria | 517 |
| 344 | Ga0501320_003890 | 3300049536 | Bacteria | 1290 |
| 345 | Ga0501335_001588 | 3300049551 | Bacteria | 1759 |
| 346 | Ga0501031_0000651 | 3300049568 | Bacteria | 20547 |
| 347 | Ga0501031_0016670 | 3300049568 | Bacteria | 4771 |
| 348 | Ga0501031_0359462 | 3300049568 | Bacteria | 942 |
| 349 | Ga0501032_0000111 | 3300049569 | Bacteria | 69802 |
| 350 | Ga0501032_0119107 | 3300049569 | Bacteria | 1746 |
| 351 | Ga0501032_0188536 | 3300049569 | Bacteria | 1348 |
| 352 | Ga0501032_0305998 | 3300049569 | Bacteria | 1027 |
| 353 | Ga0501032_0319352 | 3300049569 | Bacteria | 1002 |
| 354 | Ga0501032_0552056 | 3300049569 | Bacteria | 734 |
| 355 | Ga0501033_0011172 | 3300049570 | Bacteria | 6877 |
| 356 | Ga0501033_0059135 | 3300049570 | Bacteria | 2830 |
| 357 | Ga0501033_0139684 | 3300049570 | Bacteria | 1751 |
| 358 | Ga0501033_1122607 | 3300049570 | Bacteria | 522 |
| 359 | Ga0501034_0026519 | 3300049571 | Bacteria | 5901 |
| 360 | Ga0501034_0035212 | 3300049571 | Bacteria | 5076 |
| 361 | Ga0501034_0078177 | 3300049571 | Bacteria | 3313 |
| 362 | Ga0501034_0234612 | 3300049571 | Bacteria | 1782 |
| 363 | Ga0501034_0961905 | 3300049571 | Bacteria | 739 |
| 364 | Ga0501036_0002605 | 3300049572 | Bacteria | 14223 |
| 365 | Ga0501036_0230566 | 3300049572 | Bacteria | 1554 |
| 366 | Ga0501036_0452590 | 3300049572 | Bacteria | 1069 |
| 367 | Ga0501036_0583788 | 3300049572 | Bacteria | 928 |
| 368 | Ga0501036_1235235 | 3300049572 | Bacteria | 608 |
| 369 | Ga0501037_0000131 | 3300049573 | Bacteria | 69802 |
| 370 | Ga0501037_0208097 | 3300049573 | Bacteria | 1380 |
| 371 | Ga0501038_0000109 | 3300049574 | Bacteria | 69802 |
| 372 | Ga0501038_0039812 | 3300049574 | Bacteria | 4110 |
| 373 | Ga0501038_0131427 | 3300049574 | Bacteria | 2055 |
| 374 | Ga0501038_0169820 | 3300049574 | Bacteria | 1766 |
| 375 | Ga0501039_0002279 | 3300049575 | Bacteria | 14235 |
| 376 | Ga0501039_0240450 | 3300049575 | Bacteria | 1423 |
| 377 | Ga0501040_0107203 | 3300049576 | Bacteria | 1952 |
| 378 | Ga0501041_0523920 | 3300049577 | Bacteria | 755 |
| 379 | Ga0501042_0099109 | 3300049578 | Bacteria | 2095 |
| 380 | Ga0501043_0038138 | 3300049579 | Bacteria | 3779 |
| 381 | Ga0501043_0047851 | 3300049579 | Bacteria | 3362 |
| 382 | Ga0501043_0099954 | 3300049579 | Bacteria | 2280 |
| 383 | Ga0501043_0808824 | 3300049579 | Bacteria | 677 |
| 384 | Ga0501043_1011885 | 3300049579 | Bacteria | 591 |
| 385 | Ga0501046_0126860 | 3300049580 | Bacteria | 1938 |
| 386 | Ga0501046_0312805 | 3300049580 | Bacteria | 1145 |
| 387 | Ga0501046_0493855 | 3300049580 | Bacteria | 877 |
| 388 | Ga0501047_0152453 | 3300049581 | Bacteria | 2186 |
| 389 | Ga0501047_0206504 | 3300049581 | Bacteria | 1823 |
| 390 | Ga0501047_0414952 | 3300049581 | Bacteria | 1178 |
| 391 | Ga0501047_0672906 | 3300049581 | Bacteria | 853 |
| 392 | Ga0501047_0782101 | 3300049581 | Bacteria | 770 |
| 393 | Ga0501047_0975116 | 3300049581 | Bacteria | 661 |
| 394 | Ga0501048_0186294 | 3300049582 | Bacteria | 1471 |
| 395 | Ga0501048_0280029 | 3300049582 | Bacteria | 1186 |
| 396 | Ga0501048_1331934 | 3300049582 | Bacteria | 516 |
| 397 | Ga0501067_0091010 | 3300049583 | Bacteria | 1693 |
| 398 | Ga0501067_0140339 | 3300049583 | Bacteria | 1345 |
| 399 | Ga0501067_0175550 | 3300049583 | Bacteria | 1193 |
| 400 | Ga0501067_0286359 | 3300049583 | Bacteria | 917 |
| 401 | Ga0501068_0298881 | 3300049584 | Bacteria | 1030 |
| 402 | Ga0501068_1176173 | 3300049584 | Bacteria | 508 |
| 403 | Ga0501069_0004122 | 3300049585 | Bacteria | 7502 |
| 404 | Ga0501069_0138940 | 3300049585 | Bacteria | 1393 |
| 405 | Ga0501069_0201430 | 3300049585 | Bacteria | 1154 |
| 406 | Ga0501070_0006301 | 3300049586 | Bacteria | 10097 |
| 407 | Ga0501070_0060281 | 3300049586 | Bacteria | 3145 |
| 408 | Ga0501070_0171551 | 3300049586 | Bacteria | 1786 |
| 409 | Ga0501070_0180101 | 3300049586 | Bacteria | 1739 |
| 410 | Ga0501070_0190795 | 3300049586 | Bacteria | 1684 |
| 411 | Ga0501071_0625049 | 3300049587 | Bacteria | 828 |
| 412 | Ga0501072_0008088 | 3300049588 | Bacteria | 7980 |
| 413 | Ga0501072_0490060 | 3300049588 | Bacteria | 972 |
| 414 | Ga0501072_1145878 | 3300049588 | Bacteria | 605 |
| 415 | Ga0501073_0015881 | 3300049589 | Bacteria | 5456 |
| 416 | Ga0501073_0058581 | 3300049589 | Bacteria | 2691 |
| 417 | Ga0501073_0103607 | 3300049589 | Bacteria | 1975 |
| 418 | Ga0501073_0456227 | 3300049589 | Bacteria | 883 |
| 419 | Ga0501073_0625539 | 3300049589 | Bacteria | 743 |
| 420 | Ga0501073_1160906 | 3300049589 | Bacteria | 530 |
| 421 | Ga0501074_0035107 | 3300049590 | Bacteria | 3633 |
| 422 | Ga0501074_0187163 | 3300049590 | Bacteria | 1476 |
| 423 | Ga0501074_0215216 | 3300049590 | Bacteria | 1369 |
| 424 | Ga0501074_0565311 | 3300049590 | Bacteria | 805 |
| 425 | Ga0501074_0599280 | 3300049590 | Bacteria | 779 |
| 426 | Ga0501076_0185791 | 3300049592 | Bacteria | 1695 |
| 427 | Ga0501076_0185876 | 3300049592 | Bacteria | 1695 |
| 428 | Ga0501076_0516025 | 3300049592 | Bacteria | 985 |
| 429 | Ga0501076_1059084 | 3300049592 | Bacteria | 668 |
| 430 | Ga0501077_0020871 | 3300049593 | Bacteria | 4147 |
| 431 | Ga0501077_0087032 | 3300049593 | Bacteria | 1980 |
| 432 | Ga0501077_0511652 | 3300049593 | Bacteria | 770 |
| 433 | Ga0501077_0831726 | 3300049593 | Bacteria | 594 |
| 434 | Ga0501238_007181 | 3300049671 | Bacteria | 1443 |
| 435 | Ga0501242_052263 | 3300049674 | Bacteria | 603 |
| 436 | Ga0501245_110671 | 3300049708 | Bacteria | 568 |
| 437 | Ga0501079_0197908 | 3300049741 | Bacteria | 1569 |
| 438 | Ga0501079_0718271 | 3300049741 | Bacteria | 786 |
| 439 | Ga0501079_0942056 | 3300049741 | Bacteria | 680 |
| 440 | Ga0501080_0010339 | 3300049742 | Bacteria | 8535 |
| 441 | Ga0501080_0017194 | 3300049742 | Bacteria | 6681 |
| 442 | Ga0501080_0084954 | 3300049742 | Bacteria | 2941 |
| 443 | Ga0501080_0102533 | 3300049742 | Bacteria | 2654 |
| 444 | Ga0501080_0363496 | 3300049742 | Bacteria | 1305 |
| 445 | Ga0501080_0669241 | 3300049742 | Bacteria | 917 |
| 446 | Ga0501080_1611351 | 3300049742 | Bacteria | 549 |
| 447 | Ga0501080_1752405 | 3300049742 | Bacteria | 523 |
| 448 | Ga0501081_0302407 | 3300049743 | Bacteria | 1174 |
| 449 | Ga0501081_0560162 | 3300049743 | Bacteria | 854 |
| 450 | Ga0501083_0020957 | 3300049744 | Bacteria | 4543 |
| 451 | Ga0501083_0030622 | 3300049744 | Bacteria | 3695 |
| 452 | Ga0501083_0190312 | 3300049744 | Bacteria | 1339 |
| 453 | Ga0501083_0457552 | 3300049744 | Bacteria | 830 |
| 454 | Ga0501083_0506726 | 3300049744 | Bacteria | 786 |
| 455 | Ga0501083_0545104 | 3300049744 | Bacteria | 755 |
| 456 | Ga0501083_0988170 | 3300049744 | Bacteria | 548 |
| 457 | Ga0501083_1087249 | 3300049744 | Bacteria | 520 |
| 458 | Ga0501280_005024 | 3300049776 | Bacteria | 1908 |
| 459 | Ga0501035_0009166 | 3300049822 | Bacteria | 9204 |
| 460 | Ga0501035_0043204 | 3300049822 | Bacteria | 4062 |
| 461 | Ga0501035_0115964 | 3300049822 | Bacteria | 2344 |
| 462 | Ga0501035_0618150 | 3300049822 | Bacteria | 881 |
| 463 | Ga0501044_0000234 | 3300049823 | Bacteria | 69802 |
| 464 | Ga0501044_0033457 | 3300049823 | Bacteria | 5402 |
| 465 | Ga0501044_0052796 | 3300049823 | Bacteria | 4185 |
| 466 | Ga0501044_0191494 | 3300049823 | Bacteria | 2007 |
