F465711

General Info

Members Datasets Scaffolds Average Seq Length
578 276 578 235

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100042246|Ga0068862_1000422464
Length 259
Sequence MPPSGRWKLIRQRFGIAAPRVEVQTQIPWYLRWAGIAIFLGVAGAAASWIYDAGRRFAGFDRSEVVQELQAVRSDLNTARAELARLRAIANAAESRVSIERTAQQTLAQQVRGLEQENARLREELAMFEQMLVSEERHTQTLAIYRFKVEPDVLPGEYRYRLLLLTPTDRRGRDFNGRLELVVSLQEGGQNAMMSFPEPGDAAAAQFRLAFKYFRRVEGTFRVNPKAKVESVQARVFEAGSSQPRATHSVSLDGTTKVN

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.83
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10085050 3300005328 Bacteria 1926
2 Ga0070683_100090729 3300005329 Bacteria 2869
3 Ga0070690_100002508 3300005330 Bacteria 9873
4 Ga0070690_100004385 3300005330 Bacteria 7829
5 Ga0070690_100329531 3300005330 Bacteria 1103
6 Ga0068869_100000144 3300005334 Bacteria 35078
7 Ga0068869_100048555 3300005334 Bacteria 3070
8 Ga0070666_10173642 3300005335 Bacteria 1510
9 Ga0070680_100018653 3300005336 Bacteria 5486
10 Ga0070680_100292477 3300005336 Bacteria 1381
11 Ga0068868_100008988 3300005338 Bacteria 7169
12 Ga0070689_100006117 3300005340 Bacteria 8294
13 Ga0070691_10011728 3300005341 Bacteria 4008
14 Ga0070687_100000509 3300005343 Bacteria 13007
15 Ga0070687_100083756 3300005343 Bacteria 1747
16 Ga0070687_100107079 3300005343 Bacteria 1576
17 Ga0070692_10003000 3300005345 Bacteria 6721
18 Ga0070692_10080478 3300005345 Bacteria 1754
19 Ga0070692_10118553 3300005345 Bacteria 1473
20 Ga0070668_100008339 3300005347 Bacteria 7695
21 Ga0070669_100036598 3300005353 Bacteria 3557
22 Ga0070675_100099912 3300005354 Bacteria 2443
23 Ga0070675_100264514 3300005354 Bacteria 1508
24 Ga0070673_100226793 3300005364 Bacteria 1619
25 Ga0070688_100128551 3300005365 Bacteria 1706
26 Ga0070714_100045792 3300005435 Bacteria 3708
27 Ga0070710_10012695 3300005437 Bacteria 4192
28 Ga0070701_10001813 3300005438 Bacteria 8066
29 Ga0070701_10081724 3300005438 Bacteria 1751
30 Ga0070705_100000974 3300005440 Bacteria 16059
31 Ga0070705_100007908 3300005440 Bacteria 5253
32 Ga0070700_100002307 3300005441 Bacteria 9712
33 Ga0070700_100017735 3300005441 Bacteria 4078
34 Ga0070700_100033731 3300005441 Bacteria 3085
35 Ga0070700_100203886 3300005441 Bacteria 1391
36 Ga0070694_100001628 3300005444 Bacteria 13178
37 Ga0070694_100035178 3300005444 Bacteria 3309
38 Ga0070694_100371692 3300005444 Unclassified 1113
39 Ga0070708_100325454 3300005445 Bacteria 1448
40 Ga0070681_10084421 3300005458 Bacteria 3128
41 Ga0068867_100001149 3300005459 Bacteria 18088
42 Ga0068867_100002155 3300005459 Bacteria 13810
43 Ga0070698_100629251 3300005471 Bacteria 1014
44 Ga0070699_100053074 3300005518 Bacteria 3509
45 Ga0070699_100075896 3300005518 Bacteria 2925
46 Ga0070679_100006806 3300005530 Bacteria 10660
47 Ga0070679_100155517 3300005530 Bacteria 2262
48 Ga0070672_100310759 3300005543 Bacteria 1338
49 Ga0070686_100000966 3300005544 Bacteria 16580
50 Ga0070686_100040646 3300005544 Bacteria 2902
51 Ga0070686_100058329 3300005544 Bacteria 2483
52 Ga0070695_100002253 3300005545 Bacteria 11042
53 Ga0070695_100016391 3300005545 Bacteria 4483
54 Ga0070695_100165611 3300005545 Bacteria 1556
55 Ga0070696_100000739 3300005546 Bacteria 20870
56 Ga0070696_100000933 3300005546 Bacteria 18945
57 Ga0070696_100028586 3300005546 Bacteria 3805
58 Ga0070696_100187444 3300005546 Bacteria 1538
59 Ga0070696_100302821 3300005546 Bacteria 1225
60 Ga0070696_100386375 3300005546 Bacteria 1092
61 Ga0070696_100453030 3300005546 Bacteria 1013
62 Ga0070693_100038627 3300005547 Bacteria 2669
63 Ga0070693_100159559 3300005547 Bacteria 1435
64 Ga0070693_100317232 3300005547 Bacteria 1056
65 Ga0070693_100336340 3300005547 Bacteria 1029
66 Ga0070704_100000093 3300005549 Bacteria 30795
67 Ga0070704_100011615 3300005549 Bacteria 5405
68 Ga0070704_100024563 3300005549 Bacteria 3955
69 Ga0068855_100006371 3300005563 Bacteria 14381
70 Ga0068854_100009430 3300005578 Bacteria 6302
71 Ga0068856_100031990 3300005614 Bacteria 5148
72 Ga0068856_100124470 3300005614 Bacteria 2581
73 Ga0070702_100000565 3300005615 Bacteria 13487
74 Ga0070702_100158585 3300005615 Bacteria 1460
75 Ga0070702_100415800 3300005615 Bacteria 966
76 Ga0068859_100006294 3300005617 Bacteria 12037
77 Ga0068859_100191583 3300005617 Bacteria 2129
78 Ga0068859_100597435 3300005617 Bacteria 1197
79 Ga0068866_10000746 3300005718 Bacteria 14720
80 Ga0068861_100001913 3300005719 Bacteria 13403
81 Ga0068861_100008115 3300005719 Bacteria 7223
82 Ga0068861_100563487 3300005719 Bacteria 1040
83 Ga0068870_10099655 3300005840 Bacteria 1639
84 Ga0068870_10206131 3300005840 Bacteria 1195
85 Ga0068858_100009592 3300005842 Bacteria 9231
86 Ga0068860_100089396 3300005843 Bacteria 2932
87 Ga0068862_100003161 3300005844 Bacteria 14315
88 Ga0068862_100042246 3300005844 Bacteria 3883
89 Ga0068862_100042303 3300005844 Bacteria 3881
90 Ga0081539_10000365 3300005985 Bacteria 99063
91 Ga0070716_100007007 3300006173 Bacteria 5529
92 Ga0070716_100308631 3300006173 Unclassified 1104
93 Ga0097621_100001187 3300006237 Bacteria 18061
94 Ga0097621_100083845 3300006237 Bacteria 2656
95 Ga0068871_100002265 3300006358 Bacteria 13084
96 Ga0068871_100019737 3300006358 Bacteria 5150
97 Ga0068871_100560157 3300006358 Bacteria 1036
98 Ga0075428_100023486 3300006844 Bacteria 6825
99 Ga0075428_100027836 3300006844 Bacteria 6254
100 Ga0075428_100040409 3300006844 Bacteria 5132
101 Ga0075428_100092047 3300006844 Bacteria 3306
102 Ga0075428_100724492 3300006844 Unclassified 1059
103 Ga0075430_100006267 3300006846 Bacteria 10032
104 Ga0075430_100092323 3300006846 Bacteria 2531
105 Ga0075430_100130127 3300006846 Bacteria 2098
106 Ga0075431_100023107 3300006847 Bacteria 6357
107 Ga0075431_100029256 3300006847 Bacteria 5669
108 Ga0075431_100132076 3300006847 Bacteria 2575
109 Ga0075431_100156970 3300006847 Bacteria 2341
110 Ga0075431_100382558 3300006847 Bacteria 1411
111 Ga0075433_10053982 3300006852 Bacteria 3505
112 Ga0075433_10094574 3300006852 Bacteria 2645
113 Ga0075434_100000306 3300006871 Bacteria 34874
114 Ga0075434_100005526 3300006871 Bacteria 11510
115 Ga0075434_100722694 3300006871 Bacteria 1013
116 Ga0075429_100000145 3300006880 Bacteria 43529
117 Ga0075429_100014658 3300006880 Bacteria 6796
118 Ga0075429_100024792 3300006880 Bacteria 5206
119 Ga0075429_100636054 3300006880 Bacteria 935
120 Ga0068865_100001100 3300006881 Bacteria 15603
121 Ga0068865_100011242 3300006881 Bacteria 5596
122 Ga0068865_100204073 3300006881 Bacteria 1536
123 Ga0075436_100000375 3300006914 Bacteria 28483
124 Ga0075436_100033749 3300006914 Bacteria 3527
125 Ga0075436_100034850 3300006914 Bacteria 3472
126 Ga0075436_100221666 3300006914 Bacteria 1342
127 Ga0097620_100006294 3300006931 Bacteria 12037
128 Ga0097620_100191604 3300006931 Bacteria 2129
129 Ga0097620_100597501 3300006931 Bacteria 1197
130 Ga0075435_100017559 3300007076 Bacteria 5419
131 Ga0075435_100040195 3300007076 Bacteria 3734
132 Ga0075435_100584460 3300007076 Bacteria 968
133 Ga0099794_10003576 3300007265 Bacteria 5955
134 Ga0099794_10009950 3300007265 Bacteria 4023
135 Ga0099794_10010226 3300007265 Bacteria 3977
136 Ga0099794_10057932 3300007265 Bacteria 1877
137 Ga0099795_10014970 3300007788 Bacteria 2418
138 Ga0111539_10006143 3300009094 Bacteria 15508
139 Ga0111539_10052933 3300009094 Bacteria 4831
140 Ga0111539_10096120 3300009094 Bacteria 3480
141 Ga0111539_10189542 3300009094 Bacteria 2400
142 Ga0111539_10228482 3300009094 Bacteria 2167
143 Ga0105245_10005883 3300009098 Bacteria 10773
144 Ga0105245_10498409 3300009098 Bacteria 1234
145 Ga0114129_10000393 3300009147 Bacteria 51077
146 Ga0114129_10527216 3300009147 Bacteria 1539
147 Ga0114129_10661176 3300009147 Bacteria 1347
148 Ga0105243_10004719 3300009148 Bacteria 10731
149 Ga0105243_10044229 3300009148 Bacteria 3493
150 Ga0105241_10605128 3300009174 Bacteria 990
151 Ga0105242_10000296 3300009176 Bacteria 39554
152 Ga0105248_10077763 3300009177 Bacteria 3730
153 Ga0105249_10001763 3300009553 Bacteria 18843
154 Ga0105249_10018583 3300009553 Bacteria 6188
155 Ga0099796_10043327 3300010159 Bacteria 1532
156 Ga0105246_10138338 3300011119 Bacteria 1828
157 Ga0157373_10109519 3300013100 Bacteria 1942
158 Ga0157371_10163266 3300013102 Bacteria 1591
159 Ga0157378_10003195 3300013297 Bacteria 14558
160 Ga0163162_10115490 3300013306 Bacteria 2784