| 467 | Ga0501044_1107833 | 3300049823 | Bacteria | 661 |
| 468 | Ga0501045_0820129 | 3300049824 | Bacteria | 685 |
| 469 | nmdc:mga03683_421963_c1 | 3300050489 | Bacteria | 639 |
| 470 | nmdc:mga03n38_161849_c1 | 3300050490 | Bacteria | 1134 |
| 471 | nmdc:mga00v17_1284_c1 | 3300050491 | Bacteria | 13184 |
| 472 | nmdc:mga00v17_512278_c1 | 3300050491 | Bacteria | 777 |
| 473 | nmdc:mga0yw44_625040_c1 | 3300050492 | Bacteria | 732 |
| 474 | nmdc:mga0yw44_669865_c1 | 3300050492 | Bacteria | 705 |
| 475 | nmdc:mga0k408_102085_c1 | 3300050493 | Bacteria | 1692 |
| 476 | nmdc:mga0k408_312241_c1 | 3300050493 | Bacteria | 938 |
| 477 | nmdc:mga06z11_119069_c1 | 3300050494 | Bacteria | 1471 |
| 478 | nmdc:mga06z11_296619_c1 | 3300050494 | Bacteria | 960 |
| 479 | nmdc:mga06z11_296640_c1 | 3300050494 | Bacteria | 960 |
| 480 | nmdc:mga07m45_672954_c1 | 3300050496 | Bacteria | 596 |
| 481 | nmdc:mga05p37_235686_c1 | 3300050507 | Bacteria | 2203 |
| 482 | nmdc:mga05p37_568202_c1 | 3300050507 | Bacteria | 1287 |
| 483 | nmdc:mga05p37_58409_c1 | 3300050507 | Bacteria | 4751 |
| 484 | nmdc:mga09592_1159694_c1 | 3300050508 | Bacteria | 640 |
| 485 | nmdc:mga09592_724683_c1 | 3300050508 | Bacteria | 845 |
| 486 | nmdc:mga09592_888430_c1 | 3300050508 | Bacteria | 750 |
| 487 | nmdc:mga0qj67_1562554_c1 | 3300050509 | Bacteria | 507 |
| 488 | nmdc:mga0qj67_794079_c1 | 3300050509 | Bacteria | 750 |
| 489 | nmdc:mga06r32_1083615_c1 | 3300050510 | Bacteria | 751 |
| 490 | nmdc:mga06r32_551432_c1 | 3300050510 | Bacteria | 1127 |
| 491 | nmdc:mga06r32_779416_c1 | 3300050510 | Bacteria | 918 |
| 492 | nmdc:mga08y16_100818_c1 | 3300050511 | Bacteria | 3006 |
| 493 | nmdc:mga08y16_37233_c1 | 3300050511 | Bacteria | 5110 |
| 494 | nmdc:mga08y16_9879_c2 | 3300050511 | Bacteria | 6288 |
| 495 | nmdc:mga0n895_423292_c1 | 3300050512 | Bacteria | 1346 |
| 496 | nmdc:mga0n895_47595_c1 | 3300050512 | Bacteria | 4193 |
| 497 | nmdc:mga0n895_483706_c1 | 3300050512 | Bacteria | 1248 |
| 498 | nmdc:mga0rr50_223414_c1 | 3300050513 | Bacteria | 1556 |
| 499 | nmdc:mga0rr50_444944_c1 | 3300050513 | Bacteria | 1098 |
| 500 | nmdc:mga0a205_525966_c1 | 3300050515 | Bacteria | 1039 |
| 501 | nmdc:mga0a205_79259_c1 | 3300050515 | Bacteria | 3173 |
| 502 | nmdc:mga0sz30_170332_c1 | 3300050516 | Bacteria | 965 |
| 503 | nmdc:mga0sz30_549993_c1 | 3300050516 | Bacteria | 521 |
| 504 | Ga0495619_1099174 | 3300053085 | Bacteria | 529 |
| 505 | Ga0500643_091036 | 3300053087 | Bacteria | 831 |
| 506 | Ga0500643_168855 | 3300053087 | Bacteria | 587 |
| 507 | Ga0500651_0224729 | 3300053093 | Bacteria | 1100 |
| 508 | Ga0500555_063991 | 3300053103 | Bacteria | 983 |
| 509 | Ga0500556_0000009 | 3300053104 | Bacteria | 288111 |
| 510 | Ga0500562_019707 | 3300053108 | Bacteria | 1747 |
| 511 | Ga0500569_090116 | 3300053109 | Bacteria | 992 |
| 512 | Ga0500608_085894 | 3300053122 | Bacteria | 1478 |
| 513 | Ga0500652_116740 | 3300053131 | Bacteria | 1115 |
| 514 | Ga0500655_132156 | 3300053133 | Bacteria | 533 |
| 515 | Ga0500658_0258922 | 3300053134 | Bacteria | 800 |
| 516 | Ga0500561_0013973 | 3300053137 | Bacteria | 1752 |
| 517 | Ga0500568_0281560 | 3300053139 | Bacteria | 604 |
| 518 | Ga0500577_0043076 | 3300053142 | Bacteria | 1656 |
| 519 | Ga0500588_0004535 | 3300053146 | Bacteria | 3018 |
| 520 | Ga0500604_0291867 | 3300053151 | Bacteria | 565 |
| 521 | Ga0500616_0024839 | 3300053153 | Bacteria | 3326 |
| 522 | Ga0500616_0042639 | 3300053153 | Bacteria | 2429 |
| 523 | Ga0500622_0001277 | 3300053156 | Bacteria | 20505 |
| 524 | Ga0500622_0008990 | 3300053156 | Bacteria | 5552 |
| 525 | Ga0500622_0269252 | 3300053156 | Bacteria | 739 |
| 526 | Ga0500624_029853 | 3300053157 | Bacteria | 931 |
| 527 | Ga0500627_0147216 | 3300053158 | Bacteria | 1064 |
| 528 | Ga0500627_0415870 | 3300053158 | Bacteria | 570 |
| 529 | Ga0500634_0068159 | 3300053161 | Bacteria | 1869 |
| 530 | Ga0500636_0009188 | 3300053177 | Bacteria | 5746 |
| 531 | Ga0500645_074069 | 3300053730 | Bacteria | 975 |
| 532 | Ga0500645_201468 | 3300053730 | Bacteria | 537 |
| 533 | Ga0501084_0023050 | 3300054114 | Bacteria | 5196 |
| 534 | Ga0501084_0218577 | 3300054114 | Bacteria | 1608 |
| 535 | Ga0501084_0381809 | 3300054114 | Bacteria | 1190 |
| 536 | Ga0501084_0565365 | 3300054114 | Bacteria | 961 |
| 537 | Ga0587070_024864 | 3300059491 | Bacteria | 1040 |
| 538 | Ga0587077_011314 | 3300059493 | Bacteria | 1400 |
| 539 | Ga0587077_013322 | 3300059493 | Bacteria | 1332 |
| 540 | Ga0587080_009823 | 3300059503 | Bacteria | 1400 |
| 541 | Ga0587085_021949 | 3300059506 | Bacteria | 980 |
| 542 | Ga0587086_080249 | 3300059507 | Bacteria | 574 |
| 543 | Ga0587089_113809 | 3300059509 | Bacteria | 502 |
| 544 | Ga0587090_003741 | 3300059510 | Bacteria | 1792 |
| 545 | Ga0587106_000771 | 3300059605 | Bacteria | 2500 |
| 546 | Ga0587125_061066 | 3300059607 | Bacteria | 551 |
| 547 | Ga0587101_003961 | 3300059623 | Bacteria | 1548 |
| 548 | Ga0587101_097169 | 3300059623 | Bacteria | 581 |
| 549 | Ga0587062_015009 | 3300059639 | Bacteria | 1030 |
| 550 | Ga0587062_087362 | 3300059639 | Bacteria | 589 |
| 551 | Ga0587068_002490 | 3300059641 | Bacteria | 2244 |
| 552 | Ga0587069_027693 | 3300059642 | Bacteria | 896 |
| 553 | Ga0587072_072792 | 3300059643 | Bacteria | 729 |
| 554 | Ga0587076_006671 | 3300059645 | Bacteria | 1548 |
| 555 | Ga0587107_075120 | 3300059652 | Bacteria | 625 |
| 556 | Ga0587111_0000057 | 3300060346 | Bacteria | 6907 |
| 557 | Ga0587111_0017505 | 3300060346 | Bacteria | 1336 |
| 558 | Ga0587111_0177517 | 3300060346 | Bacteria | 590 |
| 559 | Ga0501082_0017998 | 3300060353 | Bacteria | 6085 |
| 560 | Ga0501082_0049749 | 3300060353 | Bacteria | 3614 |
| 561 | Ga0501082_0084660 | 3300060353 | Bacteria | 2734 |
| 562 | Ga0501082_0325161 | 3300060353 | Bacteria | 1340 |
| 563 | Ga0501082_0348793 | 3300060353 | Bacteria | 1290 |
| 564 | Ga0501082_0447594 | 3300060353 | Bacteria | 1128 |
| 565 | Ga0501082_0676492 | 3300060353 | Bacteria | 903 |
| 566 | Ga0501082_0835902 | 3300060353 | Bacteria | 805 |
| 567 | Ga0501082_0848015 | 3300060353 | Bacteria | 799 |
| 568 | Ga0501082_1444350 | 3300060353 | Bacteria | 601 |
| 569 | Ga0530510_0056862 | 3300061734 | Bacteria | 2827 |
| 570 | Ga0530510_0373431 | 3300061734 | Bacteria | 1073 |
| 571 | Ga0530510_0378904 | 3300061734 | Bacteria | 1065 |
| 572 | Ga0530510_0526569 | 3300061734 | Bacteria | 897 |
| 573 | Ga0530510_1007502 | 3300061734 | Bacteria | 637 |
| 574 | Ga0530510_1306601 | 3300061734 | Bacteria | 556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005455 | Ga0070663_100001615 | Ga0070663_1000016152 | 57 |
| 2 | 3300006847 | Ga0075431_100769041 | Ga0075431_1007690413 | 57 |
| 3 | 3300020082 | Ga0206353_11323013 | Ga0206353_113230132 | 63 |
| 4 | 3300025923 | Ga0207681_10084218 | Ga0207681_100842186 | 63 |
| 5 | 3300029957 | Ga0265324_10220715 | Ga0265324_102207152 | 63 |
| 6 | 3300031240 | Ga0265320_10357585 | Ga0265320_103575851 | 63 |
| 7 | 3300031249 | Ga0265339_10436794 | Ga0265339_104367942 | 63 |
| 8 | 3300031344 | Ga0265316_10407169 | Ga0265316_104071692 | 63 |
| 9 | 3300031595 | Ga0265313_10053734 | Ga0265313_100537343 | 63 |