161 Ga0157372_10224087 3300013307 Bacteria 2180
162 Ga0157375_10181878 3300013308 Bacteria 2254
163 Ga0157375_10406823 3300013308 Bacteria 1527
164 Ga0157380_10108561 3300014326 Bacteria 2326
165 Ga0157380_10182425 3300014326 Bacteria 1845
166 Ga0157377_10092033 3300014745 Bacteria 1792
167 Ga0157376_10000936 3300014969 Bacteria 18964
168 Ga0157376_10022734 3300014969 Bacteria 4894
169 Ga0207642_10003197 3300025899 Bacteria 5135
170 Ga0207642_10008706 3300025899 Bacteria 3497
171 Ga0207688_10008525 3300025901 Bacteria 5581
172 Ga0207680_10225926 3300025903 Bacteria 1285
173 Ga0207685_10031561 3300025905 Bacteria 1898
174 Ga0207645_10128850 3300025907 Bacteria 1646
175 Ga0207643_10025392 3300025908 Bacteria 3274
176 Ga0207643_10262359 3300025908 Bacteria 1067
177 Ga0207707_10043157 3300025912 Bacteria 3935
178 Ga0207707_10066126 3300025912 Bacteria 3148
179 Ga0207707_10499526 3300025912 Unclassified 1037
180 Ga0207660_10020901 3300025917 Bacteria 4397
181 Ga0207660_10137290 3300025917 Bacteria 1867
182 Ga0207660_10395852 3300025917 Bacteria 1112
183 Ga0207662_10000408 3300025918 Bacteria 19001
184 Ga0207662_10124796 3300025918 Bacteria 1618
185 Ga0207662_10167497 3300025918 Bacteria 1407
186 Ga0207652_10201665 3300025921 Bacteria 1790
187 Ga0207646_10219473 3300025922 Bacteria 1718
188 Ga0207681_10005406 3300025923 Bacteria 7846
189 Ga0207659_10060428 3300025926 Bacteria 2728
190 Ga0207687_10004862 3300025927 Bacteria 8931
191 Ga0207664_10160319 3300025929 Bacteria 1918
192 Ga0207686_10001177 3300025934 Bacteria 15116
193 Ga0207709_10004109 3300025935 Bacteria 8479
194 Ga0207709_10012991 3300025935 Bacteria 4590
195 Ga0207670_10005181 3300025936 Bacteria 7128
196 Ga0207670_10066673 3300025936 Bacteria 2474
197 Ga0207704_10000918 3300025938 Bacteria 13025
198 Ga0207704_10004148 3300025938 Bacteria 6605
199 Ga0207665_10317898 3300025939 Bacteria 1167
200 Ga0207691_10194578 3300025940 Bacteria 1767
201 Ga0207711_10145934 3300025941 Bacteria 2132
202 Ga0207689_10005174 3300025942 Bacteria 11717
203 Ga0207689_10175046 3300025942 Bacteria 1769
204 Ga0207689_10223258 3300025942 Bacteria 1557
205 Ga0207661_10080217 3300025944 Bacteria 2692
206 Ga0207661_10159581 3300025944 Bacteria 1956
207 Ga0207667_10029335 3300025949 Bacteria 5967
208 Ga0207651_10398279 3300025960 Bacteria 1170
209 Ga0207712_10009287 3300025961 Bacteria 6221
210 Ga0207712_10013791 3300025961 Bacteria 5184
211 Ga0207668_10003596 3300025972 Bacteria 9111
212 Ga0207640_10006940 3300025981 Bacteria 6230
213 Ga0207677_10012594 3300026023 Bacteria 4870
214 Ga0207703_10054571 3300026035 Bacteria 3250
215 Ga0207639_10090935 3300026041 Bacteria 2442
216 Ga0207708_10002074 3300026075 Bacteria 14763
217 Ga0207708_10041848 3300026075 Bacteria 3493
218 Ga0207708_10073796 3300026075 Bacteria 2615
219 Ga0207708_10267808 3300026075 Bacteria 1381
220 Ga0207702_10027487 3300026078 Bacteria 4724
221 Ga0207702_10372245 3300026078 Bacteria 1372
222 Ga0207648_10003015 3300026089 Bacteria 17790
223 Ga0207648_10005161 3300026089 Bacteria 13223
224 Ga0207648_10336558 3300026089 Bacteria 1358
225 Ga0207675_100000954 3300026118 Bacteria 28821
226 Ga0207675_100002609 3300026118 Bacteria 17841
227 Ga0207683_10434713 3300026121 Bacteria 1209
228 Ga0209969_1014600 3300027360 Bacteria 1144
229 Ga0209967_1005621 3300027364 Bacteria 1689
230 Ga0209981_1004502 3300027378 Bacteria 1831
231 Ga0209981_1005358 3300027378 Bacteria 1703
232 Ga0209996_1009691 3300027395 Bacteria 1272
233 Ga0210000_1000415 3300027462 Bacteria 5879
234 Ga0210000_1001858 3300027462 Bacteria 2984
235 Ga0210000_1009389 3300027462 Bacteria 1439
236 Ga0209995_1023225 3300027471 Bacteria 1031
237 Ga0209968_1003895 3300027526 Bacteria 2240
238 Ga0209999_1000420 3300027543 Bacteria 6544
239 Ga0209970_1001627 3300027614 Bacteria 3898
240 Ga0209588_1005808 3300027671 Bacteria 3553
241 Ga0209588_1005878 3300027671 Bacteria 3536
242 Ga0209588_1033196 3300027671 Bacteria 1655
243 Ga0209588_1065684 3300027671 Bacteria 1173
244 Ga0209966_1003058 3300027695 Bacteria 2806
245 Ga0209966_1003212 3300027695 Bacteria 2746
246 Ga0209974_10006215 3300027876 Bacteria 4180
247 Ga0207428_10000766 3300027907 Bacteria 36583
248 Ga0207428_10013958 3300027907 Bacteria 6997
249 Ga0207428_10014517 3300027907 Bacteria 6836
250 Ga0207428_10113601 3300027907 Bacteria 2082
251 Ga0207428_10141373 3300027907 Bacteria 1837
252 Ga0268265_10001934 3300028380 Bacteria 16433
253 Ga0268265_10050233 3300028380 Bacteria 3141
254 Ga0268265_10051998 3300028380 Bacteria 3095
255 Ga0268265_10360178 3300028380 Bacteria 1331
256 Ga0268264_10004281 3300028381 Bacteria 12183
257 Ga0316575_10000042 3300031665 Bacteria 31213
258 Ga0316579_10004329 3300031691 Bacteria 5627
259 Ga0316578_10198494 3300031728 Bacteria 1208
260 Ga0307405_10522557 3300031731 Bacteria 955
261 Ga0307406_10123946 3300031901 Bacteria 1802
262 Ga0307406_10372161 3300031901 Bacteria 1124
263 Ga0307416_100015416 3300032002 Bacteria 5280
264 Ga0307416_100100170 3300032002 Bacteria 2519
265 Ga0307416_100104870 3300032002 Bacteria 2473
266 Ga0307416_100844077 3300032002 Bacteria 1014
267 Ga0316583_10001814 3300032133 Bacteria 7266
268 Ga0316583_10011406 3300032133 Bacteria 3203
269 Ga0316583_10014149 3300032133 Bacteria 2878
270 Ga0373948_0025531 3300034817 Bacteria 1159
271 Ga0373950_0002602 3300034818 Bacteria 2499
272 Ga0373958_0014186 3300034819 Bacteria 1390
273 Ga0373938_0030247 3300034957 Bacteria 1154
274 Ga0373928_0001280 3300035084 Bacteria 4948
275 Ga0373929_0042022 3300035085 Bacteria 1018
276 Ga0373934_0000072 3300035086 Bacteria 34972
277 Ga0373934_0000747 3300035086 Bacteria 11636
278 Ga0373940_0019347 3300035088 Bacteria 1719
279 Ga0373944_0003130 3300035089 Bacteria 4257
280 Ga0373951_0010704 3300035091 Bacteria 2060
281 Ga0373923_0003342 3300035111 Bacteria 5128
282 Ga0373932_0009768 3300035112 Bacteria 2314
283 Ga0373932_0010269 3300035112 Bacteria 2263
284 Ga0373932_0024058 3300035112 Bacteria 1636
285 Ga0373936_0011228 3300035113 Bacteria 3387
286 Ga0373936_0016985 3300035113 Bacteria 2798
287 Ga0373939_0003004 3300035114 Bacteria 3959
288 Ga0373941_0066842 3300035115 Bacteria 1184
289 Ga0373954_0000059 3300035118 Bacteria 38918
290 Ga0373954_0000522 3300035118 Bacteria 14412
291 Ga0373954_0000755 3300035118 Bacteria 12508
292 Ga0373954_0001068 3300035118 Bacteria 10932
293 Ga0373954_0111032 3300035118 Bacteria 1326
294 Ga0373956_0000032 3300035119 Bacteria 44749
295 Ga0373956_0016277 3300035119 Bacteria 3121
296 Ga0373956_0025568 3300035119 Bacteria 2553
297 Ga0373956_0123871 3300035119 Bacteria 1208
298 Ga0373960_0007932 3300035121 Bacteria 2530
299 Ga0373943_0109384 3300035170 Bacteria 1456
300 Ga0373946_0094142 3300035171 Bacteria 1332
301 Ga0373955_0001531 3300035172 Bacteria 9881
302 Ga0373955_0009419 3300035172 Bacteria 4569
303 Ga0373955_0052590 3300035172 Bacteria 2222
304 Ga0373955_0387682 3300035172 Bacteria 848
305 Ga0373942_0004062 3300035207 Bacteria 3416
306 Ga0373942_0005856 3300035207 Bacteria 2845
307 Ga0373942_0013216 3300035207 Bacteria 1982
308 Ga0373961_0013208 3300035241 Bacteria 2078
309 Ga0373961_0015332 3300035241 Bacteria 1958
310 Ga0373961_0018666 3300035241 Bacteria 1814
311 Ga0373961_0081094 3300035241 Unclassified 1021
312 Ga0373962_0008139 3300035242 Bacteria 2576
313 Ga0373924_0002169 3300035410 Bacteria 6570
314 Ga0373924_0015038 3300035410 Bacteria 2934
315 Ga0373931_0003092 3300035691 Bacteria 7444
316 Ga0373931_0009676 3300035691 Bacteria 4615
317 Ga0373931_0021192 3300035691 Bacteria 3260
318 Ga0373931_0203521 3300035691 Bacteria 1184
319 Ga0373927_0065865 3300035695 Bacteria 2343
320 Ga0373927_0133582 3300035695 Bacteria 1621
321 Ga0373933_0001253 3300035724 Bacteria 14993
322 Ga0373933_0066547 3300035724 Bacteria 2183
323 Ga0373933_0188902 3300035724 Unclassified 1316
324 Ga0373947_0001813 3300035725 Bacteria 13070
325 Ga0373947_0186267 3300035725 Unclassified 1353
326 Ga0373937_0000487 3300036401 Bacteria 36252
327 Ga0373937_0002664 3300036401 Bacteria 14883
328 Ga0373937_0004354 3300036401 Bacteria 12020
329 Ga0373937_0135374 3300036401 Bacteria 2303
330 Ga0373937_0241761 3300036401 Bacteria 1701
331 Ga0373937_0249614 3300036401 Bacteria 1673
332 Ga0373937_0396936 3300036401 Bacteria 1308
333 Ga0316582_0013731 3300036647 Bacteria 4568