| 10 | 3300031712 | Ga0265342_10587936 | Ga0265342_105879362 | 63 |
| 11 | 3300032168 | Ga0316593_10001189 | Ga0316593_100011895 | 63 |
| 12 | 3300033541 | Ga0316596_1011427 | Ga0316596_10114274 | 63 |
| 13 | 3300005336 | Ga0070680_101985014 | Ga0070680_1019850141 | 64 |
| 14 | 3300005440 | Ga0070705_100586427 | Ga0070705_1005864272 | 64 |
| 15 | 3300005548 | Ga0070665_100006166 | Ga0070665_10000616611 | 64 |
| 16 | 3300005549 | Ga0070704_101816982 | Ga0070704_1018169822 | 64 |
| 17 | 3300006048 | Ga0075363_100397590 | Ga0075363_1003975902 | 64 |
| 18 | 3300009094 | Ga0111539_10682184 | Ga0111539_106821844 | 64 |
| 19 | 3300009545 | Ga0105237_10747504 | Ga0105237_107475044 | 64 |
| 20 | 3300009553 | Ga0105249_10014071 | Ga0105249_1001407111 | 64 |
| 21 | 3300009553 | Ga0105249_13431225 | Ga0105249_134312252 | 64 |
| 22 | 3300013100 | Ga0157373_11139525 | Ga0157373_111395252 | 64 |
| 23 | 3300013296 | Ga0157374_11492341 | Ga0157374_114923412 | 64 |
| 24 | 3300025935 | Ga0207709_11043522 | Ga0207709_110435221 | 64 |
| 25 | 3300026067 | Ga0207678_11372282 | Ga0207678_113722821 | 64 |
| 26 | 3300031247 | Ga0265340_10045117 | Ga0265340_100451173 | 64 |
| 27 | 3300031824 | Ga0307413_11325543 | Ga0307413_113255432 | 64 |
| 28 | 3300031995 | Ga0307409_100472547 | Ga0307409_1004725473 | 64 |
| 29 | 3300039437 | Ga0436365_0527365 | Ga0436365_0527365_186_389 | 64 |
| 30 | 3300046491 | Ga0495584_0188772 | Ga0495584_0188772_247_450 | 64 |
| 31 | 3300046615 | Ga0495656_0105356 | Ga0495656_0105356_813_1016 | 64 |
| 32 | 3300046684 | Ga0495669_0572117 | Ga0495669_0572117_156_359 | 64 |
| 33 | 3300049568 | Ga0501031_0016670 | Ga0501031_0016670_3763_3963 | 64 |
| 34 | 3300049569 | Ga0501032_0188536 | Ga0501032_0188536_463_663 | 64 |
| 35 | 3300049570 | Ga0501033_1122607 | Ga0501033_1122607_135_335 | 64 |
| 36 | 3300049571 | Ga0501034_0035212 | Ga0501034_0035212_1375_1575 | 64 |
| 37 | 3300049572 | Ga0501036_0452590 | Ga0501036_0452590_623_823 | 64 |
| 38 | 3300049573 | Ga0501037_0208097 | Ga0501037_0208097_666_866 | 64 |
| 39 | 3300049574 | Ga0501038_0039812 | Ga0501038_0039812_1240_1440 | 64 |
| 40 | 3300049575 | Ga0501039_0240450 | Ga0501039_0240450_305_505 | 64 |
| 41 | 3300049579 | Ga0501043_0808824 | Ga0501043_0808824_384_584 | 64 |
| 42 | 3300049583 | Ga0501067_0286359 | Ga0501067_0286359_192_392 | 64 |
| 43 | 3300049585 | Ga0501069_0138940 | Ga0501069_0138940_517_717 | 64 |
| 44 | 3300049586 | Ga0501070_0171551 | Ga0501070_0171551_915_1115 | 64 |
| 45 | 3300049589 | Ga0501073_0058581 | Ga0501073_0058581_1963_2163 | 64 |
| 46 | 3300049590 | Ga0501074_0215216 | Ga0501074_0215216_544_744 | 64 |
| 47 | 3300049590 | Ga0501074_0565311 | Ga0501074_0565311_134_373 | 64 |
| 48 | 3300049590 | Ga0501074_0599280 | Ga0501074_0599280_34_237 | 64 |
| 49 | 3300049742 | Ga0501080_0363496 | Ga0501080_0363496_622_822 | 64 |
| 50 | 3300049742 | Ga0501080_1752405 | Ga0501080_1752405_204_404 | 64 |
| 51 | 3300049823 | Ga0501044_0191494 | Ga0501044_0191494_495_695 | 64 |
| 52 | 3300053103 | Ga0500555_063991 | Ga0500555_063991_289_492 | 64 |
| 53 | 3300060353 | Ga0501082_0848015 | Ga0501082_0848015_219_419 | 64 |
| 54 | 3300061734 | Ga0530510_0526569 | Ga0530510_0526569_414_701 | 64 |
| 55 | 3300061734 | Ga0530510_1007502 | Ga0530510_1007502_184_387 | 64 |
| 56 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_100096120 | 65 |
| 57 | 3300003911 | JGI25405J52794_10041760 | JGI25405J52794_100417602 | 65 |
| 58 | 3300005289 | Ga0065704_10114286 | Ga0065704_101142863 | 65 |
| 59 | 3300005336 | Ga0070680_100099273 | Ga0070680_1000992736 | 65 |
| 60 | 3300005336 | Ga0070680_100254677 | Ga0070680_1002546773 | 65 |
| 61 | 3300005336 | Ga0070680_100552650 | Ga0070680_1005526502 | 65 |
| 62 | 3300005340 | Ga0070689_101321229 | Ga0070689_1013212291 | 65 |
| 63 | 3300005345 | Ga0070692_10860787 | Ga0070692_108607871 | 65 |
| 64 | 3300005347 | Ga0070668_101457376 | Ga0070668_1014573762 | 65 |
| 65 | 3300005347 | Ga0070668_102099616 | Ga0070668_1020996162 | 65 |
| 66 | 3300005456 | Ga0070678_100961198 | Ga0070678_1009611982 | 65 |
| 67 | 3300005458 | Ga0070681_10238328 | Ga0070681_102383282 | 65 |
| 68 | 3300005458 | Ga0070681_10666110 | Ga0070681_106661102 | 65 |
| 69 | 3300005458 | Ga0070681_10810161 | Ga0070681_108101613 | 65 |
| 70 | 3300005458 | Ga0070681_11291366 | Ga0070681_112913661 | 65 |
| 71 | 3300005471 | Ga0070698_101707381 | Ga0070698_1017073811 | 65 |
| 72 | 3300005530 | Ga0070679_100049286 | Ga0070679_1000492863 | 65 |
| 73 | 3300005539 | Ga0068853_100013375 | Ga0068853_1000133759 | 65 |
| 74 | 3300005545 | Ga0070695_100893997 | Ga0070695_1008939972 | 65 |
| 75 | 3300005547 | Ga0070693_101108505 | Ga0070693_1011085052 | 65 |
| 76 | 3300005548 | Ga0070665_100319540 | Ga0070665_1003195404 | 65 |
| 77 | 3300005548 | Ga0070665_101021496 | Ga0070665_1010214962 | 65 |
| 78 | 3300005548 | Ga0070665_102085774 | Ga0070665_1020857742 | 65 |
| 79 | 3300005614 | Ga0068856_100200510 | Ga0068856_1002005105 | 65 |
| 80 | 3300005618 | Ga0068864_100822873 | Ga0068864_1008228733 | 65 |
| 81 | 3300005618 | Ga0068864_101815125 | Ga0068864_1018151252 | 65 |
| 82 | 3300005719 | Ga0068861_101161149 | Ga0068861_1011611493 | 65 |
| 83 | 3300005719 | Ga0068861_102240121 | Ga0068861_1022401212 | 65 |
| 84 | 3300005844 | Ga0068862_100749614 | Ga0068862_1007496143 | 65 |
| 85 | 3300005844 | Ga0068862_100988724 | Ga0068862_1009887242 | 65 |
| 86 | 3300005844 | Ga0068862_101214985 | Ga0068862_1012149853 | 65 |
| 87 | 3300005844 | Ga0068862_101379067 | Ga0068862_1013790671 | 65 |
| 88 | 3300005937 | Ga0081455_10001008 | Ga0081455_1000100834 | 65 |
| 89 | 3300005937 | Ga0081455_10019145 | Ga0081455_100191458 | 65 |
| 90 | 3300005981 | Ga0081538_10003741 | Ga0081538_1000374111 | 65 |
| 91 | 3300005981 | Ga0081538_10043084 | Ga0081538_100430846 | 65 |
| 92 | 3300005981 | Ga0081538_10152960 | Ga0081538_101529602 | 65 |
| 93 | 3300005983 | Ga0081540_1008438 | Ga0081540_100843810 | 65 |
| 94 | 3300005983 | Ga0081540_1043521 | Ga0081540_10435216 | 65 |
| 95 | 3300006038 | Ga0075365_10210208 | Ga0075365_102102082 | 65 |
| 96 | 3300006038 | Ga0075365_10431230 | Ga0075365_104312303 | 65 |
| 97 | 3300006051 | Ga0075364_10067532 | Ga0075364_100675324 | 65 |
| 98 | 3300006051 | Ga0075364_10359037 | Ga0075364_103590372 | 65 |
| 99 | 3300006051 | Ga0075364_10517391 | Ga0075364_105173912 | 65 |
| 100 | 3300006058 | Ga0075432_10376983 | Ga0075432_103769832 | 65 |
| 101 | 3300006178 | Ga0075367_10314485 | Ga0075367_103144853 | 65 |
| 102 | 3300006178 | Ga0075367_10323469 | Ga0075367_103234692 | 65 |
| 103 | 3300006186 | Ga0075369_10048331 | Ga0075369_100483313 | 65 |
| 104 | 3300006186 | Ga0075369_10423656 | Ga0075369_104236562 | 65 |
| 105 | 3300006195 | Ga0075366_10042037 | Ga0075366_100420372 | 65 |
| 106 | 3300006195 | Ga0075366_10316635 | Ga0075366_103166352 | 65 |
| 107 | 3300006237 | Ga0097621_101991995 | Ga0097621_1019919952 | 65 |
| 108 | 3300006846 | Ga0075430_100740905 | Ga0075430_1007409052 | 65 |
| 109 | 3300006846 | Ga0075430_101707119 | Ga0075430_1017071192 | 65 |
| 110 | 3300006847 | Ga0075431_101131764 | Ga0075431_1011317642 | 65 |
| 111 | 3300006852 | Ga0075433_10418300 | Ga0075433_104183003 | 65 |
| 112 | 3300006871 | Ga0075434_100237438 | Ga0075434_1002374382 | 65 |
| 113 | 3300006871 | Ga0075434_100252710 | Ga0075434_1002527103 | 65 |
| 114 | 3300006880 | Ga0075429_100197579 | Ga0075429_1001975793 | 65 |
| 115 | 3300006914 | Ga0075436_101365257 | Ga0075436_1013652572 | 65 |
| 116 | 3300006946 | Ga0079104_1000547 | Ga0079104_100054747 | 65 |
| 117 | 3300007076 | Ga0075435_100763996 | Ga0075435_1007639963 | 65 |
| 118 | 3300007076 | Ga0075435_101374118 | Ga0075435_1013741182 | 65 |
| 119 | 3300009092 | Ga0105250_10572582 | Ga0105250_105725822 | 65 |
| 120 | 3300009094 | Ga0111539_10092029 | Ga0111539_100920294 | 65 |
| 121 | 3300009098 | Ga0105245_10327906 | Ga0105245_103279062 | 65 |
| 122 | 3300009147 | Ga0114129_10079719 | Ga0114129_100797199 | 65 |
| 123 | 3300009147 | Ga0114129_10778840 | Ga0114129_107788403 | 65 |
| 124 | 3300009148 | Ga0105243_11232115 | Ga0105243_112321152 | 65 |
| 125 | 3300009148 | Ga0105243_11721412 | Ga0105243_117214123 | 65 |
| 126 | 3300009148 | Ga0105243_12682766 | Ga0105243_126827662 | 65 |
| 127 | 3300009177 | Ga0105248_10723019 | Ga0105248_107230192 | 65 |
| 128 | 3300009177 | Ga0105248_10983695 | Ga0105248_109836952 | 65 |
| 129 | 3300009545 | Ga0105237_10586873 | Ga0105237_105868733 | 65 |
| 130 | 3300009545 | Ga0105237_10822763 | Ga0105237_108227633 | 65 |
| 131 | 3300009551 | Ga0105238_12377522 | Ga0105238_123775222 | 65 |
| 132 | 3300009553 | Ga0105249_10410828 | Ga0105249_104108283 | 65 |
| 133 | 3300009553 | Ga0105249_11347390 | Ga0105249_113473902 | 65 |
| 134 | 3300009553 | Ga0105249_11425620 | Ga0105249_114256201 | 65 |
| 135 | 3300009553 | Ga0105249_12411574 | Ga0105249_124115742 | 65 |
| 136 | 3300009987 | Ga0105030_128379 | Ga0105030_1283791 | 65 |
| 137 | 3300009993 | Ga0105028_109128 | Ga0105028_1091281 | 65 |
| 138 | 3300010159 | Ga0099796_10576206 | Ga0099796_105762062 | 65 |
| 139 | 3300010375 | Ga0105239_10984974 | Ga0105239_109849743 | 65 |
| 140 | 3300010375 | Ga0105239_12407305 | Ga0105239_124073052 | 65 |
| 141 | 3300012502 | Ga0157347_1037009 | Ga0157347_10370092 | 65 |
| 142 | 3300013105 | Ga0157369_11151176 | Ga0157369_111511761 | 65 |
| 143 | 3300013297 | Ga0157378_10464731 | Ga0157378_104647314 | 65 |
| 144 | 3300013297 | Ga0157378_10639748 | Ga0157378_106397483 | 65 |
| 145 | 3300014325 | Ga0163163_11740043 | Ga0163163_117400433 | 65 |
| 146 | 3300014326 | Ga0157380_10310935 | Ga0157380_103109353 | 65 |
| 147 | 3300014326 | Ga0157380_10398047 | Ga0157380_103980473 | 65 |
| 148 | 3300014497 | Ga0182008_10408056 | Ga0182008_104080562 | 65 |
| 149 | 3300015265 | Ga0182005_1002173 | Ga0182005_100217314 | 65 |
| 150 | 3300020080 | Ga0206350_10535392 | Ga0206350_105353922 | 65 |
| 151 | 3300025294 | Ga0209025_1041276 | Ga0209025_10412763 | 65 |
| 152 | 3300025912 | Ga0207707_10357488 | Ga0207707_103574882 | 65 |
| 153 | 3300025912 | Ga0207707_10863067 | Ga0207707_108630672 | 65 |
| 154 | 3300025918 | Ga0207662_11096961 | Ga0207662_110969612 | 65 |
| 155 | 3300025924 | Ga0207694_11678532 | Ga0207694_116785322 | 65 |
| 156 | 3300025926 | Ga0207659_11027428 | Ga0207659_110274282 | 65 |
| 157 | 3300025927 | Ga0207687_10977447 | Ga0207687_109774472 | 65 |
| 158 | 3300025935 | Ga0207709_10969606 | Ga0207709_109696062 | 65 |
| 159 | 3300025936 | Ga0207670_10553176 | Ga0207670_105531762 | 65 |
| 160 | 3300025941 | Ga0207711_10140909 | Ga0207711_101409092 | 65 |
| 161 | 3300025941 | Ga0207711_11132271 | Ga0207711_111322712 | 65 |
| 162 | 3300025961 | Ga0207712_10273112 | Ga0207712_102731122 | 65 |
| 163 | 3300025961 | Ga0207712_11127724 | Ga0207712_111277242 | 65 |
| 164 | 3300025972 | Ga0207668_10714327 | Ga0207668_107143271 | 65 |
| 165 | 3300025972 | Ga0207668_10917752 | Ga0207668_109177522 | 65 |
| 166 | 3300025972 | Ga0207668_11307576 | Ga0207668_113075762 | 65 |
| 167 | 3300026067 | Ga0207678_10548627 | Ga0207678_105486272 | 65 |
| 168 | 3300026075 | Ga0207708_11768763 | Ga0207708_117687631 | 65 |
| 169 | 3300026118 | Ga0207675_101467341 | Ga0207675_1014673411 | 65 |
| 170 | 3300026118 | Ga0207675_101592654 | Ga0207675_1015926542 | 65 |
| 171 | 3300026121 | Ga0207683_10815670 | Ga0207683_108156702 | 65 |
| 172 | 3300027111 | Ga0209281_1000573 | Ga0209281_100057311 | 65 |
| 173 | 3300027512 | Ga0209179_1030741 | Ga0209179_10307413 | 65 |
| 174 | 3300027866 | Ga0209813_10225347 | Ga0209813_102253472 | 65 |
| 175 | 3300027876 | Ga0209974_10185273 | Ga0209974_101852733 | 65 |
| 176 | 3300027876 | Ga0209974_10210068 | Ga0209974_102100681 | 65 |
| 177 | 3300027876 | Ga0209974_10258863 | Ga0209974_102588632 | 65 |
| 178 | 3300027907 | Ga0207428_10020203 | Ga0207428_1002020310 | 65 |
| 179 | 3300027907 | Ga0207428_10185324 | Ga0207428_101853242 | 65 |
| 180 | 3300028379 | Ga0268266_10036033 | Ga0268266_100360331 | 65 |
| 181 | 3300028577 | Ga0265318_10015702 | Ga0265318_100157028 | 65 |
| 182 | 3300028577 | Ga0265318_10361672 | Ga0265318_103616722 | 65 |
| 183 | 3300028794 | Ga0307515_10058447 | Ga0307515_100584478 | 65 |
| 184 | 3300028800 | Ga0265338_10609169 | Ga0265338_106091692 | 65 |
| 185 | 3300028800 | Ga0265338_11085278 | Ga0265338_110852782 | 65 |
| 186 | 3300030733 | Ga0314311_1193439 | Ga0314311_11934392 | 65 |
| 187 | 3300031090 | Ga0265760_10077843 | Ga0265760_100778434 | 65 |
| 188 | 3300031235 | Ga0265330_10125296 | Ga0265330_101252962 | 65 |
| 189 | 3300031239 | Ga0265328_10009346 | Ga0265328_100093467 | 65 |
| 190 | 3300031239 | Ga0265328_10407638 | Ga0265328_104076382 | 65 |
| 191 | 3300031240 | Ga0265320_10551472 | Ga0265320_105514722 | 65 |
| 192 | 3300031241 | Ga0265325_10016753 | Ga0265325_100167534 | 65 |
| 193 | 3300031241 | Ga0265325_10196517 | Ga0265325_101965173 | 65 |
| 194 | 3300031242 | Ga0265329_10024967 | Ga0265329_100249672 | 65 |
| 195 | 3300031242 | Ga0265329_10185270 | Ga0265329_101852702 | 65 |
| 196 | 3300031247 | Ga0265340_10065829 | Ga0265340_100658292 | 65 |
| 197 | 3300031247 | Ga0265340_10097663 | Ga0265340_100976634 | 65 |
| 198 | 3300031247 | Ga0265340_10398266 | Ga0265340_103982662 | 65 |
| 199 | 3300031249 | Ga0265339_10002105 | Ga0265339_100021059 | 65 |
| 200 | 3300031249 | Ga0265339_10045403 | Ga0265339_100454035 | 65 |
| 201 | 3300031249 | Ga0265339_10074118 | Ga0265339_100741183 | 65 |
| 202 | 3300031249 | Ga0265339_10085133 | Ga0265339_100851332 | 65 |
| 203 | 3300031249 | Ga0265339_10150396 | Ga0265339_101503962 | 65 |
| 204 | 3300031250 | Ga0265331_10037674 | Ga0265331_100376746 | 65 |
| 205 | 3300031250 | Ga0265331_10087123 | Ga0265331_100871233 | 65 |
| 206 | 3300031344 | Ga0265316_10015933 | Ga0265316_1001593310 | 65 |
| 207 | 3300031344 | Ga0265316_10030464 | Ga0265316_100304645 | 65 |
| 208 | 3300031344 | Ga0265316_10561013 | Ga0265316_105610132 | 65 |
| 209 | 3300031344 | Ga0265316_10883304 | Ga0265316_108833042 | 65 |
| 210 | 3300031548 | Ga0307408_101310200 | Ga0307408_1013102002 | 65 |
| 211 | 3300031595 | Ga0265313_10000031 | Ga0265313_1000003187 | 65 |
| 212 | 3300031595 | Ga0265313_10052060 | Ga0265313_100520603 | 65 |
| 213 | 3300031595 | Ga0265313_10273582 | Ga0265313_102735822 | 65 |
| 214 | 3300031595 | Ga0265313_10275639 | Ga0265313_102756393 | 65 |
| 215 | 3300031595 | Ga0265313_10419109 | Ga0265313_104191092 | 65 |
| 216 | 3300031711 | Ga0265314_10008857 | Ga0265314_100088576 | 65 |