334 Ga0316584_0165789 3300036712 Bacteria 1641
335 Ga0439439_0077659 3300041406 Bacteria 895
336 Ga0439453_0004469 3300041408 Bacteria 2078
337 Ga0451845_0636266 3300041501 Bacteria 1079
338 Ga0439441_004254 3300042001 Bacteria 2158
339 Ga0439441_025778 3300042001 Bacteria 1112
340 Ga0439443_020685 3300042003 Bacteria 1035
341 Ga0439446_0033516 3300042156 Bacteria 1492
342 Ga0439434_0001404 3300042435 Bacteria 6946
343 Ga0439434_0066952 3300042435 Bacteria 1128
344 Ga0439435_0000172 3300042436 Bacteria 9063
345 Ga0439435_0003451 3300042436 Bacteria 3289
346 Ga0439435_0060401 3300042436 Bacteria 1103
347 Ga0439444_0001310 3300042437 Bacteria 3183
348 Ga0439460_0008178 3300042461 Bacteria 2638
349 Ga0450893_0015742 3300042532 Bacteria 1277
350 Ga0451577_0895771 3300042876 Unclassified 799
351 Ga0451576_0002938 3300045051 Bacteria 24214
352 Ga0451576_0004225 3300045051 Bacteria 18855
353 Ga0451576_0018770 3300045051 Bacteria 7562
354 Ga0451576_0023848 3300045051 Bacteria 6618
355 Ga0451576_0044507 3300045051 Bacteria 4680
356 Ga0451576_0056464 3300045051 Bacteria 4105
357 Ga0451576_0069422 3300045051 Bacteria 3667
358 Ga0451576_0074363 3300045051 Bacteria 3536
359 Ga0451576_0189098 3300045051 Bacteria 2150
360 Ga0451576_0219033 3300045051 Bacteria 1987
361 Ga0466967_0021254 3300045976 Bacteria 5265
362 Ga0495592_0007548 3300046454 Bacteria 8145
363 Ga0495592_0037461 3300046454 Bacteria 3651
364 Ga0495603_0010021 3300046455 Bacteria 5733
365 Ga0495629_0061381 3300046459 Bacteria 2627
366 Ga0495651_0004123 3300046462 Bacteria 11127
367 Ga0495651_0013221 3300046462 Bacteria 6381
368 Ga0495653_0005500 3300046463 Bacteria 10318
369 Ga0495653_0080908 3300046463 Bacteria 2402
370 Ga0495580_0007829 3300046472 Bacteria 8553
371 Ga0495580_0017367 3300046472 Bacteria 5383
372 Ga0495582_0019116 3300046473 Bacteria 3749
373 Ga0495582_0172851 3300046473 Bacteria 1230
374 Ga0495639_0005107 3300046475 Bacteria 5636
375 Ga0495639_0017538 3300046475 Bacteria 3111
376 Ga0495662_0007329 3300046476 Bacteria 5456
377 Ga0495662_0020468 3300046476 Bacteria 3200
378 Ga0495664_0031855 3300046477 Bacteria 3091
379 Ga0495608_0068843 3300046511 Bacteria 2313
380 Ga0495608_0083082 3300046511 Bacteria 2079
381 Ga0495618_0005079 3300046514 Bacteria 8039
382 Ga0495628_0033897 3300046516 Bacteria 4110
383 Ga0495628_0071066 3300046516 Bacteria 2713
384 Ga0495630_0002610 3300046517 Bacteria 12484
385 Ga0495630_0093905 3300046517 Bacteria 2268
386 Ga0495630_0166258 3300046517 Bacteria 1679
387 Ga0495666_0002721 3300046526 Bacteria 8826
388 Ga0495666_0017571 3300046526 Bacteria 3562
389 Ga0495666_0038695 3300046526 Bacteria 2319
390 Ga0495652_0099656 3300046529 Bacteria 2359
391 Ga0495652_0099940 3300046529 Bacteria 2355
392 Ga0495652_0362788 3300046529 Bacteria 1035
393 Ga0495652_0453987 3300046529 Bacteria 897
394 Ga0495665_0012747 3300046531 Bacteria 4549
395 Ga0495640_0018976 3300046533 Bacteria 5085
396 Ga0495640_0023869 3300046533 Bacteria 4449
397 Ga0495586_0004390 3300046535 Bacteria 7535
398 Ga0495586_0011069 3300046535 Bacteria 4792
399 Ga0495586_0014694 3300046535 Bacteria 4159
400 Ga0495587_0026224 3300046536 Bacteria 3555
401 Ga0495587_0044872 3300046536 Bacteria 2628
402 Ga0495587_0309198 3300046536 Bacteria 883
403 Ga0495587_0314500 3300046536 Bacteria 875
404 Ga0495598_0010846 3300046537 Bacteria 2194
405 Ga0495621_0055655 3300046539 Bacteria 1424
406 Ga0495622_0042429 3300046557 Bacteria 2115
407 Ga0495667_0025720 3300046559 Bacteria 3965
408 Ga0495667_0045846 3300046559 Bacteria 2892
409 Ga0495667_0114313 3300046559 Bacteria 1744
410 Ga0495634_0017568 3300046642 Bacteria 5102
411 Ga0495634_0018115 3300046642 Bacteria 5018
412 Ga0495635_0009581 3300046663 Bacteria 6769
413 Ga0495588_0064633 3300046674 Bacteria 1898
414 Ga0495657_0004048 3300046675 Bacteria 11756
415 Ga0495657_0106086 3300046675 Bacteria 1784
416 Ga0495599_0018760 3300046678 Bacteria 4311
417 Ga0495599_0105421 3300046678 Bacteria 1756
418 Ga0495599_0264013 3300046678 Unclassified 1045
419 Ga0495647_0000533 3300046681 Bacteria 11165
420 Ga0495647_0001320 3300046681 Bacteria 7631
421 Ga0495658_0008849 3300046683 Bacteria 5004
422 Ga0495658_0010870 3300046683 Bacteria 4560
423 Ga0495658_0045919 3300046683 Bacteria 2453
424 Ga0495669_0002492 3300046684 Bacteria 7515
425 Ga0495669_0091583 3300046684 Bacteria 1404
426 Ga0495613_0012771 3300046689 Bacteria 6245
427 Ga0495624_0004793 3300046690 Bacteria 9834
428 Ga0495624_0359481 3300046690 Bacteria 875
429 Ga0495600_0017744 3300046809 Bacteria 4530
430 Ga0495600_0021205 3300046809 Bacteria 4159
431 Ga0495604_0031525 3300047317 Bacteria 4204
432 Ga0495604_0094456 3300047317 Bacteria 2210
433 Ga0495604_0415784 3300047317 Bacteria 883
434 Ga0495636_0127975 3300047318 Bacteria 1128
435 Ga0495674_0010827 3300047319 Bacteria 8626
436 Ga0495676_0054045 3300047321 Bacteria 3195
437 Ga0495680_0004125 3300047322 Bacteria 13968
438 Ga0495680_0024998 3300047322 Bacteria 4946
439 Ga0495680_0082638 3300047322 Bacteria 2423
440 Ga0495680_0124320 3300047322 Bacteria 1902
441 Ga0495675_0093313 3300047444 Bacteria 1889
442 Ga0495684_0017407 3300047471 Bacteria 5532
443 Ga0495593_0135722 3300047673 Bacteria 1247
444 Ga0501297_005010 3300049520 Bacteria 1374
445 Ga0501031_0135696 3300049568 Bacteria 1608
446 Ga0501031_0185076 3300049568 Unclassified 1360
447 Ga0501032_0099465 3300049569 Bacteria 1927
448 Ga0501033_0022466 3300049570 Bacteria 4759
449 Ga0501036_0000268 3300049572 Bacteria 35567
450 Ga0501036_0004836 3300049572 Bacteria 10884
451 Ga0501036_0070538 3300049572 Bacteria 2955
452 Ga0501037_0058146 3300049573 Bacteria 2822
453 Ga0501037_0210796 3300049573 Bacteria 1370
454 Ga0501038_0020021 3300049574 Bacteria 6023
455 Ga0501038_0136745 3300049574 Bacteria 2007
456 Ga0501038_0261447 3300049574 Bacteria 1368
457 Ga0501039_0026109 3300049575 Bacteria 4488
458 Ga0501039_0075705 3300049575 Bacteria 2616
459 Ga0501039_0348370 3300049575 Bacteria 1164
460 Ga0501039_0439295 3300049575 Bacteria 1025
461 Ga0501040_0002845 3300049576 Bacteria 11165
462 Ga0501040_0074166 3300049576 Bacteria 2351
463 Ga0501040_0123958 3300049576 Bacteria 1814
464 Ga0501040_0349480 3300049576 Unclassified 1059
465 Ga0501041_0000171 3300049577 Bacteria 29019
466 Ga0501041_0007643 3300049577 Bacteria 6348
467 Ga0501041_0018645 3300049577 Bacteria 4133
468 Ga0501041_0239748 3300049577 Bacteria 1139
469 Ga0501042_0003752 3300049578 Bacteria 9600
470 Ga0501042_0122887 3300049578 Bacteria 1869
471 Ga0501043_0007248 3300049579 Bacteria 8807
472 Ga0501046_0005363 3300049580 Bacteria 11467
473 Ga0501046_0033689 3300049580 Bacteria 4137
474 Ga0501046_0038625 3300049580 Bacteria 3829
475 Ga0501047_0099643 3300049581 Bacteria 2785
476 Ga0501048_0002988 3300049582 Bacteria 12906
477 Ga0501048_0017910 3300049582 Bacteria 5212
478 Ga0501067_0029209 3300049583 Bacteria 3056
479 Ga0501068_0125534 3300049584 Bacteria 1602
480 Ga0501068_0176447 3300049584 Bacteria 1350
481 Ga0501070_0132428 3300049586 Bacteria 2059
482 Ga0501071_0065805 3300049587 Bacteria 2632
483 Ga0501071_0331535 3300049587 Bacteria 1157
484 Ga0501071_0382897 3300049587 Bacteria 1073
485 Ga0501072_0007011 3300049588 Bacteria 8555
486 Ga0501072_0110379 3300049588 Bacteria 2189
487 Ga0501073_0122035 3300049589 Bacteria 1806
488 Ga0501073_0134868 3300049589 Bacteria 1711
489 Ga0501074_0095745 3300049590 Bacteria 2126
490 Ga0501074_0139382 3300049590 Bacteria 1735
491 Ga0501075_0003959 3300049591 Bacteria 9983
492 Ga0501075_0024369 3300049591 Bacteria 4436
493 Ga0501075_0035536 3300049591 Bacteria 3717
494 Ga0501075_0178718 3300049591 Bacteria 1619
495 Ga0501075_0385917 3300049591 Bacteria 1068
496 Ga0501076_0009781 3300049592 Bacteria 7082
497 Ga0501076_0047742 3300049592 Bacteria 3385
498 Ga0501076_0197577 3300049592 Bacteria 1642
499 Ga0501077_0014240 3300049593 Bacteria 4994
500 Ga0501077_0028571 3300049593 Bacteria 3545
501 Ga0501225_0028593 3300049705 Bacteria 1532
502 Ga0501079_0005505 3300049741 Bacteria 9436
503 Ga0501079_0015806 3300049741 Bacteria 5767
504 Ga0501079_0049182 3300049741 Bacteria 3254
505 Ga0501079_0275599 3300049741 Bacteria 1315
506 Ga0501079_0387232 3300049741 Bacteria 1096
507 Ga0501080_0014806 3300049742 Bacteria 7183
508 Ga0501080_0260030 3300049742 Bacteria 1582
509 Ga0501081_0002036 3300049743 Bacteria 12604
510 Ga0501081_0005713 3300049743 Bacteria 8049
511 Ga0501081_0030146 3300049743 Bacteria 3670
512 Ga0501035_0054614 3300049822 Bacteria 3569
513 Ga0501035_0296212 3300049822 Bacteria 1364
514 Ga0501044_0298396 3300049823 Bacteria 1541
515 Ga0501045_0004851 3300049824 Bacteria 9307
516 Ga0501045_0010944 3300049824 Bacteria 6355
517 Ga0501045_0093225 3300049824 Bacteria 2227
518 Ga0501045_0228850 3300049824 Bacteria 1384
519 nmdc:mga05p37_288139_c1 3300050507 Bacteria 1955
520 nmdc:mga05p37_529058_c1 3300050507 Bacteria 1347
521 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
522 nmdc:mga05p37_812202_c1 3300050507 Bacteria 1021
523 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
524 nmdc:mga09592_16668_c1 3300050508 Bacteria 6013
525 nmdc:mga09592_352385_c1 3300050508 Bacteria 1274
526 nmdc:mga09592_35553_c1 3300050508 Bacteria 4171
527 nmdc:mga09592_401631_c1 3300050508 Bacteria 1185
528 nmdc:mga0qj67_308957_c1 3300050509 Bacteria 1281
529 nmdc:mga0qj67_52913_c1 3300050509 Bacteria 3214
530 nmdc:mga0qj67_740_c1 3300050509 Bacteria 22151
531 nmdc:mga0qj67_90690_c1 3300050509 Bacteria 2456
532 nmdc:mga0qj67_97038_c1 3300050509 Bacteria 2373
533 nmdc:mga06r32_157984_c1 3300050510 Bacteria 2249
534 nmdc:mga06r32_431354_c1 3300050510 Bacteria 1299
535 nmdc:mga06r32_45334_c1 3300050510 Bacteria 4191
536 nmdc:mga06r32_518552_c1 3300050510 Bacteria 1168
537 nmdc:mga06r32_570032_c1 3300050510 Bacteria 1105
538 nmdc:mga08y16_109792_c1 3300050511 Bacteria 2872
539 nmdc:mga08y16_11747_c1 3300050511 Bacteria 9201
540 nmdc:mga08y16_166513_c1 3300050511 Bacteria 2290
541 nmdc:mga08y16_195044_c1 3300050511 Bacteria 2100
542 nmdc:mga08y16_49876_c1 3300050511 Bacteria 4380
543 nmdc:mga08y16_5867_c1 3300050511 Bacteria 12866
544 nmdc:mga0n895_10506_c1 3300050512 Bacteria 8189
545 nmdc:mga0n895_432_c1 3300050512 Bacteria 28136
546 nmdc:mga0n895_610463_c1 3300050512 Bacteria 1092
547 nmdc:mga0n895_866_c1 3300050512 Bacteria 21745
548 nmdc:mga0rr50_13151_c1 3300050513 Bacteria 5377
549 nmdc:mga0rr50_1318_c1 3300050513 Bacteria 13536
550 nmdc:mga0rr50_469372_c1 3300050513 Bacteria 1068
551 nmdc:mga0rr50_7287_c1 3300050513 Bacteria 6806
552 nmdc:mga08x19_216992_c1 3300050514 Bacteria 1314
553 nmdc:mga08x19_219076_c1 3300050514 Bacteria 1307
554 nmdc:mga08x19_227528_c1 3300050514 Bacteria 1283
555 nmdc:mga08x19_263872_c1 3300050514 Bacteria 1191
556 nmdc:mga08x19_2831_c1 3300050514 Bacteria 10471
557 nmdc:mga08x19_4153_c1 3300050514 Bacteria 8588
558 nmdc:mga08x19_43732_c1 3300050514 Bacteria 2857
559 nmdc:mga0a205_13750_c1 3300050515 Bacteria 7543
560 nmdc:mga0a205_31396_c1 3300050515 Bacteria 5089
561 Ga0495601_0048329 3300053077 Bacteria 2679
562 Ga0495612_0046368 3300053078 Bacteria 1780
563 Ga0495595_0001225 3300053084 Bacteria 9989
564 Ga0495619_0038651 3300053085 Bacteria 3113
565 Ga0501084_0000832 3300054114 Bacteria 23774
566 Ga0501084_0062117 3300054114 Bacteria 3127
567 Ga0501084_0148038 3300054114 Bacteria 1978
568 Ga0501084_0155913 3300054114 Bacteria 1926
569 Ga0501082_0006696 3300060353 Bacteria 9967
570 Ga0501082_0071784 3300060353 Bacteria 2982
571 Ga0501082_0079297 3300060353 Bacteria 2833
572 Ga0501082_0141373 3300060353 Bacteria 2089
573 Ga0501082_0419217 3300060353 Bacteria 1169
574 Ga0530510_0000042 3300061734 Bacteria 58436
575 Ga0530510_0001659 3300061734 Bacteria 15060
576 Ga0530510_0159222 3300061734 Bacteria 1670
577 Ga0530510_0524983 3300061734 Bacteria 898
578 Ga0530510_0620237 3300061734 Unclassified 823

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035241 Ga0373961_0015332 Ga0373961_0015332_730_1374 173
2 3300007788 Ga0099795_10014970 Ga0099795_100149702 182
3 3300010159 Ga0099796_10043327 Ga0099796_100433273 182
4 3300007265 Ga0099794_10003576 Ga0099794_100035767 183
5 3300027671 Ga0209588_1005878 Ga0209588_10058782 183
6 3300005546 Ga0070696_100187444 Ga0070696_1001874443 188
7 3300032002 Ga0307416_100015416 Ga0307416_1000154162 188
8 3300031665 Ga0316575_10000042 Ga0316575_1000004212 189
9 3300046536 Ga0495587_0314500 Ga0495587_0314500_193_846 191
10 3300050514 nmdc:mga08x19_216992_c1 nmdc:mga08x19_216992_c1_176_937 191
11 3300049822 Ga0501035_0296212 Ga0501035_0296212_256_1020 192
12 3300006852 Ga0075433_10053982 Ga0075433_100539823 193
13 3300006871 Ga0075434_100722694 Ga0075434_1007226942 193
14 3300007076 Ga0075435_100017559 Ga0075435_1000175597 193
15 3300035118 Ga0373954_0000522 Ga0373954_0000522_9696_10445 193
16 3300042876 Ga0451577_0895771 Ga0451577_0895771_11_700 193
17 3300046678 Ga0495599_0264013 Ga0495599_0264013_235_984 193
18 3300050513 nmdc:mga0rr50_13151_c1 nmdc:mga0rr50_13151_c1_785_1534 193
19 3300032133 Ga0316583_10014149 Ga0316583_100141494 194
20 3300061734 Ga0530510_0620237 Ga0530510_0620237_13_666 194
21 3300005441 Ga0070700_100203886 Ga0070700_1002038862 195
22 3300026075 Ga0207708_10073796 Ga0207708_100737964 195
23 3300026089 Ga0207648_10336558 Ga0207648_103365582 195
24 3300035086 Ga0373934_0000747 Ga0373934_0000747_4954_5703 195
25 3300035111 Ga0373923_0003342 Ga0373923_0003342_1221_1970 195
26 3300035113 Ga0373936_0016985 Ga0373936_0016985_226_975 195
27 3300035118 Ga0373954_0000755 Ga0373954_0000755_6578_7327 195
28 3300035119 Ga0373956_0016277 Ga0373956_0016277_1152_1901 195
29 3300035170 Ga0373943_0109384 Ga0373943_0109384_374_1123 195
30 3300035171 Ga0373946_0094142 Ga0373946_0094142_311_1060 195
31 3300035172 Ga0373955_0009419 Ga0373955_0009419_3446_4195 195
32 3300035410 Ga0373924_0002169 Ga0373924_0002169_4904_5653 195
33 3300035695 Ga0373927_0065865 Ga0373927_0065865_728_1477 195
34 3300035724 Ga0373933_0066547 Ga0373933_0066547_1328_2077 195
35 3300035725 Ga0373947_0186267 Ga0373947_0186267_59_808 195
36 3300036401 Ga0373937_0135374 Ga0373937_0135374_1214_1963 195
37 3300046454 Ga0495592_0007548 Ga0495592_0007548_5937_6686 195
38 3300046459 Ga0495629_0061381 Ga0495629_0061381_628_1377 195
39 3300046462 Ga0495651_0013221 Ga0495651_0013221_5222_5971 195
40 3300046463 Ga0495653_0005500 Ga0495653_0005500_3316_4065 195
41 3300046472 Ga0495580_0007829 Ga0495580_0007829_4957_5706 195
42 3300046473 Ga0495582_0019116 Ga0495582_0019116_1371_2120 195
43 3300046475 Ga0495639_0005107 Ga0495639_0005107_874_1623 195
44 3300046476 Ga0495662_0007329 Ga0495662_0007329_806_1555 195
45 3300046477 Ga0495664_0031855 Ga0495664_0031855_2214_2963 195
46 3300046511 Ga0495608_0068843 Ga0495608_0068843_341_1090 195
47 3300046514 Ga0495618_0005079 Ga0495618_0005079_6077_6826 195
48 3300046516 Ga0495628_0071066 Ga0495628_0071066_687_1436 195
49 3300046517 Ga0495630_0002610 Ga0495630_0002610_8248_8997 195
50 3300046526 Ga0495666_0002721 Ga0495666_0002721_6632_7381 195
51 3300046529 Ga0495652_0099656 Ga0495652_0099656_1271_2020 195
52 3300046533 Ga0495640_0018976 Ga0495640_0018976_3056_3805 195
53 3300046535 Ga0495586_0011069 Ga0495586_0011069_988_1737 195
54 3300046536 Ga0495587_0044872 Ga0495587_0044872_1539_2288 195
55 3300046557 Ga0495622_0042429 Ga0495622_0042429_130_879 195
56 3300046559 Ga0495667_0025720 Ga0495667_0025720_1130_1879 195
57 3300046642 Ga0495634_0018115 Ga0495634_0018115_1214_1963 195
58 3300046663 Ga0495635_0009581 Ga0495635_0009581_5481_6230 195
59 3300046675 Ga0495657_0004048 Ga0495657_0004048_5494_6243 195
60 3300046678 Ga0495599_0018760 Ga0495599_0018760_3488_4237 195
61 3300046681 Ga0495647_0001320 Ga0495647_0001320_5074_5823 195
62 3300046683 Ga0495658_0010870 Ga0495658_0010870_3065_3814 195
63 3300046690 Ga0495624_0004793 Ga0495624_0004793_5655_6404 195
64 3300046809 Ga0495600_0021205 Ga0495600_0021205_3070_3819 195
65 3300047317 Ga0495604_0094456 Ga0495604_0094456_107_856 195
66 3300047319 Ga0495674_0010827 Ga0495674_0010827_6078_6827 195
67 3300047322 Ga0495680_0082638 Ga0495680_0082638_446_1195 195
68 3300047471 Ga0495684_0017407 Ga0495684_0017407_4306_5055 195
69 3300053078 Ga0495612_0046368 Ga0495612_0046368_380_1129 195
70 3300053084 Ga0495595_0001225 Ga0495595_0001225_4056_4805 195
71 3300053085 Ga0495619_0038651 Ga0495619_0038651_1681_2430 195
72 3300005343 Ga0070687_100083756 Ga0070687_1000837561 196
73 3300005544 Ga0070686_100040646 Ga0070686_1000406463 196
74 3300006847 Ga0075431_100156970 Ga0075431_1001569704 196
75 3300006871 Ga0075434_100005526 Ga0075434_10000552613 196
76 3300006881 Ga0068865_100204073 Ga0068865_1002040732 196