| 217 | 3300031711 | Ga0265314_10028299 | Ga0265314_100282998 | 65 |
| 218 | 3300031711 | Ga0265314_10398931 | Ga0265314_103989312 | 65 |
| 219 | 3300031711 | Ga0265314_10458770 | Ga0265314_104587702 | 65 |
| 220 | 3300031711 | Ga0265314_10700573 | Ga0265314_107005731 | 65 |
| 221 | 3300031712 | Ga0265342_10004137 | Ga0265342_1000413711 | 65 |
| 222 | 3300031712 | Ga0265342_10038280 | Ga0265342_100382803 | 65 |
| 223 | 3300031712 | Ga0265342_10078306 | Ga0265342_100783065 | 65 |
| 224 | 3300031712 | Ga0265342_10357588 | Ga0265342_103575882 | 65 |
| 225 | 3300031731 | Ga0307405_10536335 | Ga0307405_105363353 | 65 |
| 226 | 3300031824 | Ga0307413_10302467 | Ga0307413_103024671 | 65 |
| 227 | 3300031852 | Ga0307410_11695408 | Ga0307410_116954082 | 65 |
| 228 | 3300031852 | Ga0307410_11938016 | Ga0307410_119380161 | 65 |
| 229 | 3300031901 | Ga0307406_10268077 | Ga0307406_102680772 | 65 |
| 230 | 3300031901 | Ga0307406_10614112 | Ga0307406_106141121 | 65 |
| 231 | 3300031903 | Ga0307407_11472189 | Ga0307407_114721892 | 65 |
| 232 | 3300031911 | Ga0307412_10813782 | Ga0307412_108137822 | 65 |
| 233 | 3300031995 | Ga0307409_100224075 | Ga0307409_1002240752 | 65 |
| 234 | 3300031995 | Ga0307409_100227836 | Ga0307409_1002278363 | 65 |
| 235 | 3300031995 | Ga0307409_101958854 | Ga0307409_1019588542 | 65 |
| 236 | 3300032002 | Ga0307416_100537909 | Ga0307416_1005379093 | 65 |
| 237 | 3300032002 | Ga0307416_101625458 | Ga0307416_1016254582 | 65 |
| 238 | 3300032002 | Ga0307416_102505778 | Ga0307416_1025057781 | 65 |
| 239 | 3300032002 | Ga0307416_103492446 | Ga0307416_1034924462 | 65 |
| 240 | 3300032004 | Ga0307414_10741124 | Ga0307414_107411243 | 65 |
| 241 | 3300032005 | Ga0307411_11316798 | Ga0307411_113167981 | 65 |
| 242 | 3300032126 | Ga0307415_100377700 | Ga0307415_1003777003 | 65 |
| 243 | 3300032126 | Ga0307415_100611652 | Ga0307415_1006116521 | 65 |
| 244 | 3300032126 | Ga0307415_100898907 | Ga0307415_1008989073 | 65 |
| 245 | 3300035089 | Ga0373944_0089856 | Ga0373944_0089856_51_263 | 65 |
| 246 | 3300035112 | Ga0373932_0289120 | Ga0373932_0289120_25_357 | 65 |
| 247 | 3300035116 | Ga0373945_0173574 | Ga0373945_0173574_125_457 | 65 |
| 248 | 3300035119 | Ga0373956_0610592 | Ga0373956_0610592_244_459 | 65 |
| 249 | 3300035691 | Ga0373931_0213407 | Ga0373931_0213407_467_667 | 65 |
| 250 | 3300035691 | Ga0373931_0284553 | Ga0373931_0284553_528_734 | 65 |
| 251 | 3300035691 | Ga0373931_0306281 | Ga0373931_0306281_284_616 | 65 |
| 252 | 3300035692 | Ga0373935_0254180 | Ga0373935_0254180_249_581 | 65 |
| 253 | 3300035725 | Ga0373947_0085526 | Ga0373947_0085526_889_1221 | 65 |
| 254 | 3300037068 | Ga0373925_0144587 | Ga0373925_0144587_406_738 | 65 |
| 255 | 3300037312 | Ga0395899_0000073 | Ga0395899_0000073_73621_73821 | 65 |
| 256 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_178191_178391 | 65 |
| 257 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_23251_23451 | 65 |
| 258 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_107542_107742 | 65 |
| 259 | 3300037853 | Ga0436364_0607066 | Ga0436364_0607066_150_350 | 65 |
| 260 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_107567_107767 | 65 |
| 261 | 3300039062 | Ga0400483_059010 | Ga0400483_059010_5074_5280 | 65 |
| 262 | 3300039062 | Ga0400483_165422 | Ga0400483_165422_1948_2154 | 65 |
| 263 | 3300039062 | Ga0400483_217885 | Ga0400483_217885_11540_11746 | 65 |
| 264 | 3300039062 | Ga0400483_243738 | Ga0400483_243738_3564_3770 | 65 |
| 265 | 3300039062 | Ga0400483_281008 | Ga0400483_281008_1077_1283 | 65 |
| 266 | 3300039438 | Ga0436360_0566130 | Ga0436360_0566130_295_498 | 65 |
| 267 | 3300039438 | Ga0436360_0590269 | Ga0436360_0590269_251_466 | 65 |
| 268 | 3300039450 | Ga0436363_1377737 | Ga0436363_1377737_30_233 | 65 |
| 269 | 3300039453 | Ga0436362_0004730 | Ga0436362_0004730_41_256 | 65 |
| 270 | 3300041413 | Ga0439465_0119634 | Ga0439465_0119634_668_868 | 65 |
| 271 | 3300041460 | Ga0451802_1457526 | Ga0451802_1457526_300_500 | 65 |
| 272 | 3300041491 | Ga0451833_1093358 | Ga0451833_1093358_264_467 | 65 |
| 273 | 3300041511 | Ga0451855_0574687 | Ga0451855_0574687_72_272 | 65 |
| 274 | 3300041997 | Ga0439431_0103480 | Ga0439431_0103480_271_471 | 65 |
| 275 | 3300042006 | Ga0439432_032485 | Ga0439432_032485_393_599 | 65 |
| 276 | 3300042007 | Ga0439449_0092967 | Ga0439449_0092967_860_1060 | 65 |
| 277 | 3300042013 | Ga0439456_070050 | Ga0439456_070050_98_298 | 65 |
| 278 | 3300042015 | Ga0439462_0152722 | Ga0439462_0152722_300_500 | 65 |
| 279 | 3300042435 | Ga0439434_0254475 | Ga0439434_0254475_306_506 | 65 |
| 280 | 3300044694 | Ga0466963_0250593 | Ga0466963_0250593_77_283 | 65 |
| 281 | 3300045976 | Ga0466967_1115804 | Ga0466967_1115804_159_365 | 65 |
| 282 | 3300046455 | Ga0495603_0312515 | Ga0495603_0312515_273_488 | 65 |
| 283 | 3300046460 | Ga0495638_0006964 | Ga0495638_0006964_2933_3133 | 65 |
| 284 | 3300046460 | Ga0495638_0040593 | Ga0495638_0040593_2046_2246 | 65 |
| 285 | 3300046460 | Ga0495638_0118029 | Ga0495638_0118029_689_901 | 65 |
| 286 | 3300046460 | Ga0495638_0240762 | Ga0495638_0240762_223_423 | 65 |
| 287 | 3300046474 | Ga0495605_0476168 | Ga0495605_0476168_246_446 | 65 |
| 288 | 3300046475 | Ga0495639_0214279 | Ga0495639_0214279_175_390 | 65 |
| 289 | 3300046512 | Ga0495610_0018183 | Ga0495610_0018183_3626_3838 | 65 |
| 290 | 3300046522 | Ga0495643_0103412 | Ga0495643_0103412_874_1101 | 65 |
| 291 | 3300046522 | Ga0495643_0120493 | Ga0495643_0120493_220_432 | 65 |
| 292 | 3300046542 | Ga0495597_0190693 | Ga0495597_0190693_423_623 | 65 |
| 293 | 3300046615 | Ga0495656_0517149 | Ga0495656_0517149_411_614 | 65 |
| 294 | 3300046648 | Ga0495611_0467739 | Ga0495611_0467739_135_341 | 65 |
| 295 | 3300046660 | Ga0495625_0084671 | Ga0495625_0084671_958_1185 | 65 |
| 296 | 3300046660 | Ga0495625_0292882 | Ga0495625_0292882_534_734 | 65 |
| 297 | 3300046660 | Ga0495625_0294702 | Ga0495625_0294702_599_799 | 65 |
| 298 | 3300046660 | Ga0495625_0659591 | Ga0495625_0659591_25_225 | 65 |
| 299 | 3300046691 | Ga0495670_0071023 | Ga0495670_0071023_89_298 | 65 |
| 300 | 3300046692 | Ga0495671_0122761 | Ga0495671_0122761_253_465 | 65 |
| 301 | 3300046694 | Ga0495649_0291237 | Ga0495649_0291237_569_769 | 65 |
| 302 | 3300046794 | Ga0495589_0221442 | Ga0495589_0221442_99_314 | 65 |
| 303 | 3300046810 | Ga0495660_0497900 | Ga0495660_0497900_114_326 | 65 |
| 304 | 3300047318 | Ga0495636_0461249 | Ga0495636_0461249_269_469 | 65 |
| 305 | 3300047320 | Ga0495672_0117241 | Ga0495672_0117241_624_833 | 65 |
| 306 | 3300047320 | Ga0495672_0303828 | Ga0495672_0303828_419_625 | 65 |
| 307 | 3300047469 | Ga0495673_0135193 | Ga0495673_0135193_664_873 | 65 |
| 308 | 3300047472 | Ga0495686_0189107 | Ga0495686_0189107_713_925 | 65 |
| 309 | 3300047673 | Ga0495593_0401814 | Ga0495593_0401814_252_467 | 65 |
| 310 | 3300048904 | Ga0496101_0010556 | Ga0496101_0010556_5845_6057 | 65 |
| 311 | 3300048904 | Ga0496101_0659266 | Ga0496101_0659266_582_782 | 65 |
| 312 | 3300048904 | Ga0496101_1458155 | Ga0496101_1458155_50_256 | 65 |
| 313 | 3300048905 | Ga0496102_0426059 | Ga0496102_0426059_24_224 | 65 |
| 314 | 3300048905 | Ga0496102_1551203 | Ga0496102_1551203_197_418 | 65 |
| 315 | 3300048907 | Ga0496104_0070384 | Ga0496104_0070384_2509_2721 | 65 |