77 3300006914 Ga0075436_100221666 Ga0075436_1002216662 196
78 3300007076 Ga0075435_100584460 Ga0075435_1005844601 196
79 3300025942 Ga0207689_10223258 Ga0207689_102232582 196
80 3300031731 Ga0307405_10522557 Ga0307405_105225572 196
81 3300034957 Ga0373938_0030247 Ga0373938_0030247_265_1026 196
82 3300035085 Ga0373929_0042022 Ga0373929_0042022_103_864 196
83 3300035207 Ga0373942_0013216 Ga0373942_0013216_1089_1850 196
84 3300035241 Ga0373961_0018666 Ga0373961_0018666_412_1173 196
85 3300035691 Ga0373931_0009676 Ga0373931_0009676_2261_3022 196
86 3300042156 Ga0439446_0033516 Ga0439446_0033516_137_904 196
87 3300042435 Ga0439434_0001404 Ga0439434_0001404_910_1677 196
88 3300042436 Ga0439435_0000172 Ga0439435_0000172_6277_7044 196
89 3300049520 Ga0501297_005010 Ga0501297_005010_174_929 196
90 3300050509 nmdc:mga0qj67_90690_c1 nmdc:mga0qj67_90690_c1_1199_1954 196
91 3300050512 nmdc:mga0n895_866_c1 nmdc:mga0n895_866_c1_16172_16870 196
92 3300050513 nmdc:mga0rr50_469372_c1 nmdc:mga0rr50_469372_c1_122_820 196
93 3300050514 nmdc:mga08x19_219076_c1 nmdc:mga08x19_219076_c1_441_1190 196
94 3300005985 Ga0081539_10000365 Ga0081539_1000036579 197
95 3300025907 Ga0207645_10128850 Ga0207645_101288503 197
96 3300005440 Ga0070705_100007908 Ga0070705_1000079082 198
97 3300005444 Ga0070694_100035178 Ga0070694_1000351784 198
98 3300005545 Ga0070695_100016391 Ga0070695_1000163915 198
99 3300005546 Ga0070696_100028586 Ga0070696_1000285862 198
100 3300005547 Ga0070693_100317232 Ga0070693_1003172321 198
101 3300005549 Ga0070704_100011615 Ga0070704_1000116156 198
102 3300006173 Ga0070716_100007007 Ga0070716_1000070076 199
103 3300006914 Ga0075436_100033749 Ga0075436_1000337492 199
104 3300007265 Ga0099794_10010226 Ga0099794_100102265 199
105 3300025905 Ga0207685_10031561 Ga0207685_100315612 199
106 3300027671 Ga0209588_1033196 Ga0209588_10331962 199
107 3300050514 nmdc:mga08x19_43732_c1 nmdc:mga08x19_43732_c1_988_1737 199
108 3300005549 Ga0070704_100024563 Ga0070704_1000245634 200
109 3300025912 Ga0207707_10043157 Ga0207707_100431572 200
110 3300035121 Ga0373960_0007932 Ga0373960_0007932_997_1725 200
111 3300035691 Ga0373931_0203521 Ga0373931_0203521_146_874 200
112 3300005546 Ga0070696_100386375 Ga0070696_1003863751 202
113 3300046529 Ga0495652_0099940 Ga0495652_0099940_540_1292 203
114 3300005546 Ga0070696_100302821 Ga0070696_1003028211 204
115 3300005547 Ga0070693_100159559 Ga0070693_1001595592 204
116 3300006358 Ga0068871_100560157 Ga0068871_1005601571 204
117 3300009098 Ga0105245_10498409 Ga0105245_104984091 204
118 3300035086 Ga0373934_0000072 Ga0373934_0000072_14781_15530 204
119 3300035118 Ga0373954_0111032 Ga0373954_0111032_430_1179 204
120 3300035119 Ga0373956_0000032 Ga0373956_0000032_4905_5654 204
121 3300035172 Ga0373955_0001531 Ga0373955_0001531_338_1087 204
122 3300035724 Ga0373933_0001253 Ga0373933_0001253_6473_7222 204
123 3300036401 Ga0373937_0000487 Ga0373937_0000487_7985_8734 204
124 3300045051 Ga0451576_0074363 Ga0451576_0074363_2674_3438 204
125 3300046462 Ga0495651_0004123 Ga0495651_0004123_2993_3742 204
126 3300046675 Ga0495657_0106086 Ga0495657_0106086_320_1069 204
127 3300047322 Ga0495680_0124320 Ga0495680_0124320_618_1367 204
128 3300047444 Ga0495675_0093313 Ga0495675_0093313_243_992 204
129 3300013100 Ga0157373_10109519 Ga0157373_101095191 205
130 3300035172 Ga0373955_0387682 Ga0373955_0387682_23_781 205
131 3300036401 Ga0373937_0396936 Ga0373937_0396936_168_926 205
132 3300042001 Ga0439441_004254 Ga0439441_004254_328_1092 205
133 3300046454 Ga0495592_0037461 Ga0495592_0037461_486_1244 205
134 3300046463 Ga0495653_0080908 Ga0495653_0080908_415_1173 205
135 3300046476 Ga0495662_0020468 Ga0495662_0020468_363_1121 205
136 3300046511 Ga0495608_0083082 Ga0495608_0083082_908_1666 205
137 3300046516 Ga0495628_0033897 Ga0495628_0033897_1267_2025 205
138 3300046517 Ga0495630_0166258 Ga0495630_0166258_689_1447 205
139 3300046526 Ga0495666_0038695 Ga0495666_0038695_833_1591 205
140 3300046533 Ga0495640_0023869 Ga0495640_0023869_1051_1809 205
141 3300046535 Ga0495586_0014694 Ga0495586_0014694_1057_1815 205
142 3300046536 Ga0495587_0026224 Ga0495587_0026224_2359_3117 205
143 3300046559 Ga0495667_0045846 Ga0495667_0045846_1390_2148 205
144 3300046642 Ga0495634_0017568 Ga0495634_0017568_1039_1797 205
145 3300046678 Ga0495599_0105421 Ga0495599_0105421_230_988 205
146 3300046683 Ga0495658_0045919 Ga0495658_0045919_1054_1812 205
147 3300046689 Ga0495613_0012771 Ga0495613_0012771_1531_2289 205
148 3300046690 Ga0495624_0359481 Ga0495624_0359481_97_855 205
149 3300046809 Ga0495600_0017744 Ga0495600_0017744_1087_1845 205
150 3300047317 Ga0495604_0031525 Ga0495604_0031525_168_926 205
151 3300047322 Ga0495680_0004125 Ga0495680_0004125_2477_3235 205
152 3300047673 Ga0495593_0135722 Ga0495593_0135722_434_1192 205
153 3300049572 Ga0501036_0000268 Ga0501036_0000268_12696_13445 205
154 3300049592 Ga0501076_0197577 Ga0501076_0197577_495_1250 205
155 3300049741 Ga0501079_0387232 Ga0501079_0387232_176_931 205
156 3300049742 Ga0501080_0260030 Ga0501080_0260030_322_1077 205
157 3300053077 Ga0495601_0048329 Ga0495601_0048329_1776_2534 205
158 3300005345 Ga0070692_10080478 Ga0070692_100804782 206
159 3300005471 Ga0070698_100629251 Ga0070698_1006292511 206
160 3300005547 Ga0070693_100336340 Ga0070693_1003363402 206
161 3300006871 Ga0075434_100000306 Ga0075434_1000003062 206
162 3300007076 Ga0075435_100040195 Ga0075435_1000401956 206
163 3300049572 Ga0501036_0070538 Ga0501036_0070538_1296_2060 206
164 3300049574 Ga0501038_0136745 Ga0501038_0136745_409_1173 206
165 3300049576 Ga0501040_0074166 Ga0501040_0074166_1134_1898 206
166 3300049577 Ga0501041_0018645 Ga0501041_0018645_2895_3659 206
167 3300049578 Ga0501042_0122887 Ga0501042_0122887_421_1185 206
168 3300049580 Ga0501046_0033689 Ga0501046_0033689_474_1238 206
169 3300049591 Ga0501075_0035536 Ga0501075_0035536_214_978 206
170 3300049824 Ga0501045_0010944 Ga0501045_0010944_3330_4094 206
171 3300050512 nmdc:mga0n895_432_c1 nmdc:mga0n895_432_c1_26775_27536 206
172 3300050513 nmdc:mga0rr50_1318_c1 nmdc:mga0rr50_1318_c1_1188_1949 206
173 3300050514 nmdc:mga08x19_263872_c1 nmdc:mga08x19_263872_c1_143_904 206
174 3300054114 Ga0501084_0155913 Ga0501084_0155913_261_1025 206
175 3300060353 Ga0501082_0141373 Ga0501082_0141373_994_1758 206
176 3300061734 Ga0530510_0524983 Ga0530510_0524983_26_790 206
177 3300006880 Ga0075429_100014658 Ga0075429_1000146582 207
178 3300027378 Ga0209981_1004502 Ga0209981_10045022 207
179 3300027462 Ga0210000_1000415 Ga0210000_10004153 207
180 3300027471 Ga0209995_1023225 Ga0209995_10232252 207
181 3300027543 Ga0209999_1000420 Ga0209999_10004208 207
182 3300027671 Ga0209588_1065684 Ga0209588_10656842 207
183 3300032133 Ga0316583_10001814 Ga0316583_100018144 207
184 3300045051 Ga0451576_0002938 Ga0451576_0002938_22162_22905 207
185 3300045051 Ga0451576_0018770 Ga0451576_0018770_1306_2049 207
186 3300046684 Ga0495669_0091583 Ga0495669_0091583_242_997 207
187 3300049575 Ga0501039_0439295 Ga0501039_0439295_79_843 207
188 3300050508 nmdc:mga09592_35553_c1 nmdc:mga09592_35553_c1_331_1086 207
189 3300006844 Ga0075428_100023486 Ga0075428_1000234868 208
190 3300006880 Ga0075429_100000145 Ga0075429_10000014512 208
191 3300009094 Ga0111539_10228482 Ga0111539_102284822 208
192 3300009147 Ga0114129_10000393 Ga0114129_1000039331 208
193 3300027907 Ga0207428_10000766 Ga0207428_1000076611 208
194 3300034817 Ga0373948_0025531 Ga0373948_0025531_53_817 208
195 3300034818 Ga0373950_0002602 Ga0373950_0002602_270_1034 208
196 3300034819 Ga0373958_0014186 Ga0373958_0014186_29_793 208
197 3300035084 Ga0373928_0001280 Ga0373928_0001280_2215_2979 208
198 3300035088 Ga0373940_0019347 Ga0373940_0019347_771_1535 208
199 3300035091 Ga0373951_0010704 Ga0373951_0010704_390_1154 208
200 3300035112 Ga0373932_0010269 Ga0373932_0010269_51_815 208
201 3300035112 Ga0373932_0024058 Ga0373932_0024058_391_1152 208
202 3300035114 Ga0373939_0003004 Ga0373939_0003004_2589_3353 208
203 3300035241 Ga0373961_0013208 Ga0373961_0013208_129_893 208
204 3300035242 Ga0373962_0008139 Ga0373962_0008139_152_916 208
205 3300035691 Ga0373931_0003092 Ga0373931_0003092_1639_2403 208
206 3300035691 Ga0373931_0021192 Ga0373931_0021192_780_1541 208
207 3300045051 Ga0451576_0044507 Ga0451576_0044507_2148_2909 208
208 3300045051 Ga0451576_0056464 Ga0451576_0056464_3124_3888 208
209 3300045051 Ga0451576_0069422 Ga0451576_0069422_418_1194 208
210 3300046473 Ga0495582_0172851 Ga0495582_0172851_264_1016 208
211 3300046684 Ga0495669_0002492 Ga0495669_0002492_159_920 208
212 3300047318 Ga0495636_0127975 Ga0495636_0127975_85_846 208
213 3300050507 nmdc:mga05p37_775_c1 nmdc:mga05p37_775_c1_18300_19064 208
214 3300050508 nmdc:mga09592_148_c1 nmdc:mga09592_148_c1_45178_45942 208
215 3300050511 nmdc:mga08y16_5867_c1 nmdc:mga08y16_5867_c1_9964_10728 208
216 3300050512 nmdc:mga0n895_610463_c1 nmdc:mga0n895_610463_c1_239_1003 208
217 3300006844 Ga0075428_100027836 Ga0075428_1000278368 209
218 3300006844 Ga0075428_100092047 Ga0075428_1000920471 209
219 3300006846 Ga0075430_100130127 Ga0075430_1001301274 209
220 3300006847 Ga0075431_100029256 Ga0075431_1000292564 209
221 3300006847 Ga0075431_100132076 Ga0075431_1001320764 209
222 3300009147 Ga0114129_10527216 Ga0114129_105272162 209
223 3300027360 Ga0209969_1014600 Ga0209969_10146002 209
224 3300027695 Ga0209966_1003058 Ga0209966_10030584 209
225 3300031901 Ga0307406_10123946 Ga0307406_101239462 209
226 3300045051 Ga0451576_0219033 Ga0451576_0219033_590_1354 209
227 3300049591 Ga0501075_0385917 Ga0501075_0385917_222_977 209
228 3300050509 nmdc:mga0qj67_97038_c1 nmdc:mga0qj67_97038_c1_599_1378 209
229 3300050510 nmdc:mga06r32_157984_c1 nmdc:mga06r32_157984_c1_627_1406 209
230 3300050510 nmdc:mga06r32_431354_c1 nmdc:mga06r32_431354_c1_510_1286 209
231 3300050510 nmdc:mga06r32_518552_c1 nmdc:mga06r32_518552_c1_112_867 209
232 3300005617 Ga0068859_100191583 Ga0068859_1001915833 210
233 3300006880 Ga0075429_100636054 Ga0075429_1006360541 210
234 3300006914 Ga0075436_100034850 Ga0075436_1000348506 210
235 3300006931 Ga0097620_100191604 Ga0097620_1001916042 210
236 3300007265 Ga0099794_10057932 Ga0099794_100579322 210
237 3300025936 Ga0207670_10066673 Ga0207670_100666734 210
238 3300032002 Ga0307416_100104870 Ga0307416_1001048702 210
239 3300035119 Ga0373956_0025568 Ga0373956_0025568_1074_1844 210
240 3300035172 Ga0373955_0052590 Ga0373955_0052590_788_1558 210
241 3300035410 Ga0373924_0015038 Ga0373924_0015038_1729_2499 210
242 3300036401 Ga0373937_0004354 Ga0373937_0004354_6695_7465 210
243 3300046517 Ga0495630_0093905 Ga0495630_0093905_1250_2020 210
244 3300046529 Ga0495652_0362788 Ga0495652_0362788_64_834 210
245 3300047322 Ga0495680_0024998 Ga0495680_0024998_2776_3546 210
246 3300050514 nmdc:mga08x19_227528_c1 nmdc:mga08x19_227528_c1_125_886 210
247 3300005330 Ga0070690_100002508 Ga0070690_1000025084 211
248 3300005334 Ga0068869_100000144 Ga0068869_10000014411 211
249 3300005335 Ga0070666_10173642 Ga0070666_101736422 211
250 3300005336 Ga0070680_100018653 Ga0070680_1000186536 211
251 3300005338 Ga0068868_100008988 Ga0068868_1000089885 211
252 3300005340 Ga0070689_100006117 Ga0070689_1000061175 211
253 3300005341 Ga0070691_10011728 Ga0070691_100117283 211
254 3300005343 Ga0070687_100000509 Ga0070687_10000050910 211
255 3300005345 Ga0070692_10003000 Ga0070692_100030004 211
256 3300005354 Ga0070675_100264514 Ga0070675_1002645142 211
257 3300005365 Ga0070688_100128551 Ga0070688_1001285513 211
258 3300005437 Ga0070710_10012695 Ga0070710_100126954 211
259 3300005438 Ga0070701_10001813 Ga0070701_100018133 211
260 3300005440 Ga0070705_100000974 Ga0070705_10000097413 211
261 3300005441 Ga0070700_100002307 Ga0070700_1000023074 211
262 3300005444 Ga0070694_100001628 Ga0070694_1000016283 211
263 3300005445 Ga0070708_100325454 Ga0070708_1003254542 211
264 3300005458 Ga0070681_10084421 Ga0070681_100844214 211
265 3300005459 Ga0068867_100002155 Ga0068867_1000021558 211
266 3300005518 Ga0070699_100053074 Ga0070699_1000530741 211
267 3300005530 Ga0070679_100006806 Ga0070679_10000680610 211
268 3300005544 Ga0070686_100000966 Ga0070686_10000096610 211
269 3300005545 Ga0070695_100002253 Ga0070695_10000225310 211
270 3300005546 Ga0070696_100000933 Ga0070696_10000093319 211
271 3300005547 Ga0070693_100038627 Ga0070693_1000386273 211
272 3300005549 Ga0070704_100000093 Ga0070704_1000000936 211
273 3300005563 Ga0068855_100006371 Ga0068855_1000063715 211
274 3300005578 Ga0068854_100009430 Ga0068854_1000094306 211
275 3300005614 Ga0068856_100124470 Ga0068856_1001244704 211
276 3300005615 Ga0070702_100000565 Ga0070702_1000005653 211
277 3300005617 Ga0068859_100006294 Ga0068859_10000629411 211
278 3300005718 Ga0068866_10000746 Ga0068866_100007466 211
279 3300005719 Ga0068861_100001913 Ga0068861_10000191313 211
280 3300005842 Ga0068858_100009592 Ga0068858_1000095926 211
281 3300005843 Ga0068860_100089396 Ga0068860_1000893963 211
282 3300005844 Ga0068862_100003161 Ga0068862_10000316110 211
283 3300006237 Ga0097621_100001187 Ga0097621_10000118713 211
284 3300006358 Ga0068871_100019737 Ga0068871_1000197373 211
285 3300006881 Ga0068865_100001100 Ga0068865_10000110013 211
286 3300006931 Ga0097620_100006294 Ga0097620_10000629411 211
287 3300009098 Ga0105245_10005883 Ga0105245_100058836 211
288 3300009148 Ga0105243_10004719 Ga0105243_100047196 211
289 3300009174 Ga0105241_10605128 Ga0105241_106051281 211
290 3300009176 Ga0105242_10000296 Ga0105242_1000029641 211
291 3300009553 Ga0105249_10018583 Ga0105249_100185837 211
292 3300011119 Ga0105246_10138338 Ga0105246_101383384 211
293 3300013102 Ga0157371_10163266 Ga0157371_101632662 211
294 3300013297 Ga0157378_10003195 Ga0157378_1000319512 211
295 3300013306 Ga0163162_10115490 Ga0163162_101154903 211
296 3300013308 Ga0157375_10181878 Ga0157375_101818784 211
297 3300014326 Ga0157380_10182425 Ga0157380_101824252 211
298 3300014745 Ga0157377_10092033 Ga0157377_100920332 211
299 3300014969 Ga0157376_10000936 Ga0157376_1000093615 211
300 3300025899 Ga0207642_10003197 Ga0207642_100031972 211
301 3300025901 Ga0207688_10008525 Ga0207688_100085254 211
302 3300025903 Ga0207680_10225926 Ga0207680_102259262 211
303 3300025908 Ga0207643_10025392 Ga0207643_100253925 211
304 3300025912 Ga0207707_10066126 Ga0207707_100661264 211
305 3300025917 Ga0207660_10020901 Ga0207660_100209014 211
306 3300025918 Ga0207662_10000408 Ga0207662_1000040810 211
307 3300025927 Ga0207687_10004862 Ga0207687_100048627 211
308 3300025934 Ga0207686_10001177 Ga0207686_100011773 211
309 3300025935 Ga0207709_10004109 Ga0207709_100041098 211
310 3300025936 Ga0207670_10005181 Ga0207670_100051815 211
311 3300025938 Ga0207704_10000918 Ga0207704_100009183 211
312 3300025942 Ga0207689_10005174 Ga0207689_1000517410 211
313 3300025949 Ga0207667_10029335 Ga0207667_100293354 211
314 3300025960 Ga0207651_10398279 Ga0207651_103982792 211
315 3300025961 Ga0207712_10013791 Ga0207712_100137916 211
316 3300025981 Ga0207640_10006940 Ga0207640_100069402 211
317 3300026023 Ga0207677_10012594 Ga0207677_100125946 211
318 3300026035 Ga0207703_10054571 Ga0207703_100545713 211
319 3300026041 Ga0207639_10090935 Ga0207639_100909352 211
320 3300026075 Ga0207708_10002074 Ga0207708_1000207412 211
321 3300026078 Ga0207702_10027487 Ga0207702_100274873 211
322 3300026089 Ga0207648_10005161 Ga0207648_100051614 211
323 3300026118 Ga0207675_100002609 Ga0207675_10000260910 211
324 3300028380 Ga0268265_10051998 Ga0268265_100519983 211
325 3300028381 Ga0268264_10004281 Ga0268264_1000428111 211
326 3300035089 Ga0373944_0003130 Ga0373944_0003130_157_918 211
327 3300035113 Ga0373936_0011228 Ga0373936_0011228_1964_2725 211
328 3300035115 Ga0373941_0066842 Ga0373941_0066842_327_1088 211
329 3300035207 Ga0373942_0005856 Ga0373942_0005856_397_1158 211
330 3300035695 Ga0373927_0133582 Ga0373927_0133582_307_1068 211
331 3300035725 Ga0373947_0001813 Ga0373947_0001813_4731_5492 211
332 3300036401 Ga0373937_0241761 Ga0373937_0241761_96_842 211
333 3300036401 Ga0373937_0249614 Ga0373937_0249614_245_1000 211
334 3300045051 Ga0451576_0004225 Ga0451576_0004225_4561_5322 211
335 3300046455 Ga0495603_0010021 Ga0495603_0010021_3206_3967 211
336 3300046472 Ga0495580_0017367 Ga0495580_0017367_2908_3669 211
337 3300046475 Ga0495639_0017538 Ga0495639_0017538_1411_2172 211
338 3300046526 Ga0495666_0017571 Ga0495666_0017571_1882_2643 211
339 3300046529 Ga0495652_0453987 Ga0495652_0453987_119_874 211
340 3300046531 Ga0495665_0012747 Ga0495665_0012747_706_1467 211
341 3300046535 Ga0495586_0004390 Ga0495586_0004390_2781_3542 211
342 3300046537 Ga0495598_0010846 Ga0495598_0010846_1227_2000 211