| 316 | 3300048907 | Ga0496104_0564312 | Ga0496104_0564312_570_776 | 65 |
| 317 | 3300048908 | Ga0496105_0005504 | Ga0496105_0005504_4413_4625 | 65 |
| 318 | 3300048911 | Ga0496108_0129057 | Ga0496108_0129057_936_1148 | 65 |
| 319 | 3300048912 | Ga0496109_0294169 | Ga0496109_0294169_894_1106 | 65 |
| 320 | 3300048913 | Ga0496110_0008141 | Ga0496110_0008141_5941_6153 | 65 |
| 321 | 3300048914 | Ga0496111_0023962 | Ga0496111_0023962_2044_2256 | 65 |
| 322 | 3300048915 | Ga0496112_0034695 | Ga0496112_0034695_3335_3547 | 65 |
| 323 | 3300048916 | Ga0496113_0004259 | Ga0496113_0004259_5020_5232 | 65 |
| 324 | 3300048917 | Ga0496114_0445680 | Ga0496114_0445680_268_480 | 65 |
| 325 | 3300048917 | Ga0496114_1602423 | Ga0496114_1602423_252_458 | 65 |
| 326 | 3300048918 | Ga0496115_0878597 | Ga0496115_0878597_386_598 | 65 |
| 327 | 3300048922 | Ga0496119_0000372 | Ga0496119_0000372_36712_36921 | 65 |
| 328 | 3300048922 | Ga0496119_0004353 | Ga0496119_0004353_8907_9119 | 65 |
| 329 | 3300048922 | Ga0496119_0019758 | Ga0496119_0019758_233_433 | 65 |
| 330 | 3300048923 | Ga0496120_0099786 | Ga0496120_0099786_1165_1365 | 65 |
| 331 | 3300048923 | Ga0496120_0184638 | Ga0496120_0184638_100_312 | 65 |
| 332 | 3300048924 | Ga0496121_0246048 | Ga0496121_0246048_415_615 | 65 |
| 333 | 3300048924 | Ga0496121_0459977 | Ga0496121_0459977_326_526 | 65 |
| 334 | 3300048925 | Ga0496122_0135780 | Ga0496122_0135780_189_389 | 65 |
| 335 | 3300048926 | Ga0496123_0017503 | Ga0496123_0017503_4976_5176 | 65 |
| 336 | 3300048926 | Ga0496123_0502510 | Ga0496123_0502510_195_395 | 65 |
| 337 | 3300048927 | Ga0496124_0698119 | Ga0496124_0698119_239_439 | 65 |
| 338 | 3300048927 | Ga0496124_0707630 | Ga0496124_0707630_40_240 | 65 |
| 339 | 3300048928 | Ga0496125_0017448 | Ga0496125_0017448_2653_2865 | 65 |
| 340 | 3300048928 | Ga0496125_0064883 | Ga0496125_0064883_2381_2581 | 65 |
| 341 | 3300048929 | Ga0496126_0344898 | Ga0496126_0344898_555_755 | 65 |
| 342 | 3300049127 | Ga0501306_000381 | Ga0501306_000381_2302_2502 | 65 |
| 343 | 3300049128 | Ga0501308_001458 | Ga0501308_001458_728_928 | 65 |
| 344 | 3300049128 | Ga0501308_002805 | Ga0501308_002805_225_425 | 65 |
| 345 | 3300049130 | Ga0501310_018342 | Ga0501310_018342_114_314 | 65 |
| 346 | 3300049130 | Ga0501310_033789 | Ga0501310_033789_376_576 | 65 |
| 347 | 3300049130 | Ga0501310_080386 | Ga0501310_080386_50_250 | 65 |
| 348 | 3300049160 | Ga0501304_004606 | Ga0501304_004606_160_360 | 65 |
| 349 | 3300049160 | Ga0501304_011395 | Ga0501304_011395_313_513 | 65 |
| 350 | 3300049161 | Ga0501305_001751 | Ga0501305_001751_1277_1477 | 65 |
| 351 | 3300049161 | Ga0501305_018020 | Ga0501305_018020_550_750 | 65 |
| 352 | 3300049162 | Ga0501307_000876 | Ga0501307_000876_751_951 | 65 |
| 353 | 3300049162 | Ga0501307_017944 | Ga0501307_017944_595_795 | 65 |
| 354 | 3300049527 | Ga0501311_002631 | Ga0501311_002631_596_796 | 65 |
| 355 | 3300049528 | Ga0501312_053243 | Ga0501312_053243_316_516 | 65 |
| 356 | 3300049529 | Ga0501313_001406 | Ga0501313_001406_603_803 | 65 |
| 357 | 3300049529 | Ga0501313_003461 | Ga0501313_003461_651_851 | 65 |
| 358 | 3300049530 | Ga0501314_001822 | Ga0501314_001822_539_739 | 65 |
| 359 | 3300049530 | Ga0501314_023558 | Ga0501314_023558_217_417 | 65 |
| 360 | 3300049530 | Ga0501314_031084 | Ga0501314_031084_210_422 | 65 |
| 361 | 3300049531 | Ga0501315_000060 | Ga0501315_000060_3899_4099 | 65 |
| 362 | 3300049531 | Ga0501315_023393 | Ga0501315_023393_333_533 | 65 |
| 363 | 3300049533 | Ga0501317_025997 | Ga0501317_025997_129_329 | 65 |
| 364 | 3300049533 | Ga0501317_026503 | Ga0501317_026503_304_504 | 65 |
| 365 | 3300049533 | Ga0501317_059311 | Ga0501317_059311_42_242 | 65 |
| 366 | 3300049534 | Ga0501318_085348 | Ga0501318_085348_98_304 | 65 |
| 367 | 3300049536 | Ga0501320_003890 | Ga0501320_003890_277_477 | 65 |
| 368 | 3300049551 | Ga0501335_001588 | Ga0501335_001588_829_1029 | 65 |
| 369 | 3300049568 | Ga0501031_0000651 | Ga0501031_0000651_15395_15595 | 65 |
| 370 | 3300049568 | Ga0501031_0359462 | Ga0501031_0359462_139_339 | 65 |
| 371 | 3300049569 | Ga0501032_0000111 | Ga0501032_0000111_4953_5153 | 65 |
| 372 | 3300049569 | Ga0501032_0119107 | Ga0501032_0119107_976_1179 | 65 |
| 373 | 3300049569 | Ga0501032_0305998 | Ga0501032_0305998_109_309 | 65 |
| 374 | 3300049569 | Ga0501032_0319352 | Ga0501032_0319352_289_495 | 65 |
| 375 | 3300049569 | Ga0501032_0552056 | Ga0501032_0552056_284_484 | 65 |
| 376 | 3300049570 | Ga0501033_0011172 | Ga0501033_0011172_812_1012 | 65 |
| 377 | 3300049570 | Ga0501033_0059135 | Ga0501033_0059135_1565_1765 | 65 |
| 378 | 3300049570 | Ga0501033_0139684 | Ga0501033_0139684_1005_1205 | 65 |
| 379 | 3300049571 | Ga0501034_0026519 | Ga0501034_0026519_4953_5153 | 65 |
| 380 | 3300049571 | Ga0501034_0078177 | Ga0501034_0078177_567_770 | 65 |
| 381 | 3300049571 | Ga0501034_0234612 | Ga0501034_0234612_1211_1417 | 65 |
| 382 | 3300049571 | Ga0501034_0961905 | Ga0501034_0961905_157_363 | 65 |
| 383 | 3300049572 | Ga0501036_0002605 | Ga0501036_0002605_9071_9271 | 65 |
| 384 | 3300049572 | Ga0501036_0230566 | Ga0501036_0230566_944_1144 | 65 |
| 385 | 3300049572 | Ga0501036_0583788 | Ga0501036_0583788_696_899 | 65 |
| 386 | 3300049572 | Ga0501036_1235235 | Ga0501036_1235235_336_542 | 65 |
| 387 | 3300049573 | Ga0501037_0000131 | Ga0501037_0000131_64650_64850 | 65 |
| 388 | 3300049574 | Ga0501038_0000109 | Ga0501038_0000109_64650_64850 | 65 |
| 389 | 3300049574 | Ga0501038_0131427 | Ga0501038_0131427_487_693 | 65 |
| 390 | 3300049574 | Ga0501038_0169820 | Ga0501038_0169820_777_977 | 65 |
| 391 | 3300049575 | Ga0501039_0002279 | Ga0501039_0002279_4953_5153 | 65 |
| 392 | 3300049576 | Ga0501040_0107203 | Ga0501040_0107203_1033_1233 | 65 |
| 393 | 3300049577 | Ga0501041_0523920 | Ga0501041_0523920_255_476 | 65 |
| 394 | 3300049578 | Ga0501042_0099109 | Ga0501042_0099109_427_627 | 65 |
| 395 | 3300049579 | Ga0501043_0038138 | Ga0501043_0038138_777_983 | 65 |
| 396 | 3300049579 | Ga0501043_0047851 | Ga0501043_0047851_1153_1353 | 65 |
| 397 | 3300049579 | Ga0501043_0099954 | Ga0501043_0099954_1512_1715 | 65 |
| 398 | 3300049579 | Ga0501043_1011885 | Ga0501043_1011885_32_232 | 65 |
| 399 | 3300049580 | Ga0501046_0126860 | Ga0501046_0126860_242_445 | 65 |
| 400 | 3300049580 | Ga0501046_0312805 | Ga0501046_0312805_633_833 | 65 |
| 401 | 3300049580 | Ga0501046_0493855 | Ga0501046_0493855_248_454 | 65 |
| 402 | 3300049581 | Ga0501047_0152453 | Ga0501047_0152453_1202_1402 | 65 |
| 403 | 3300049581 | Ga0501047_0206504 | Ga0501047_0206504_1144_1347 | 65 |
| 404 | 3300049581 | Ga0501047_0414952 | Ga0501047_0414952_861_1088 | 65 |
| 405 | 3300049581 | Ga0501047_0672906 | Ga0501047_0672906_433_633 | 65 |
| 406 | 3300049581 | Ga0501047_0782101 | Ga0501047_0782101_417_617 | 65 |
| 407 | 3300049581 | Ga0501047_0975116 | Ga0501047_0975116_86_292 | 65 |
| 408 | 3300049582 | Ga0501048_0186294 | Ga0501048_0186294_463_663 | 65 |
| 409 | 3300049582 | Ga0501048_0280029 | Ga0501048_0280029_230_433 | 65 |
| 410 | 3300049582 | Ga0501048_1331934 | Ga0501048_1331934_203_403 | 65 |
| 411 | 3300049583 | Ga0501067_0091010 | Ga0501067_0091010_328_528 | 65 |
| 412 | 3300049583 | Ga0501067_0140339 | Ga0501067_0140339_617_820 | 65 |