343 3300046539 Ga0495621_0055655 Ga0495621_0055655_430_1203 211
344 3300046674 Ga0495588_0064633 Ga0495588_0064633_1084_1845 211
345 3300046681 Ga0495647_0000533 Ga0495647_0000533_7571_8332 211
346 3300046683 Ga0495658_0008849 Ga0495658_0008849_1104_1865 211
347 3300047321 Ga0495676_0054045 Ga0495676_0054045_1114_1875 211
348 3300005336 Ga0070680_100292477 Ga0070680_1002924772 212
349 3300005444 Ga0070694_100371692 Ga0070694_1003716921 212
350 3300005545 Ga0070695_100165611 Ga0070695_1001656112 212
351 3300005546 Ga0070696_100000739 Ga0070696_10000073920 212
352 3300006852 Ga0075433_10094574 Ga0075433_100945745 212
353 3300025922 Ga0207646_10219473 Ga0207646_102194732 212
354 3300032002 Ga0307416_100100170 Ga0307416_1001001702 212
355 3300035118 Ga0373954_0001068 Ga0373954_0001068_7226_7975 212
356 3300045051 Ga0451576_0023848 Ga0451576_0023848_5637_6401 212
357 3300046536 Ga0495587_0309198 Ga0495587_0309198_13_762 212
358 3300046559 Ga0495667_0114313 Ga0495667_0114313_299_1048 212
359 3300049574 Ga0501038_0261447 Ga0501038_0261447_542_1303 212
360 3300049575 Ga0501039_0348370 Ga0501039_0348370_339_1100 212
361 3300049590 Ga0501074_0095745 Ga0501074_0095745_556_1317 212
362 3300049591 Ga0501075_0178718 Ga0501075_0178718_581_1342 212
363 3300049741 Ga0501079_0275599 Ga0501079_0275599_331_1092 212
364 3300050507 nmdc:mga05p37_812202_c1 nmdc:mga05p37_812202_c1_117_863 212
365 3300050515 nmdc:mga0a205_31396_c1 nmdc:mga0a205_31396_c1_1820_2590 212
366 3300060353 Ga0501082_0419217 Ga0501082_0419217_299_1060 212
367 3300061734 Ga0530510_0159222 Ga0530510_0159222_363_1124 212
368 3300009094 Ga0111539_10006143 Ga0111539_1000614313 213
369 3300026075 Ga0207708_10267808 Ga0207708_102678082 213
370 3300027907 Ga0207428_10141373 Ga0207428_101413732 213
371 3300035112 Ga0373932_0009768 Ga0373932_0009768_445_1215 213
372 3300041406 Ga0439439_0077659 Ga0439439_0077659_50_814 213
373 3300049577 Ga0501041_0007643 Ga0501041_0007643_868_1623 213
374 3300050508 nmdc:mga09592_352385_c1 nmdc:mga09592_352385_c1_136_900 213
375 3300050511 nmdc:mga08y16_109792_c1 nmdc:mga08y16_109792_c1_297_1061 213
376 3300005334 Ga0068869_100048555 Ga0068869_1000485554 214
377 3300005435 Ga0070714_100045792 Ga0070714_1000457925 214
378 3300006173 Ga0070716_100308631 Ga0070716_1003086312 214
379 3300025929 Ga0207664_10160319 Ga0207664_101603194 214
380 3300025939 Ga0207665_10317898 Ga0207665_103178982 214
381 3300025942 Ga0207689_10175046 Ga0207689_101750462 214
382 3300028380 Ga0268265_10360178 Ga0268265_103601782 214
383 3300045051 Ga0451576_0189098 Ga0451576_0189098_1284_2048 214
384 3300049568 Ga0501031_0185076 Ga0501031_0185076_559_1311 214
385 3300049569 Ga0501032_0099465 Ga0501032_0099465_334_1086 214
386 3300049570 Ga0501033_0022466 Ga0501033_0022466_927_1679 214
387 3300049572 Ga0501036_0004836 Ga0501036_0004836_4436_5188 214
388 3300049573 Ga0501037_0058146 Ga0501037_0058146_104_856 214
389 3300049574 Ga0501038_0020021 Ga0501038_0020021_2781_3533 214
390 3300049575 Ga0501039_0026109 Ga0501039_0026109_898_1650 214
391 3300049576 Ga0501040_0002845 Ga0501040_0002845_4242_4994 214
392 3300049577 Ga0501041_0000171 Ga0501041_0000171_23995_24747 214
393 3300049578 Ga0501042_0003752 Ga0501042_0003752_4622_5374 214
394 3300049579 Ga0501043_0007248 Ga0501043_0007248_3554_4306 214
395 3300049580 Ga0501046_0005363 Ga0501046_0005363_4216_4968 214
396 3300049581 Ga0501047_0099643 Ga0501047_0099643_457_1209 214
397 3300049582 Ga0501048_0002988 Ga0501048_0002988_3649_4401 214
398 3300049584 Ga0501068_0125534 Ga0501068_0125534_397_1149 214
399 3300049586 Ga0501070_0132428 Ga0501070_0132428_13_765 214
400 3300049588 Ga0501072_0007011 Ga0501072_0007011_5978_6730 214
401 3300049589 Ga0501073_0122035 Ga0501073_0122035_132_884 214
402 3300049590 Ga0501074_0139382 Ga0501074_0139382_681_1433 214
403 3300049591 Ga0501075_0003959 Ga0501075_0003959_4815_5567 214
404 3300049592 Ga0501076_0009781 Ga0501076_0009781_3341_4093 214
405 3300049593 Ga0501077_0014240 Ga0501077_0014240_4208_4960 214
406 3300049705 Ga0501225_0028593 Ga0501225_0028593_312_1064 214
407 3300049741 Ga0501079_0005505 Ga0501079_0005505_4190_4942 214
408 3300049743 Ga0501081_0005713 Ga0501081_0005713_4320_5072 214
409 3300049822 Ga0501035_0054614 Ga0501035_0054614_242_994 214
410 3300049824 Ga0501045_0093225 Ga0501045_0093225_468_1220 214
411 3300054114 Ga0501084_0000832 Ga0501084_0000832_4622_5374 214
412 3300060353 Ga0501082_0006696 Ga0501082_0006696_4214_4966 214
413 3300061734 Ga0530510_0001659 Ga0530510_0001659_4475_5227 214
414 3300005329 Ga0070683_100090729 Ga0070683_1000907294 215
415 3300005330 Ga0070690_100004385 Ga0070690_1000043856 215
416 3300005343 Ga0070687_100107079 Ga0070687_1001070793 215
417 3300005354 Ga0070675_100099912 Ga0070675_1000999122 215
418 3300005438 Ga0070701_10081724 Ga0070701_100817242 215
419 3300005441 Ga0070700_100033731 Ga0070700_1000337314 215
420 3300005518 Ga0070699_100075896 Ga0070699_1000758963 215
421 3300005530 Ga0070679_100155517 Ga0070679_1001555173 215
422 3300005544 Ga0070686_100058329 Ga0070686_1000583292 215
423 3300005615 Ga0070702_100415800 Ga0070702_1004158002 215
424 3300005617 Ga0068859_100597435 Ga0068859_1005974352 215
425 3300005719 Ga0068861_100563487 Ga0068861_1005634872 215
426 3300005840 Ga0068870_10099655 Ga0068870_100996553 215
427 3300006237 Ga0097621_100083845 Ga0097621_1000838452 215
428 3300006358 Ga0068871_100002265 Ga0068871_1000022658 215
429 3300006844 Ga0075428_100040409 Ga0075428_1000404094 215
430 3300006844 Ga0075428_100724492 Ga0075428_1007244921 215
431 3300006846 Ga0075430_100006267 Ga0075430_1000062677 215
432 3300006846 Ga0075430_100092323 Ga0075430_1000923234 215
433 3300006847 Ga0075431_100023107 Ga0075431_1000231073 215
434 3300006847 Ga0075431_100382558 Ga0075431_1003825582 215
435 3300006880 Ga0075429_100024792 Ga0075429_1000247923 215
436 3300006914 Ga0075436_100000375 Ga0075436_10000037529 215
437 3300006931 Ga0097620_100597501 Ga0097620_1005975012 215
438 3300009147 Ga0114129_10661176 Ga0114129_106611762 215
439 3300009177 Ga0105248_10077763 Ga0105248_100777635 215
440 3300014969 Ga0157376_10022734 Ga0157376_100227345 215
441 3300025917 Ga0207660_10137290 Ga0207660_101372902 215
442 3300025917 Ga0207660_10395852 Ga0207660_103958522 215
443 3300025918 Ga0207662_10167497 Ga0207662_101674972 215
444 3300025921 Ga0207652_10201665 Ga0207652_102016652 215
445 3300025926 Ga0207659_10060428 Ga0207659_100604282 215
446 3300025941 Ga0207711_10145934 Ga0207711_101459344 215
447 3300025944 Ga0207661_10080217 Ga0207661_100802174 215
448 3300027364 Ga0209967_1005621 Ga0209967_10056212 215
449 3300027378 Ga0209981_1005358 Ga0209981_10053582 215
450 3300027395 Ga0209996_1009691 Ga0209996_10096911 215
451 3300027462 Ga0210000_1001858 Ga0210000_10018583 215
452 3300027462 Ga0210000_1009389 Ga0210000_10093892 215
453 3300027526 Ga0209968_1003895 Ga0209968_10038954 215
454 3300027614 Ga0209970_1001627 Ga0209970_10016273 215
455 3300027671 Ga0209588_1005808 Ga0209588_10058082 215
456 3300027695 Ga0209966_1003212 Ga0209966_10032124 215
457 3300027876 Ga0209974_10006215 Ga0209974_100062156 215
458 3300031691 Ga0316579_10004329 Ga0316579_100043293 215
459 3300031728 Ga0316578_10198494 Ga0316578_101984942 215
460 3300032133 Ga0316583_10011406 Ga0316583_100114062 215
461 3300035118 Ga0373954_0000059 Ga0373954_0000059_28448_29212 215
462 3300035207 Ga0373942_0004062 Ga0373942_0004062_1090_1845 215
463 3300036401 Ga0373937_0002664 Ga0373937_0002664_8321_9085 215
464 3300036647 Ga0316582_0013731 Ga0316582_0013731_1399_2154 215
465 3300036712 Ga0316584_0165789 Ga0316584_0165789_235_990 215
466 3300041408 Ga0439453_0004469 Ga0439453_0004469_474_1229 215
467 3300041501 Ga0451845_0636266 Ga0451845_0636266_92_862 215
468 3300042001 Ga0439441_025778 Ga0439441_025778_140_895 215
469 3300042003 Ga0439443_020685 Ga0439443_020685_64_819 215
470 3300042435 Ga0439434_0066952 Ga0439434_0066952_25_780 215
471 3300042436 Ga0439435_0003451 Ga0439435_0003451_646_1401 215
472 3300042436 Ga0439435_0060401 Ga0439435_0060401_160_915 215
473 3300042437 Ga0439444_0001310 Ga0439444_0001310_504_1259 215
474 3300042461 Ga0439460_0008178 Ga0439460_0008178_406_1161 215
475 3300042532 Ga0450893_0015742 Ga0450893_0015742_15_770 215
476 3300045976 Ga0466967_0021254 Ga0466967_0021254_3405_4178 215
477 3300047317 Ga0495604_0415784 Ga0495604_0415784_12_776 215
478 3300049568 Ga0501031_0135696 Ga0501031_0135696_149_904 215
479 3300049573 Ga0501037_0210796 Ga0501037_0210796_497_1252 215
480 3300049575 Ga0501039_0075705 Ga0501039_0075705_1153_1908 215
481 3300049576 Ga0501040_0123958 Ga0501040_0123958_713_1468 215
482 3300049580 Ga0501046_0038625 Ga0501046_0038625_1917_2672 215
483 3300049582 Ga0501048_0017910 Ga0501048_0017910_3943_4698 215
484 3300049583 Ga0501067_0029209 Ga0501067_0029209_1578_2342 215
485 3300049587 Ga0501071_0331535 Ga0501071_0331535_347_1111 215
486 3300049587 Ga0501071_0382897 Ga0501071_0382897_169_924 215
487 3300049588 Ga0501072_0110379 Ga0501072_0110379_11_766 215
488 3300049593 Ga0501077_0028571 Ga0501077_0028571_313_1068 215
489 3300049741 Ga0501079_0015806 Ga0501079_0015806_534_1289 215
490 3300049742 Ga0501080_0014806 Ga0501080_0014806_3640_4395 215
491 3300049743 Ga0501081_0002036 Ga0501081_0002036_246_1001 215
492 3300049824 Ga0501045_0004851 Ga0501045_0004851_3465_4220 215
493 3300050507 nmdc:mga05p37_288139_c1 nmdc:mga05p37_288139_c1_594_1370 215
494 3300050507 nmdc:mga05p37_529058_c1 nmdc:mga05p37_529058_c1_169_924 215
495 3300050508 nmdc:mga09592_16668_c1 nmdc:mga09592_16668_c1_2270_3025 215
496 3300050508 nmdc:mga09592_401631_c1 nmdc:mga09592_401631_c1_195_971 215
497 3300050509 nmdc:mga0qj67_308957_c1 nmdc:mga0qj67_308957_c1_29_784 215
498 3300050509 nmdc:mga0qj67_52913_c1 nmdc:mga0qj67_52913_c1_909_1685 215
499 3300050509 nmdc:mga0qj67_740_c1 nmdc:mga0qj67_740_c1_932_1687 215
500 3300050510 nmdc:mga06r32_45334_c1 nmdc:mga06r32_45334_c1_2939_3694 215
501 3300050510 nmdc:mga06r32_570032_c1 nmdc:mga06r32_570032_c1_114_869 215
502 3300050514 nmdc:mga08x19_2831_c1 nmdc:mga08x19_2831_c1_2982_3743 215
503 3300054114 Ga0501084_0062117 Ga0501084_0062117_2224_2979 215
504 3300060353 Ga0501082_0071784 Ga0501082_0071784_2143_2898 215
505 3300061734 Ga0530510_0000042 Ga0530510_0000042_13239_13994 215
506 3300005614 Ga0068856_100031990 Ga0068856_1000319902 216
507 3300007265 Ga0099794_10009950 Ga0099794_100099503 216
508 3300013307 Ga0157372_10224087 Ga0157372_102240872 216
509 3300025912 Ga0207707_10499526 Ga0207707_104995262 216
510 3300025944 Ga0207661_10159581 Ga0207661_101595811 216
511 3300026078 Ga0207702_10372245 Ga0207702_103722452 216
512 3300027907 Ga0207428_10113601 Ga0207428_101136012 216
513 3300035119 Ga0373956_0123871 Ga0373956_0123871_322_1098 216
514 3300035724 Ga0373933_0188902 Ga0373933_0188902_506_1282 216
515 3300049576 Ga0501040_0349480 Ga0501040_0349480_70_834 216
516 3300049577 Ga0501041_0239748 Ga0501041_0239748_357_1121 216
517 3300049584 Ga0501068_0176447 Ga0501068_0176447_204_968 216
518 3300049587 Ga0501071_0065805 Ga0501071_0065805_1229_1993 216
519 3300049589 Ga0501073_0134868 Ga0501073_0134868_372_1136 216
520 3300049591 Ga0501075_0024369 Ga0501075_0024369_2251_3015 216
521 3300049592 Ga0501076_0047742 Ga0501076_0047742_1899_2663 216
522 3300049741 Ga0501079_0049182 Ga0501079_0049182_100_864 216
523 3300049743 Ga0501081_0030146 Ga0501081_0030146_441_1205 216
524 3300049823 Ga0501044_0298396 Ga0501044_0298396_765_1529 216
525 3300049824 Ga0501045_0228850 Ga0501045_0228850_272_1036 216
526 3300050511 nmdc:mga08y16_195044_c1 nmdc:mga08y16_195044_c1_104_865 216
527 3300050512 nmdc:mga0n895_10506_c1 nmdc:mga0n895_10506_c1_6645_7406 216
528 3300050513 nmdc:mga0rr50_7287_c1 nmdc:mga0rr50_7287_c1_414_1175 216
529 3300050514 nmdc:mga08x19_4153_c1 nmdc:mga08x19_4153_c1_6000_6761 216
530 3300050515 nmdc:mga0a205_13750_c1 nmdc:mga0a205_13750_c1_6184_6945 216
531 3300054114 Ga0501084_0148038 Ga0501084_0148038_470_1234 216
532 3300060353 Ga0501082_0079297 Ga0501082_0079297_1279_2043 216
533 3300005345 Ga0070692_10118553 Ga0070692_101185532 218
534 3300005347 Ga0070668_100008339 Ga0070668_1000083392 218
535 3300005353 Ga0070669_100036598 Ga0070669_1000365983 218
536 3300005441 Ga0070700_100017735 Ga0070700_1000177354 218
537 3300005459 Ga0068867_100001149 Ga0068867_10000114918 218
538 3300005543 Ga0070672_100310759 Ga0070672_1003107591 218
539 3300005546 Ga0070696_100453030 Ga0070696_1004530302 218
540 3300005719 Ga0068861_100008115 Ga0068861_1000081153 218
541 3300005840 Ga0068870_10206131 Ga0068870_102061312 218
542 3300005844 Ga0068862_100042303 Ga0068862_1000423033 218
543 3300006881 Ga0068865_100011242 Ga0068865_1000112422 218
544 3300009094 Ga0111539_10096120 Ga0111539_100961204 218
545 3300009148 Ga0105243_10044229 Ga0105243_100442293 218
546 3300009553 Ga0105249_10001763 Ga0105249_1000176320 218
547 3300014326 Ga0157380_10108561 Ga0157380_101085613 218
548 3300025899 Ga0207642_10008706 Ga0207642_100087064 218
549 3300025908 Ga0207643_10262359 Ga0207643_102623592 218
550 3300025923 Ga0207681_10005406 Ga0207681_100054068 218
551 3300025935 Ga0207709_10012991 Ga0207709_100129912 218
552 3300025938 Ga0207704_10004148 Ga0207704_100041484 218
553 3300025940 Ga0207691_10194578 Ga0207691_101945781 218
554 3300025961 Ga0207712_10009287 Ga0207712_100092872 218
555 3300025972 Ga0207668_10003596 Ga0207668_100035968 218
556 3300026075 Ga0207708_10041848 Ga0207708_100418484 218
557 3300026089 Ga0207648_10003015 Ga0207648_100030155 218
558 3300026118 Ga0207675_100000954 Ga0207675_1000009542 218
559 3300027907 Ga0207428_10013958 Ga0207428_100139585 218
560 3300028380 Ga0268265_10001934 Ga0268265_100019346 218
561 3300050511 nmdc:mga08y16_49876_c1 nmdc:mga08y16_49876_c1_1635_2411 218
562 3300031901 Ga0307406_10372161 Ga0307406_103721612 219
563 3300032002 Ga0307416_100844077 Ga0307416_1008440771 219
564 3300005328 Ga0070676_10085050 Ga0070676_100850503 222
565 3300005330 Ga0070690_100329531 Ga0070690_1003295311 222
566 3300005364 Ga0070673_100226793 Ga0070673_1002267933 222
567 3300005615 Ga0070702_100158585 Ga0070702_1001585852 222
568 3300005844 Ga0068862_100042246 Ga0068862_1000422464 222
569 3300009094 Ga0111539_10052933 Ga0111539_100529333 222
570 3300009094 Ga0111539_10189542 Ga0111539_101895424 222
571 3300013308 Ga0157375_10406823 Ga0157375_104068232 222
572 3300025918 Ga0207662_10124796 Ga0207662_101247962 222
573 3300026121 Ga0207683_10434713 Ga0207683_104347132 222
574 3300027907 Ga0207428_10014517 Ga0207428_100145177 222
575 3300028380 Ga0268265_10050233 Ga0268265_100502333 222
576 3300035241 Ga0373961_0081094 Ga0373961_0081094_48_827 222
577 3300050511 nmdc:mga08y16_11747_c1 nmdc:mga08y16_11747_c1_3668_4444 222
578 3300050511 nmdc:mga08y16_166513_c1 nmdc:mga08y16_166513_c1_1298_2077 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20567

DUF6776

Family of unknown function (DUF6776)

86

234

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o24-assembly1.cif.gz_A structure of the foamy viral protease-reverse transcriptase in complex with dsdna. 0.7121 193 218
8u01-assembly1.cif.gz_A crystal structure of the glycoside hydrolase family 2 tim barrel-domain containing protein from phocaeicola plebeius 0.6651 104 213
2r2c-assembly1.cif.gz_A crystal structure of a domain of the outer membrane lipoprotein omp28 from porphyromonas gingivalis 0.6589 104 214
6ncw-assembly1.cif.gz_A crystal structure of a gh2 beta-galacturonidase from eisenbergiella tayi bound to glycerol 0.6077 104 214
7edd-assembly1.cif.gz_A crystal structure of a serine protease from streptococcus pyogenes 0.6065 117 212
ID Description Score Start End Superfamily
af_P06864_208_318_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6298 105 215 2.60.40.10
2r2cA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6148 104 214 2.60.40.10
af_Q8ITZ2_1_146_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6147 110 201 2.60.120.260
af_P16620_439_548_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6114 109 213 2.60.40.10
af_Q8WSR7_104_226_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6103 104 213 2.60.40.640
ID Description Score Start End GO Terms
AF-A0A353Y2R7-F1-model_v4 Uncharacterized protein 0.8854 103 219 GO:0016020
AF-A0A7Y5UVS6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.8843 86 215 GO:0000166
GO:0016491
AF-A0A257X1Z9-F1-model_v4 Uncharacterized protein 0.8738 97 215
AF-A0A2R5EKD3-F1-model_v4 Uncharacterized protein 0.8642 103 214
AF-A0A6A7RSE6-F1-model_v4 Uncharacterized protein 0.8513 120 215

Feature Viewer

pLDDT pTM Quality
72.6 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map