| 413 | 3300049583 | Ga0501067_0175550 | Ga0501067_0175550_119_319 | 65 |
| 414 | 3300049584 | Ga0501068_0298881 | Ga0501068_0298881_444_644 | 65 |
| 415 | 3300049584 | Ga0501068_1176173 | Ga0501068_1176173_158_358 | 65 |
| 416 | 3300049585 | Ga0501069_0004122 | Ga0501069_0004122_6959_7162 | 65 |
| 417 | 3300049585 | Ga0501069_0201430 | Ga0501069_0201430_160_366 | 65 |
| 418 | 3300049586 | Ga0501070_0006301 | Ga0501070_0006301_5019_5219 | 65 |
| 419 | 3300049586 | Ga0501070_0060281 | Ga0501070_0060281_2560_2763 | 65 |
| 420 | 3300049586 | Ga0501070_0180101 | Ga0501070_0180101_1300_1506 | 65 |
| 421 | 3300049586 | Ga0501070_0190795 | Ga0501070_0190795_1007_1207 | 65 |
| 422 | 3300049587 | Ga0501071_0625049 | Ga0501071_0625049_70_273 | 65 |
| 423 | 3300049588 | Ga0501072_0008088 | Ga0501072_0008088_2807_3010 | 65 |
| 424 | 3300049588 | Ga0501072_0490060 | Ga0501072_0490060_442_645 | 65 |
| 425 | 3300049588 | Ga0501072_1145878 | Ga0501072_1145878_200_403 | 65 |
| 426 | 3300049589 | Ga0501073_0015881 | Ga0501073_0015881_3477_3680 | 65 |
| 427 | 3300049589 | Ga0501073_0103607 | Ga0501073_0103607_1542_1748 | 65 |
| 428 | 3300049589 | Ga0501073_0456227 | Ga0501073_0456227_403_609 | 65 |
| 429 | 3300049589 | Ga0501073_0625539 | Ga0501073_0625539_32_238 | 65 |
| 430 | 3300049589 | Ga0501073_1160906 | Ga0501073_1160906_197_400 | 65 |
| 431 | 3300049590 | Ga0501074_0035107 | Ga0501074_0035107_985_1188 | 65 |
| 432 | 3300049590 | Ga0501074_0187163 | Ga0501074_0187163_962_1162 | 65 |
| 433 | 3300049592 | Ga0501076_0185791 | Ga0501076_0185791_1029_1235 | 65 |
| 434 | 3300049592 | Ga0501076_0185876 | Ga0501076_0185876_920_1120 | 65 |
| 435 | 3300049592 | Ga0501076_0516025 | Ga0501076_0516025_101_307 | 65 |
| 436 | 3300049592 | Ga0501076_1059084 | Ga0501076_1059084_90_293 | 65 |
| 437 | 3300049593 | Ga0501077_0020871 | Ga0501077_0020871_3554_3760 | 65 |
| 438 | 3300049593 | Ga0501077_0087032 | Ga0501077_0087032_1556_1786 | 65 |
| 439 | 3300049593 | Ga0501077_0511652 | Ga0501077_0511652_360_563 | 65 |
| 440 | 3300049593 | Ga0501077_0831726 | Ga0501077_0831726_184_402 | 65 |
| 441 | 3300049671 | Ga0501238_007181 | Ga0501238_007181_380_580 | 65 |
| 442 | 3300049674 | Ga0501242_052263 | Ga0501242_052263_150_350 | 65 |
| 443 | 3300049708 | Ga0501245_110671 | Ga0501245_110671_212_418 | 65 |
| 444 | 3300049741 | Ga0501079_0197908 | Ga0501079_0197908_896_1102 | 65 |
| 445 | 3300049741 | Ga0501079_0718271 | Ga0501079_0718271_78_281 | 65 |
| 446 | 3300049741 | Ga0501079_0942056 | Ga0501079_0942056_347_547 | 65 |
| 447 | 3300049742 | Ga0501080_0010339 | Ga0501080_0010339_6820_7023 | 65 |
| 448 | 3300049742 | Ga0501080_0017194 | Ga0501080_0017194_5112_5312 | 65 |
| 449 | 3300049742 | Ga0501080_0084954 | Ga0501080_0084954_2124_2333 | 65 |
| 450 | 3300049742 | Ga0501080_0102533 | Ga0501080_0102533_1855_2061 | 65 |
| 451 | 3300049742 | Ga0501080_0669241 | Ga0501080_0669241_299_505 | 65 |
| 452 | 3300049742 | Ga0501080_1611351 | Ga0501080_1611351_112_318 | 65 |
| 453 | 3300049743 | Ga0501081_0302407 | Ga0501081_0302407_574_795 | 65 |
| 454 | 3300049743 | Ga0501081_0560162 | Ga0501081_0560162_185_391 | 65 |
| 455 | 3300049744 | Ga0501083_0020957 | Ga0501083_0020957_1309_1512 | 65 |
| 456 | 3300049744 | Ga0501083_0030622 | Ga0501083_0030622_1657_1860 | 65 |
| 457 | 3300049744 | Ga0501083_0190312 | Ga0501083_0190312_317_526 | 65 |
| 458 | 3300049744 | Ga0501083_0457552 | Ga0501083_0457552_247_453 | 65 |
| 459 | 3300049744 | Ga0501083_0506726 | Ga0501083_0506726_263_469 | 65 |
| 460 | 3300049744 | Ga0501083_0545104 | Ga0501083_0545104_44_268 | 65 |
| 461 | 3300049744 | Ga0501083_0988170 | Ga0501083_0988170_73_273 | 65 |
| 462 | 3300049744 | Ga0501083_1087249 | Ga0501083_1087249_179_379 | 65 |
| 463 | 3300049776 | Ga0501280_005024 | Ga0501280_005024_1005_1205 | 65 |
| 464 | 3300049822 | Ga0501035_0009166 | Ga0501035_0009166_8158_8358 | 65 |
| 465 | 3300049822 | Ga0501035_0043204 | Ga0501035_0043204_3114_3314 | 65 |
| 466 | 3300049822 | Ga0501035_0115964 | Ga0501035_0115964_839_1045 | 65 |
| 467 | 3300049822 | Ga0501035_0618150 | Ga0501035_0618150_528_731 | 65 |
| 468 | 3300049823 | Ga0501044_0000234 | Ga0501044_0000234_64650_64850 | 65 |
| 469 | 3300049823 | Ga0501044_0033457 | Ga0501044_0033457_2323_2526 | 65 |
| 470 | 3300049823 | Ga0501044_0052796 | Ga0501044_0052796_314_520 | 65 |
| 471 | 3300049823 | Ga0501044_1107833 | Ga0501044_1107833_47_253 | 65 |
| 472 | 3300049824 | Ga0501045_0820129 | Ga0501045_0820129_419_619 | 65 |
| 473 | 3300050489 | nmdc:mga03683_421963_c1 | nmdc:mga03683_421963_c1_144_344 | 65 |
| 474 | 3300050490 | nmdc:mga03n38_161849_c1 | nmdc:mga03n38_161849_c1_897_1106 | 65 |
| 475 | 3300050491 | nmdc:mga00v17_1284_c1 | nmdc:mga00v17_1284_c1_7438_7638 | 65 |
| 476 | 3300050491 | nmdc:mga00v17_512278_c1 | nmdc:mga00v17_512278_c1_25_225 | 65 |
| 477 | 3300050492 | nmdc:mga0yw44_625040_c1 | nmdc:mga0yw44_625040_c1_116_316 | 65 |
| 478 | 3300050492 | nmdc:mga0yw44_669865_c1 | nmdc:mga0yw44_669865_c1_386_643 | 65 |
| 479 | 3300050493 | nmdc:mga0k408_102085_c1 | nmdc:mga0k408_102085_c1_1401_1607 | 65 |
| 480 | 3300050493 | nmdc:mga0k408_312241_c1 | nmdc:mga0k408_312241_c1_297_497 | 65 |
| 481 | 3300050494 | nmdc:mga06z11_119069_c1 | nmdc:mga06z11_119069_c1_682_882 | 65 |
| 482 | 3300050494 | nmdc:mga06z11_296619_c1 | nmdc:mga06z11_296619_c1_674_883 | 65 |
| 483 | 3300050494 | nmdc:mga06z11_296640_c1 | nmdc:mga06z11_296640_c1_561_767 | 65 |
| 484 | 3300050496 | nmdc:mga07m45_672954_c1 | nmdc:mga07m45_672954_c1_138_344 | 65 |
| 485 | 3300050507 | nmdc:mga05p37_235686_c1 | nmdc:mga05p37_235686_c1_1061_1264 | 65 |
| 486 | 3300050507 | nmdc:mga05p37_568202_c1 | nmdc:mga05p37_568202_c1_638_838 | 65 |
| 487 | 3300050507 | nmdc:mga05p37_58409_c1 | nmdc:mga05p37_58409_c1_767_988 | 65 |
| 488 | 3300050508 | nmdc:mga09592_1159694_c1 | nmdc:mga09592_1159694_c1_382_585 | 65 |
| 489 | 3300050508 | nmdc:mga09592_724683_c1 | nmdc:mga09592_724683_c1_66_287 | 65 |
| 490 | 3300050508 | nmdc:mga09592_888430_c1 | nmdc:mga09592_888430_c1_324_527 | 65 |
| 491 | 3300050509 | nmdc:mga0qj67_1562554_c1 | nmdc:mga0qj67_1562554_c1_169_372 | 65 |
| 492 | 3300050509 | nmdc:mga0qj67_794079_c1 | nmdc:mga0qj67_794079_c1_67_270 | 65 |
| 493 | 3300050510 | nmdc:mga06r32_1083615_c1 | nmdc:mga06r32_1083615_c1_227_448 | 65 |
| 494 | 3300050510 | nmdc:mga06r32_551432_c1 | nmdc:mga06r32_551432_c1_427_630 | 65 |
| 495 | 3300050510 | nmdc:mga06r32_779416_c1 | nmdc:mga06r32_779416_c1_673_879 | 65 |
| 496 | 3300050511 | nmdc:mga08y16_100818_c1 | nmdc:mga08y16_100818_c1_293_496 | 65 |
| 497 | 3300050511 | nmdc:mga08y16_37233_c1 | nmdc:mga08y16_37233_c1_3828_4049 | 65 |
| 498 | 3300050511 | nmdc:mga08y16_9879_c2 | nmdc:mga08y16_9879_c2_4925_5128 | 65 |
| 499 | 3300050512 | nmdc:mga0n895_423292_c1 | nmdc:mga0n895_423292_c1_674_877 | 65 |
| 500 | 3300050512 | nmdc:mga0n895_47595_c1 | nmdc:mga0n895_47595_c1_451_759 | 65 |
| 501 | 3300050512 | nmdc:mga0n895_483706_c1 | nmdc:mga0n895_483706_c1_269_469 | 65 |
| 502 | 3300050513 | nmdc:mga0rr50_223414_c1 | nmdc:mga0rr50_223414_c1_582_785 | 65 |
| 503 | 3300050513 | nmdc:mga0rr50_444944_c1 | nmdc:mga0rr50_444944_c1_579_887 | 65 |
| 504 | 3300050515 | nmdc:mga0a205_525966_c1 | nmdc:mga0a205_525966_c1_435_743 | 65 |
| 505 | 3300050515 | nmdc:mga0a205_79259_c1 | nmdc:mga0a205_79259_c1_2349_2552 | 65 |
| 506 | 3300050516 | nmdc:mga0sz30_170332_c1 | nmdc:mga0sz30_170332_c1_326_532 | 65 |
| 507 | 3300050516 | nmdc:mga0sz30_549993_c1 | nmdc:mga0sz30_549993_c1_26_238 | 65 |
| 508 | 3300053085 | Ga0495619_1099174 | Ga0495619_1099174_219_422 | 65 |
| 509 | 3300053087 | Ga0500643_091036 | Ga0500643_091036_457_657 | 65 |
| 510 | 3300053087 | Ga0500643_168855 | Ga0500643_168855_96_308 | 65 |
| 511 | 3300053093 | Ga0500651_0224729 | Ga0500651_0224729_283_495 | 65 |
| 512 | 3300053104 | Ga0500556_0000009 | Ga0500556_0000009_148328_148537 | 65 |
| 513 | 3300053108 | Ga0500562_019707 | Ga0500562_019707_790_1017 | 65 |
| 514 | 3300053109 | Ga0500569_090116 | Ga0500569_090116_78_290 | 65 |
| 515 | 3300053122 | Ga0500608_085894 | Ga0500608_085894_1078_1290 | 65 |
| 516 | 3300053131 | Ga0500652_116740 | Ga0500652_116740_13_213 | 65 |
| 517 | 3300053133 | Ga0500655_132156 | Ga0500655_132156_142_354 | 65 |
| 518 | 3300053134 | Ga0500658_0258922 | Ga0500658_0258922_414_614 | 65 |
| 519 | 3300053137 | Ga0500561_0013973 | Ga0500561_0013973_615_827 | 65 |
| 520 | 3300053139 | Ga0500568_0281560 | Ga0500568_0281560_130_330 | 65 |
| 521 | 3300053142 | Ga0500577_0043076 | Ga0500577_0043076_901_1113 | 65 |
| 522 | 3300053146 | Ga0500588_0004535 | Ga0500588_0004535_809_1021 | 65 |
| 523 | 3300053151 | Ga0500604_0291867 | Ga0500604_0291867_336_536 | 65 |
| 524 | 3300053153 | Ga0500616_0024839 | Ga0500616_0024839_1600_1800 | 65 |
| 525 | 3300053153 | Ga0500616_0042639 | Ga0500616_0042639_2138_2350 | 65 |
| 526 | 3300053156 | Ga0500622_0001277 | Ga0500622_0001277_19492_19692 | 65 |
| 527 | 3300053156 | Ga0500622_0008990 | Ga0500622_0008990_4996_5208 | 65 |
| 528 | 3300053156 | Ga0500622_0269252 | Ga0500622_0269252_187_396 | 65 |
| 529 | 3300053157 | Ga0500624_029853 | Ga0500624_029853_470_682 | 65 |
| 530 | 3300053158 | Ga0500627_0147216 | Ga0500627_0147216_445_657 | 65 |
| 531 | 3300053158 | Ga0500627_0415870 | Ga0500627_0415870_270_470 | 65 |
| 532 | 3300053161 | Ga0500634_0068159 | Ga0500634_0068159_566_778 | 65 |
| 533 | 3300053177 | Ga0500636_0009188 | Ga0500636_0009188_521_733 | 65 |
| 534 | 3300053730 | Ga0500645_074069 | Ga0500645_074069_193_402 | 65 |
| 535 | 3300053730 | Ga0500645_201468 | Ga0500645_201468_238_450 | 65 |
| 536 | 3300054114 | Ga0501084_0023050 | Ga0501084_0023050_2789_2992 | 65 |
| 537 | 3300054114 | Ga0501084_0218577 | Ga0501084_0218577_642_872 | 65 |
| 538 | 3300054114 | Ga0501084_0381809 | Ga0501084_0381809_887_1090 | 65 |
| 539 | 3300054114 | Ga0501084_0565365 | Ga0501084_0565365_566_772 | 65 |
| 540 | 3300059491 | Ga0587070_024864 | Ga0587070_024864_748_948 | 65 |
| 541 | 3300059493 | Ga0587077_011314 | Ga0587077_011314_757_957 | 65 |
| 542 | 3300059493 | Ga0587077_013322 | Ga0587077_013322_10_210 | 65 |
| 543 | 3300059503 | Ga0587080_009823 | Ga0587080_009823_461_661 | 65 |
| 544 | 3300059506 | Ga0587085_021949 | Ga0587085_021949_552_755 | 65 |
| 545 | 3300059507 | Ga0587086_080249 | Ga0587086_080249_213_416 | 65 |
| 546 | 3300059509 | Ga0587089_113809 | Ga0587089_113809_96_299 | 65 |
| 547 | 3300059510 | Ga0587090_003741 | Ga0587090_003741_751_951 | 65 |
| 548 | 3300059605 | Ga0587106_000771 | Ga0587106_000771_701_901 | 65 |
| 549 | 3300059607 | Ga0587125_061066 | Ga0587125_061066_278_481 | 65 |
| 550 | 3300059623 | Ga0587101_003961 | Ga0587101_003961_161_361 | 65 |
| 551 | 3300059623 | Ga0587101_097169 | Ga0587101_097169_257_457 | 65 |
| 552 | 3300059639 | Ga0587062_015009 | Ga0587062_015009_296_496 | 65 |
| 553 | 3300059639 | Ga0587062_087362 | Ga0587062_087362_124_327 | 65 |
| 554 | 3300059641 | Ga0587068_002490 | Ga0587068_002490_1410_1610 | 65 |
| 555 | 3300059642 | Ga0587069_027693 | Ga0587069_027693_120_320 | 65 |
| 556 | 3300059643 | Ga0587072_072792 | Ga0587072_072792_391_594 | 65 |
| 557 | 3300059645 | Ga0587076_006671 | Ga0587076_006671_646_846 | 65 |
| 558 | 3300059652 | Ga0587107_075120 | Ga0587107_075120_324_524 | 65 |
| 559 | 3300060346 | Ga0587111_0000057 | Ga0587111_0000057_136_342 | 65 |
| 560 | 3300060346 | Ga0587111_0017505 | Ga0587111_0017505_804_1004 | 65 |
| 561 | 3300060346 | Ga0587111_0177517 | Ga0587111_0177517_205_408 | 65 |
| 562 | 3300060353 | Ga0501082_0017998 | Ga0501082_0017998_2106_2312 | 65 |
| 563 | 3300060353 | Ga0501082_0049749 | Ga0501082_0049749_1471_1674 | 65 |
| 564 | 3300060353 | Ga0501082_0084660 | Ga0501082_0084660_752_958 | 65 |
| 565 | 3300060353 | Ga0501082_0325161 | Ga0501082_0325161_1014_1244 | 65 |
| 566 | 3300060353 | Ga0501082_0348793 | Ga0501082_0348793_369_575 | 65 |
| 567 | 3300060353 | Ga0501082_0447594 | Ga0501082_0447594_602_805 | 65 |
| 568 | 3300060353 | Ga0501082_0676492 | Ga0501082_0676492_297_506 | 65 |
| 569 | 3300060353 | Ga0501082_0835902 | Ga0501082_0835902_217_417 | 65 |
| 570 | 3300060353 | Ga0501082_1444350 | Ga0501082_1444350_22_231 | 65 |
| 571 | 3300061734 | Ga0530510_0056862 | Ga0530510_0056862_1217_1423 | 65 |
| 572 | 3300061734 | Ga0530510_0373431 | Ga0530510_0373431_147_359 | 65 |
| 573 | 3300061734 | Ga0530510_0378904 | Ga0530510_0378904_673_879 | 65 |
| 574 | 3300061734 | Ga0530510_1306601 | Ga0530510_1306601_206_412 | 65 |
| 575 | iso_pu_bacteria | 2841911363 | 2841913387 | 65 |
| 576 | iso_pu_bacteria | 2841917233 | 2841919134 | 65 |
| 577 | iso_pu_bacteria | 8002060224 | 8002061405 | 65 |
| 578 | iso_pu_bacteria | 8004703790 | 8004710422 | 65 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a57-assembly1.cif.gz_2 | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.9883 | 4 | 60 |
| 5kcr-assembly1.cif.gz_12 | cryo-em structure of the escherichia coli 70s ribosome in complex with antibiotic avilamycin c, mrna and p-site trna at 3.6a resolution | 0.9869 | 2 | 62 |
| 4ybb-assembly1.cif.gz_DZ | high-resolution structure of the escherichia coli ribosome | 0.9865 | 2 | 62 |
| 8a63-assembly1.cif.gz_2 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.9855 | 4 | 60 |
| 5gad-assembly1.cif.gz_Z | rnc-srp-sr complex early state | 0.985 | 2 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wf9V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.976 | 10 | 64 | 1.10.287.310 |
| 4wceV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9671 | 2 | 64 | 1.10.287.310 |
| 1vq8V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9625 | 1 | 61 | 1.10.287.310 |
| 3cclV00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9625 | 1 | 61 | 1.10.287.310 |
| 3cc7V00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9624 | 1 | 61 | 1.10.287.310 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127EWI9-F1-model_v4 | Large ribosomal subunit protein uL29 | 1.004 | 1 | 63 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2N5JX79-F1-model_v4 | deleted | 1.004 | 1 | 64 |
|
| AF-A0A2G2GN20-F1-model_v4 | Large ribosomal subunit protein uL29 | 1.003 | 1 | 64 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A177QAN0-F1-model_v4 | Large ribosomal subunit protein uL29 | 1.002 | 1 | 64 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A424IU50-F1-model_v4 | Large ribosomal subunit protein uL29 | 1.002 | 1 | 64 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar