F465711
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 276 | 578 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100042246|Ga0068862_1000422464 |
| Length | 259 |
| Sequence | MPPSGRWKLIRQRFGIAAPRVEVQTQIPWYLRWAGIAIFLGVAGAAASWIYDAGRRFAGFDRSEVVQELQAVRSDLNTARAELARLRAIANAAESRVSIERTAQQTLAQQVRGLEQENARLREELAMFEQMLVSEERHTQTLAIYRFKVEPDVLPGEYRYRLLLLTPTDRRGRDFNGRLELVVSLQEGGQNAMMSFPEPGDAAAAQFRLAFKYFRRVEGTFRVNPKAKVESVQARVFEAGSSQPRATHSVSLDGTTKVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 134 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 135 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 140 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 141 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 143 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 171 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 172 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 173 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 174 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 175 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 176 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 177 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 178 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 179 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 180 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 181 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 182 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10085050 | 3300005328 | Bacteria | 1926 |
| 2 | Ga0070683_100090729 | 3300005329 | Bacteria | 2869 |
| 3 | Ga0070690_100002508 | 3300005330 | Bacteria | 9873 |
| 4 | Ga0070690_100004385 | 3300005330 | Bacteria | 7829 |
| 5 | Ga0070690_100329531 | 3300005330 | Bacteria | 1103 |
| 6 | Ga0068869_100000144 | 3300005334 | Bacteria | 35078 |
| 7 | Ga0068869_100048555 | 3300005334 | Bacteria | 3070 |
| 8 | Ga0070666_10173642 | 3300005335 | Bacteria | 1510 |
| 9 | Ga0070680_100018653 | 3300005336 | Bacteria | 5486 |
| 10 | Ga0070680_100292477 | 3300005336 | Bacteria | 1381 |
| 11 | Ga0068868_100008988 | 3300005338 | Bacteria | 7169 |
| 12 | Ga0070689_100006117 | 3300005340 | Bacteria | 8294 |
| 13 | Ga0070691_10011728 | 3300005341 | Bacteria | 4008 |
| 14 | Ga0070687_100000509 | 3300005343 | Bacteria | 13007 |
| 15 | Ga0070687_100083756 | 3300005343 | Bacteria | 1747 |
| 16 | Ga0070687_100107079 | 3300005343 | Bacteria | 1576 |
| 17 | Ga0070692_10003000 | 3300005345 | Bacteria | 6721 |
| 18 | Ga0070692_10080478 | 3300005345 | Bacteria | 1754 |
| 19 | Ga0070692_10118553 | 3300005345 | Bacteria | 1473 |
| 20 | Ga0070668_100008339 | 3300005347 | Bacteria | 7695 |
| 21 | Ga0070669_100036598 | 3300005353 | Bacteria | 3557 |
| 22 | Ga0070675_100099912 | 3300005354 | Bacteria | 2443 |
| 23 | Ga0070675_100264514 | 3300005354 | Bacteria | 1508 |
| 24 | Ga0070673_100226793 | 3300005364 | Bacteria | 1619 |
| 25 | Ga0070688_100128551 | 3300005365 | Bacteria | 1706 |
| 26 | Ga0070714_100045792 | 3300005435 | Bacteria | 3708 |
| 27 | Ga0070710_10012695 | 3300005437 | Bacteria | 4192 |
| 28 | Ga0070701_10001813 | 3300005438 | Bacteria | 8066 |
| 29 | Ga0070701_10081724 | 3300005438 | Bacteria | 1751 |
| 30 | Ga0070705_100000974 | 3300005440 | Bacteria | 16059 |
| 31 | Ga0070705_100007908 | 3300005440 | Bacteria | 5253 |
| 32 | Ga0070700_100002307 | 3300005441 | Bacteria | 9712 |
| 33 | Ga0070700_100017735 | 3300005441 | Bacteria | 4078 |
| 34 | Ga0070700_100033731 | 3300005441 | Bacteria | 3085 |
| 35 | Ga0070700_100203886 | 3300005441 | Bacteria | 1391 |
| 36 | Ga0070694_100001628 | 3300005444 | Bacteria | 13178 |
| 37 | Ga0070694_100035178 | 3300005444 | Bacteria | 3309 |
| 38 | Ga0070694_100371692 | 3300005444 | Unclassified | 1113 |
| 39 | Ga0070708_100325454 | 3300005445 | Bacteria | 1448 |
| 40 | Ga0070681_10084421 | 3300005458 | Bacteria | 3128 |
| 41 | Ga0068867_100001149 | 3300005459 | Bacteria | 18088 |
| 42 | Ga0068867_100002155 | 3300005459 | Bacteria | 13810 |
| 43 | Ga0070698_100629251 | 3300005471 | Bacteria | 1014 |
| 44 | Ga0070699_100053074 | 3300005518 | Bacteria | 3509 |
| 45 | Ga0070699_100075896 | 3300005518 | Bacteria | 2925 |
| 46 | Ga0070679_100006806 | 3300005530 | Bacteria | 10660 |
| 47 | Ga0070679_100155517 | 3300005530 | Bacteria | 2262 |
| 48 | Ga0070672_100310759 | 3300005543 | Bacteria | 1338 |
| 49 | Ga0070686_100000966 | 3300005544 | Bacteria | 16580 |
| 50 | Ga0070686_100040646 | 3300005544 | Bacteria | 2902 |
| 51 | Ga0070686_100058329 | 3300005544 | Bacteria | 2483 |
| 52 | Ga0070695_100002253 | 3300005545 | Bacteria | 11042 |
| 53 | Ga0070695_100016391 | 3300005545 | Bacteria | 4483 |
| 54 | Ga0070695_100165611 | 3300005545 | Bacteria | 1556 |
| 55 | Ga0070696_100000739 | 3300005546 | Bacteria | 20870 |
| 56 | Ga0070696_100000933 | 3300005546 | Bacteria | 18945 |
| 57 | Ga0070696_100028586 | 3300005546 | Bacteria | 3805 |
| 58 | Ga0070696_100187444 | 3300005546 | Bacteria | 1538 |
| 59 | Ga0070696_100302821 | 3300005546 | Bacteria | 1225 |
| 60 | Ga0070696_100386375 | 3300005546 | Bacteria | 1092 |
| 61 | Ga0070696_100453030 | 3300005546 | Bacteria | 1013 |
| 62 | Ga0070693_100038627 | 3300005547 | Bacteria | 2669 |
| 63 | Ga0070693_100159559 | 3300005547 | Bacteria | 1435 |
| 64 | Ga0070693_100317232 | 3300005547 | Bacteria | 1056 |
| 65 | Ga0070693_100336340 | 3300005547 | Bacteria | 1029 |
| 66 | Ga0070704_100000093 | 3300005549 | Bacteria | 30795 |
| 67 | Ga0070704_100011615 | 3300005549 | Bacteria | 5405 |
| 68 | Ga0070704_100024563 | 3300005549 | Bacteria | 3955 |
| 69 | Ga0068855_100006371 | 3300005563 | Bacteria | 14381 |
| 70 | Ga0068854_100009430 | 3300005578 | Bacteria | 6302 |
| 71 | Ga0068856_100031990 | 3300005614 | Bacteria | 5148 |
| 72 | Ga0068856_100124470 | 3300005614 | Bacteria | 2581 |
| 73 | Ga0070702_100000565 | 3300005615 | Bacteria | 13487 |
| 74 | Ga0070702_100158585 | 3300005615 | Bacteria | 1460 |
| 75 | Ga0070702_100415800 | 3300005615 | Bacteria | 966 |
| 76 | Ga0068859_100006294 | 3300005617 | Bacteria | 12037 |
| 77 | Ga0068859_100191583 | 3300005617 | Bacteria | 2129 |
| 78 | Ga0068859_100597435 | 3300005617 | Bacteria | 1197 |
| 79 | Ga0068866_10000746 | 3300005718 | Bacteria | 14720 |
| 80 | Ga0068861_100001913 | 3300005719 | Bacteria | 13403 |
| 81 | Ga0068861_100008115 | 3300005719 | Bacteria | 7223 |
| 82 | Ga0068861_100563487 | 3300005719 | Bacteria | 1040 |
| 83 | Ga0068870_10099655 | 3300005840 | Bacteria | 1639 |
| 84 | Ga0068870_10206131 | 3300005840 | Bacteria | 1195 |
| 85 | Ga0068858_100009592 | 3300005842 | Bacteria | 9231 |
| 86 | Ga0068860_100089396 | 3300005843 | Bacteria | 2932 |
| 87 | Ga0068862_100003161 | 3300005844 | Bacteria | 14315 |
| 88 | Ga0068862_100042246 | 3300005844 | Bacteria | 3883 |
| 89 | Ga0068862_100042303 | 3300005844 | Bacteria | 3881 |
| 90 | Ga0081539_10000365 | 3300005985 | Bacteria | 99063 |
| 91 | Ga0070716_100007007 | 3300006173 | Bacteria | 5529 |
| 92 | Ga0070716_100308631 | 3300006173 | Unclassified | 1104 |
| 93 | Ga0097621_100001187 | 3300006237 | Bacteria | 18061 |
| 94 | Ga0097621_100083845 | 3300006237 | Bacteria | 2656 |
| 95 | Ga0068871_100002265 | 3300006358 | Bacteria | 13084 |
| 96 | Ga0068871_100019737 | 3300006358 | Bacteria | 5150 |
| 97 | Ga0068871_100560157 | 3300006358 | Bacteria | 1036 |
| 98 | Ga0075428_100023486 | 3300006844 | Bacteria | 6825 |
| 99 | Ga0075428_100027836 | 3300006844 | Bacteria | 6254 |
| 100 | Ga0075428_100040409 | 3300006844 | Bacteria | 5132 |
| 101 | Ga0075428_100092047 | 3300006844 | Bacteria | 3306 |
| 102 | Ga0075428_100724492 | 3300006844 | Unclassified | 1059 |
| 103 | Ga0075430_100006267 | 3300006846 | Bacteria | 10032 |
| 104 | Ga0075430_100092323 | 3300006846 | Bacteria | 2531 |
| 105 | Ga0075430_100130127 | 3300006846 | Bacteria | 2098 |
| 106 | Ga0075431_100023107 | 3300006847 | Bacteria | 6357 |
| 107 | Ga0075431_100029256 | 3300006847 | Bacteria | 5669 |
| 108 | Ga0075431_100132076 | 3300006847 | Bacteria | 2575 |
| 109 | Ga0075431_100156970 | 3300006847 | Bacteria | 2341 |
| 110 | Ga0075431_100382558 | 3300006847 | Bacteria | 1411 |
| 111 | Ga0075433_10053982 | 3300006852 | Bacteria | 3505 |
| 112 | Ga0075433_10094574 | 3300006852 | Bacteria | 2645 |
| 113 | Ga0075434_100000306 | 3300006871 | Bacteria | 34874 |
| 114 | Ga0075434_100005526 | 3300006871 | Bacteria | 11510 |
| 115 | Ga0075434_100722694 | 3300006871 | Bacteria | 1013 |
| 116 | Ga0075429_100000145 | 3300006880 | Bacteria | 43529 |
| 117 | Ga0075429_100014658 | 3300006880 | Bacteria | 6796 |
| 118 | Ga0075429_100024792 | 3300006880 | Bacteria | 5206 |
| 119 | Ga0075429_100636054 | 3300006880 | Bacteria | 935 |
| 120 | Ga0068865_100001100 | 3300006881 | Bacteria | 15603 |
| 121 | Ga0068865_100011242 | 3300006881 | Bacteria | 5596 |
| 122 | Ga0068865_100204073 | 3300006881 | Bacteria | 1536 |
| 123 | Ga0075436_100000375 | 3300006914 | Bacteria | 28483 |
| 124 | Ga0075436_100033749 | 3300006914 | Bacteria | 3527 |
| 125 | Ga0075436_100034850 | 3300006914 | Bacteria | 3472 |
| 126 | Ga0075436_100221666 | 3300006914 | Bacteria | 1342 |
| 127 | Ga0097620_100006294 | 3300006931 | Bacteria | 12037 |
| 128 | Ga0097620_100191604 | 3300006931 | Bacteria | 2129 |
| 129 | Ga0097620_100597501 | 3300006931 | Bacteria | 1197 |
| 130 | Ga0075435_100017559 | 3300007076 | Bacteria | 5419 |
| 131 | Ga0075435_100040195 | 3300007076 | Bacteria | 3734 |
| 132 | Ga0075435_100584460 | 3300007076 | Bacteria | 968 |
| 133 | Ga0099794_10003576 | 3300007265 | Bacteria | 5955 |
| 134 | Ga0099794_10009950 | 3300007265 | Bacteria | 4023 |
| 135 | Ga0099794_10010226 | 3300007265 | Bacteria | 3977 |
| 136 | Ga0099794_10057932 | 3300007265 | Bacteria | 1877 |
| 137 | Ga0099795_10014970 | 3300007788 | Bacteria | 2418 |
| 138 | Ga0111539_10006143 | 3300009094 | Bacteria | 15508 |
| 139 | Ga0111539_10052933 | 3300009094 | Bacteria | 4831 |
| 140 | Ga0111539_10096120 | 3300009094 | Bacteria | 3480 |
| 141 | Ga0111539_10189542 | 3300009094 | Bacteria | 2400 |
| 142 | Ga0111539_10228482 | 3300009094 | Bacteria | 2167 |
| 143 | Ga0105245_10005883 | 3300009098 | Bacteria | 10773 |
| 144 | Ga0105245_10498409 | 3300009098 | Bacteria | 1234 |
| 145 | Ga0114129_10000393 | 3300009147 | Bacteria | 51077 |
| 146 | Ga0114129_10527216 | 3300009147 | Bacteria | 1539 |
| 147 | Ga0114129_10661176 | 3300009147 | Bacteria | 1347 |
| 148 | Ga0105243_10004719 | 3300009148 | Bacteria | 10731 |
| 149 | Ga0105243_10044229 | 3300009148 | Bacteria | 3493 |
| 150 | Ga0105241_10605128 | 3300009174 | Bacteria | 990 |
| 151 | Ga0105242_10000296 | 3300009176 | Bacteria | 39554 |
| 152 | Ga0105248_10077763 | 3300009177 | Bacteria | 3730 |
| 153 | Ga0105249_10001763 | 3300009553 | Bacteria | 18843 |
| 154 | Ga0105249_10018583 | 3300009553 | Bacteria | 6188 |
| 155 | Ga0099796_10043327 | 3300010159 | Bacteria | 1532 |
| 156 | Ga0105246_10138338 | 3300011119 | Bacteria | 1828 |
| 157 | Ga0157373_10109519 | 3300013100 | Bacteria | 1942 |
| 158 | Ga0157371_10163266 | 3300013102 | Bacteria | 1591 |
| 159 | Ga0157378_10003195 | 3300013297 | Bacteria | 14558 |
| 160 | Ga0163162_10115490 | 3300013306 | Bacteria | 2784 |
| 161 | Ga0157372_10224087 | 3300013307 | Bacteria | 2180 |
| 162 | Ga0157375_10181878 | 3300013308 | Bacteria | 2254 |
| 163 | Ga0157375_10406823 | 3300013308 | Bacteria | 1527 |
| 164 | Ga0157380_10108561 | 3300014326 | Bacteria | 2326 |
| 165 | Ga0157380_10182425 | 3300014326 | Bacteria | 1845 |
| 166 | Ga0157377_10092033 | 3300014745 | Bacteria | 1792 |
| 167 | Ga0157376_10000936 | 3300014969 | Bacteria | 18964 |
| 168 | Ga0157376_10022734 | 3300014969 | Bacteria | 4894 |
| 169 | Ga0207642_10003197 | 3300025899 | Bacteria | 5135 |
| 170 | Ga0207642_10008706 | 3300025899 | Bacteria | 3497 |
| 171 | Ga0207688_10008525 | 3300025901 | Bacteria | 5581 |
| 172 | Ga0207680_10225926 | 3300025903 | Bacteria | 1285 |
| 173 | Ga0207685_10031561 | 3300025905 | Bacteria | 1898 |
| 174 | Ga0207645_10128850 | 3300025907 | Bacteria | 1646 |
| 175 | Ga0207643_10025392 | 3300025908 | Bacteria | 3274 |
| 176 | Ga0207643_10262359 | 3300025908 | Bacteria | 1067 |
| 177 | Ga0207707_10043157 | 3300025912 | Bacteria | 3935 |
| 178 | Ga0207707_10066126 | 3300025912 | Bacteria | 3148 |
| 179 | Ga0207707_10499526 | 3300025912 | Unclassified | 1037 |
| 180 | Ga0207660_10020901 | 3300025917 | Bacteria | 4397 |
| 181 | Ga0207660_10137290 | 3300025917 | Bacteria | 1867 |
| 182 | Ga0207660_10395852 | 3300025917 | Bacteria | 1112 |
| 183 | Ga0207662_10000408 | 3300025918 | Bacteria | 19001 |
| 184 | Ga0207662_10124796 | 3300025918 | Bacteria | 1618 |
| 185 | Ga0207662_10167497 | 3300025918 | Bacteria | 1407 |
| 186 | Ga0207652_10201665 | 3300025921 | Bacteria | 1790 |
| 187 | Ga0207646_10219473 | 3300025922 | Bacteria | 1718 |
| 188 | Ga0207681_10005406 | 3300025923 | Bacteria | 7846 |
| 189 | Ga0207659_10060428 | 3300025926 | Bacteria | 2728 |
| 190 | Ga0207687_10004862 | 3300025927 | Bacteria | 8931 |
| 191 | Ga0207664_10160319 | 3300025929 | Bacteria | 1918 |
| 192 | Ga0207686_10001177 | 3300025934 | Bacteria | 15116 |
| 193 | Ga0207709_10004109 | 3300025935 | Bacteria | 8479 |
| 194 | Ga0207709_10012991 | 3300025935 | Bacteria | 4590 |
| 195 | Ga0207670_10005181 | 3300025936 | Bacteria | 7128 |
| 196 | Ga0207670_10066673 | 3300025936 | Bacteria | 2474 |
| 197 | Ga0207704_10000918 | 3300025938 | Bacteria | 13025 |
| 198 | Ga0207704_10004148 | 3300025938 | Bacteria | 6605 |
| 199 | Ga0207665_10317898 | 3300025939 | Bacteria | 1167 |
| 200 | Ga0207691_10194578 | 3300025940 | Bacteria | 1767 |
| 201 | Ga0207711_10145934 | 3300025941 | Bacteria | 2132 |
| 202 | Ga0207689_10005174 | 3300025942 | Bacteria | 11717 |
| 203 | Ga0207689_10175046 | 3300025942 | Bacteria | 1769 |
| 204 | Ga0207689_10223258 | 3300025942 | Bacteria | 1557 |
| 205 | Ga0207661_10080217 | 3300025944 | Bacteria | 2692 |
| 206 | Ga0207661_10159581 | 3300025944 | Bacteria | 1956 |
| 207 | Ga0207667_10029335 | 3300025949 | Bacteria | 5967 |
| 208 | Ga0207651_10398279 | 3300025960 | Bacteria | 1170 |
| 209 | Ga0207712_10009287 | 3300025961 | Bacteria | 6221 |
| 210 | Ga0207712_10013791 | 3300025961 | Bacteria | 5184 |
| 211 | Ga0207668_10003596 | 3300025972 | Bacteria | 9111 |
| 212 | Ga0207640_10006940 | 3300025981 | Bacteria | 6230 |
| 213 | Ga0207677_10012594 | 3300026023 | Bacteria | 4870 |
| 214 | Ga0207703_10054571 | 3300026035 | Bacteria | 3250 |
| 215 | Ga0207639_10090935 | 3300026041 | Bacteria | 2442 |
| 216 | Ga0207708_10002074 | 3300026075 | Bacteria | 14763 |
| 217 | Ga0207708_10041848 | 3300026075 | Bacteria | 3493 |
| 218 | Ga0207708_10073796 | 3300026075 | Bacteria | 2615 |
| 219 | Ga0207708_10267808 | 3300026075 | Bacteria | 1381 |
| 220 | Ga0207702_10027487 | 3300026078 | Bacteria | 4724 |
| 221 | Ga0207702_10372245 | 3300026078 | Bacteria | 1372 |
| 222 | Ga0207648_10003015 | 3300026089 | Bacteria | 17790 |
| 223 | Ga0207648_10005161 | 3300026089 | Bacteria | 13223 |
| 224 | Ga0207648_10336558 | 3300026089 | Bacteria | 1358 |
| 225 | Ga0207675_100000954 | 3300026118 | Bacteria | 28821 |
| 226 | Ga0207675_100002609 | 3300026118 | Bacteria | 17841 |
| 227 | Ga0207683_10434713 | 3300026121 | Bacteria | 1209 |
| 228 | Ga0209969_1014600 | 3300027360 | Bacteria | 1144 |
| 229 | Ga0209967_1005621 | 3300027364 | Bacteria | 1689 |
| 230 | Ga0209981_1004502 | 3300027378 | Bacteria | 1831 |
| 231 | Ga0209981_1005358 | 3300027378 | Bacteria | 1703 |
| 232 | Ga0209996_1009691 | 3300027395 | Bacteria | 1272 |
| 233 | Ga0210000_1000415 | 3300027462 | Bacteria | 5879 |
| 234 | Ga0210000_1001858 | 3300027462 | Bacteria | 2984 |
| 235 | Ga0210000_1009389 | 3300027462 | Bacteria | 1439 |
| 236 | Ga0209995_1023225 | 3300027471 | Bacteria | 1031 |
| 237 | Ga0209968_1003895 | 3300027526 | Bacteria | 2240 |
| 238 | Ga0209999_1000420 | 3300027543 | Bacteria | 6544 |
| 239 | Ga0209970_1001627 | 3300027614 | Bacteria | 3898 |
| 240 | Ga0209588_1005808 | 3300027671 | Bacteria | 3553 |
| 241 | Ga0209588_1005878 | 3300027671 | Bacteria | 3536 |
| 242 | Ga0209588_1033196 | 3300027671 | Bacteria | 1655 |
| 243 | Ga0209588_1065684 | 3300027671 | Bacteria | 1173 |
| 244 | Ga0209966_1003058 | 3300027695 | Bacteria | 2806 |
| 245 | Ga0209966_1003212 | 3300027695 | Bacteria | 2746 |
| 246 | Ga0209974_10006215 | 3300027876 | Bacteria | 4180 |
| 247 | Ga0207428_10000766 | 3300027907 | Bacteria | 36583 |
| 248 | Ga0207428_10013958 | 3300027907 | Bacteria | 6997 |
| 249 | Ga0207428_10014517 | 3300027907 | Bacteria | 6836 |
| 250 | Ga0207428_10113601 | 3300027907 | Bacteria | 2082 |
| 251 | Ga0207428_10141373 | 3300027907 | Bacteria | 1837 |
| 252 | Ga0268265_10001934 | 3300028380 | Bacteria | 16433 |
| 253 | Ga0268265_10050233 | 3300028380 | Bacteria | 3141 |
| 254 | Ga0268265_10051998 | 3300028380 | Bacteria | 3095 |
| 255 | Ga0268265_10360178 | 3300028380 | Bacteria | 1331 |
| 256 | Ga0268264_10004281 | 3300028381 | Bacteria | 12183 |
| 257 | Ga0316575_10000042 | 3300031665 | Bacteria | 31213 |
| 258 | Ga0316579_10004329 | 3300031691 | Bacteria | 5627 |
| 259 | Ga0316578_10198494 | 3300031728 | Bacteria | 1208 |
| 260 | Ga0307405_10522557 | 3300031731 | Bacteria | 955 |
| 261 | Ga0307406_10123946 | 3300031901 | Bacteria | 1802 |
| 262 | Ga0307406_10372161 | 3300031901 | Bacteria | 1124 |
| 263 | Ga0307416_100015416 | 3300032002 | Bacteria | 5280 |
| 264 | Ga0307416_100100170 | 3300032002 | Bacteria | 2519 |
| 265 | Ga0307416_100104870 | 3300032002 | Bacteria | 2473 |
| 266 | Ga0307416_100844077 | 3300032002 | Bacteria | 1014 |
| 267 | Ga0316583_10001814 | 3300032133 | Bacteria | 7266 |
| 268 | Ga0316583_10011406 | 3300032133 | Bacteria | 3203 |
| 269 | Ga0316583_10014149 | 3300032133 | Bacteria | 2878 |
| 270 | Ga0373948_0025531 | 3300034817 | Bacteria | 1159 |
| 271 | Ga0373950_0002602 | 3300034818 | Bacteria | 2499 |
| 272 | Ga0373958_0014186 | 3300034819 | Bacteria | 1390 |
| 273 | Ga0373938_0030247 | 3300034957 | Bacteria | 1154 |
| 274 | Ga0373928_0001280 | 3300035084 | Bacteria | 4948 |
| 275 | Ga0373929_0042022 | 3300035085 | Bacteria | 1018 |
| 276 | Ga0373934_0000072 | 3300035086 | Bacteria | 34972 |
| 277 | Ga0373934_0000747 | 3300035086 | Bacteria | 11636 |
| 278 | Ga0373940_0019347 | 3300035088 | Bacteria | 1719 |
| 279 | Ga0373944_0003130 | 3300035089 | Bacteria | 4257 |
| 280 | Ga0373951_0010704 | 3300035091 | Bacteria | 2060 |
| 281 | Ga0373923_0003342 | 3300035111 | Bacteria | 5128 |
| 282 | Ga0373932_0009768 | 3300035112 | Bacteria | 2314 |
| 283 | Ga0373932_0010269 | 3300035112 | Bacteria | 2263 |
| 284 | Ga0373932_0024058 | 3300035112 | Bacteria | 1636 |
| 285 | Ga0373936_0011228 | 3300035113 | Bacteria | 3387 |
| 286 | Ga0373936_0016985 | 3300035113 | Bacteria | 2798 |
| 287 | Ga0373939_0003004 | 3300035114 | Bacteria | 3959 |
| 288 | Ga0373941_0066842 | 3300035115 | Bacteria | 1184 |
| 289 | Ga0373954_0000059 | 3300035118 | Bacteria | 38918 |
| 290 | Ga0373954_0000522 | 3300035118 | Bacteria | 14412 |
| 291 | Ga0373954_0000755 | 3300035118 | Bacteria | 12508 |
| 292 | Ga0373954_0001068 | 3300035118 | Bacteria | 10932 |
| 293 | Ga0373954_0111032 | 3300035118 | Bacteria | 1326 |
| 294 | Ga0373956_0000032 | 3300035119 | Bacteria | 44749 |
| 295 | Ga0373956_0016277 | 3300035119 | Bacteria | 3121 |
| 296 | Ga0373956_0025568 | 3300035119 | Bacteria | 2553 |
| 297 | Ga0373956_0123871 | 3300035119 | Bacteria | 1208 |
| 298 | Ga0373960_0007932 | 3300035121 | Bacteria | 2530 |
| 299 | Ga0373943_0109384 | 3300035170 | Bacteria | 1456 |
| 300 | Ga0373946_0094142 | 3300035171 | Bacteria | 1332 |
| 301 | Ga0373955_0001531 | 3300035172 | Bacteria | 9881 |
| 302 | Ga0373955_0009419 | 3300035172 | Bacteria | 4569 |
| 303 | Ga0373955_0052590 | 3300035172 | Bacteria | 2222 |
| 304 | Ga0373955_0387682 | 3300035172 | Bacteria | 848 |
| 305 | Ga0373942_0004062 | 3300035207 | Bacteria | 3416 |
| 306 | Ga0373942_0005856 | 3300035207 | Bacteria | 2845 |
| 307 | Ga0373942_0013216 | 3300035207 | Bacteria | 1982 |
| 308 | Ga0373961_0013208 | 3300035241 | Bacteria | 2078 |
| 309 | Ga0373961_0015332 | 3300035241 | Bacteria | 1958 |
| 310 | Ga0373961_0018666 | 3300035241 | Bacteria | 1814 |
| 311 | Ga0373961_0081094 | 3300035241 | Unclassified | 1021 |
| 312 | Ga0373962_0008139 | 3300035242 | Bacteria | 2576 |
| 313 | Ga0373924_0002169 | 3300035410 | Bacteria | 6570 |
| 314 | Ga0373924_0015038 | 3300035410 | Bacteria | 2934 |
| 315 | Ga0373931_0003092 | 3300035691 | Bacteria | 7444 |
| 316 | Ga0373931_0009676 | 3300035691 | Bacteria | 4615 |
| 317 | Ga0373931_0021192 | 3300035691 | Bacteria | 3260 |
| 318 | Ga0373931_0203521 | 3300035691 | Bacteria | 1184 |
| 319 | Ga0373927_0065865 | 3300035695 | Bacteria | 2343 |
| 320 | Ga0373927_0133582 | 3300035695 | Bacteria | 1621 |
| 321 | Ga0373933_0001253 | 3300035724 | Bacteria | 14993 |
| 322 | Ga0373933_0066547 | 3300035724 | Bacteria | 2183 |
| 323 | Ga0373933_0188902 | 3300035724 | Unclassified | 1316 |
| 324 | Ga0373947_0001813 | 3300035725 | Bacteria | 13070 |
| 325 | Ga0373947_0186267 | 3300035725 | Unclassified | 1353 |
| 326 | Ga0373937_0000487 | 3300036401 | Bacteria | 36252 |
| 327 | Ga0373937_0002664 | 3300036401 | Bacteria | 14883 |
| 328 | Ga0373937_0004354 | 3300036401 | Bacteria | 12020 |
| 329 | Ga0373937_0135374 | 3300036401 | Bacteria | 2303 |
| 330 | Ga0373937_0241761 | 3300036401 | Bacteria | 1701 |
| 331 | Ga0373937_0249614 | 3300036401 | Bacteria | 1673 |
| 332 | Ga0373937_0396936 | 3300036401 | Bacteria | 1308 |
| 333 | Ga0316582_0013731 | 3300036647 | Bacteria | 4568 |
| 334 | Ga0316584_0165789 | 3300036712 | Bacteria | 1641 |
| 335 | Ga0439439_0077659 | 3300041406 | Bacteria | 895 |
| 336 | Ga0439453_0004469 | 3300041408 | Bacteria | 2078 |
| 337 | Ga0451845_0636266 | 3300041501 | Bacteria | 1079 |
| 338 | Ga0439441_004254 | 3300042001 | Bacteria | 2158 |
| 339 | Ga0439441_025778 | 3300042001 | Bacteria | 1112 |
| 340 | Ga0439443_020685 | 3300042003 | Bacteria | 1035 |
| 341 | Ga0439446_0033516 | 3300042156 | Bacteria | 1492 |
| 342 | Ga0439434_0001404 | 3300042435 | Bacteria | 6946 |
| 343 | Ga0439434_0066952 | 3300042435 | Bacteria | 1128 |
| 344 | Ga0439435_0000172 | 3300042436 | Bacteria | 9063 |
| 345 | Ga0439435_0003451 | 3300042436 | Bacteria | 3289 |
| 346 | Ga0439435_0060401 | 3300042436 | Bacteria | 1103 |
| 347 | Ga0439444_0001310 | 3300042437 | Bacteria | 3183 |
| 348 | Ga0439460_0008178 | 3300042461 | Bacteria | 2638 |
| 349 | Ga0450893_0015742 | 3300042532 | Bacteria | 1277 |
| 350 | Ga0451577_0895771 | 3300042876 | Unclassified | 799 |
| 351 | Ga0451576_0002938 | 3300045051 | Bacteria | 24214 |
| 352 | Ga0451576_0004225 | 3300045051 | Bacteria | 18855 |
| 353 | Ga0451576_0018770 | 3300045051 | Bacteria | 7562 |
| 354 | Ga0451576_0023848 | 3300045051 | Bacteria | 6618 |
| 355 | Ga0451576_0044507 | 3300045051 | Bacteria | 4680 |
| 356 | Ga0451576_0056464 | 3300045051 | Bacteria | 4105 |
| 357 | Ga0451576_0069422 | 3300045051 | Bacteria | 3667 |
| 358 | Ga0451576_0074363 | 3300045051 | Bacteria | 3536 |
| 359 | Ga0451576_0189098 | 3300045051 | Bacteria | 2150 |
| 360 | Ga0451576_0219033 | 3300045051 | Bacteria | 1987 |
| 361 | Ga0466967_0021254 | 3300045976 | Bacteria | 5265 |
| 362 | Ga0495592_0007548 | 3300046454 | Bacteria | 8145 |
| 363 | Ga0495592_0037461 | 3300046454 | Bacteria | 3651 |
| 364 | Ga0495603_0010021 | 3300046455 | Bacteria | 5733 |
| 365 | Ga0495629_0061381 | 3300046459 | Bacteria | 2627 |
| 366 | Ga0495651_0004123 | 3300046462 | Bacteria | 11127 |
| 367 | Ga0495651_0013221 | 3300046462 | Bacteria | 6381 |
| 368 | Ga0495653_0005500 | 3300046463 | Bacteria | 10318 |
| 369 | Ga0495653_0080908 | 3300046463 | Bacteria | 2402 |
| 370 | Ga0495580_0007829 | 3300046472 | Bacteria | 8553 |
| 371 | Ga0495580_0017367 | 3300046472 | Bacteria | 5383 |
| 372 | Ga0495582_0019116 | 3300046473 | Bacteria | 3749 |
| 373 | Ga0495582_0172851 | 3300046473 | Bacteria | 1230 |
| 374 | Ga0495639_0005107 | 3300046475 | Bacteria | 5636 |
| 375 | Ga0495639_0017538 | 3300046475 | Bacteria | 3111 |
| 376 | Ga0495662_0007329 | 3300046476 | Bacteria | 5456 |
| 377 | Ga0495662_0020468 | 3300046476 | Bacteria | 3200 |
| 378 | Ga0495664_0031855 | 3300046477 | Bacteria | 3091 |
| 379 | Ga0495608_0068843 | 3300046511 | Bacteria | 2313 |
| 380 | Ga0495608_0083082 | 3300046511 | Bacteria | 2079 |
| 381 | Ga0495618_0005079 | 3300046514 | Bacteria | 8039 |
| 382 | Ga0495628_0033897 | 3300046516 | Bacteria | 4110 |
| 383 | Ga0495628_0071066 | 3300046516 | Bacteria | 2713 |
| 384 | Ga0495630_0002610 | 3300046517 | Bacteria | 12484 |
| 385 | Ga0495630_0093905 | 3300046517 | Bacteria | 2268 |
| 386 | Ga0495630_0166258 | 3300046517 | Bacteria | 1679 |
| 387 | Ga0495666_0002721 | 3300046526 | Bacteria | 8826 |
| 388 | Ga0495666_0017571 | 3300046526 | Bacteria | 3562 |
| 389 | Ga0495666_0038695 | 3300046526 | Bacteria | 2319 |
| 390 | Ga0495652_0099656 | 3300046529 | Bacteria | 2359 |
| 391 | Ga0495652_0099940 | 3300046529 | Bacteria | 2355 |
| 392 | Ga0495652_0362788 | 3300046529 | Bacteria | 1035 |
| 393 | Ga0495652_0453987 | 3300046529 | Bacteria | 897 |
| 394 | Ga0495665_0012747 | 3300046531 | Bacteria | 4549 |
| 395 | Ga0495640_0018976 | 3300046533 | Bacteria | 5085 |
| 396 | Ga0495640_0023869 | 3300046533 | Bacteria | 4449 |
| 397 | Ga0495586_0004390 | 3300046535 | Bacteria | 7535 |
| 398 | Ga0495586_0011069 | 3300046535 | Bacteria | 4792 |
| 399 | Ga0495586_0014694 | 3300046535 | Bacteria | 4159 |
| 400 | Ga0495587_0026224 | 3300046536 | Bacteria | 3555 |
| 401 | Ga0495587_0044872 | 3300046536 | Bacteria | 2628 |
| 402 | Ga0495587_0309198 | 3300046536 | Bacteria | 883 |
| 403 | Ga0495587_0314500 | 3300046536 | Bacteria | 875 |
| 404 | Ga0495598_0010846 | 3300046537 | Bacteria | 2194 |
| 405 | Ga0495621_0055655 | 3300046539 | Bacteria | 1424 |
| 406 | Ga0495622_0042429 | 3300046557 | Bacteria | 2115 |
| 407 | Ga0495667_0025720 | 3300046559 | Bacteria | 3965 |
| 408 | Ga0495667_0045846 | 3300046559 | Bacteria | 2892 |
| 409 | Ga0495667_0114313 | 3300046559 | Bacteria | 1744 |
| 410 | Ga0495634_0017568 | 3300046642 | Bacteria | 5102 |
| 411 | Ga0495634_0018115 | 3300046642 | Bacteria | 5018 |
| 412 | Ga0495635_0009581 | 3300046663 | Bacteria | 6769 |
| 413 | Ga0495588_0064633 | 3300046674 | Bacteria | 1898 |
| 414 | Ga0495657_0004048 | 3300046675 | Bacteria | 11756 |
| 415 | Ga0495657_0106086 | 3300046675 | Bacteria | 1784 |
| 416 | Ga0495599_0018760 | 3300046678 | Bacteria | 4311 |
| 417 | Ga0495599_0105421 | 3300046678 | Bacteria | 1756 |
| 418 | Ga0495599_0264013 | 3300046678 | Unclassified | 1045 |
| 419 | Ga0495647_0000533 | 3300046681 | Bacteria | 11165 |
| 420 | Ga0495647_0001320 | 3300046681 | Bacteria | 7631 |
| 421 | Ga0495658_0008849 | 3300046683 | Bacteria | 5004 |
| 422 | Ga0495658_0010870 | 3300046683 | Bacteria | 4560 |
| 423 | Ga0495658_0045919 | 3300046683 | Bacteria | 2453 |
| 424 | Ga0495669_0002492 | 3300046684 | Bacteria | 7515 |
| 425 | Ga0495669_0091583 | 3300046684 | Bacteria | 1404 |
| 426 | Ga0495613_0012771 | 3300046689 | Bacteria | 6245 |
| 427 | Ga0495624_0004793 | 3300046690 | Bacteria | 9834 |
| 428 | Ga0495624_0359481 | 3300046690 | Bacteria | 875 |
| 429 | Ga0495600_0017744 | 3300046809 | Bacteria | 4530 |
| 430 | Ga0495600_0021205 | 3300046809 | Bacteria | 4159 |
| 431 | Ga0495604_0031525 | 3300047317 | Bacteria | 4204 |
| 432 | Ga0495604_0094456 | 3300047317 | Bacteria | 2210 |
| 433 | Ga0495604_0415784 | 3300047317 | Bacteria | 883 |
| 434 | Ga0495636_0127975 | 3300047318 | Bacteria | 1128 |
| 435 | Ga0495674_0010827 | 3300047319 | Bacteria | 8626 |
| 436 | Ga0495676_0054045 | 3300047321 | Bacteria | 3195 |
| 437 | Ga0495680_0004125 | 3300047322 | Bacteria | 13968 |
| 438 | Ga0495680_0024998 | 3300047322 | Bacteria | 4946 |
| 439 | Ga0495680_0082638 | 3300047322 | Bacteria | 2423 |
| 440 | Ga0495680_0124320 | 3300047322 | Bacteria | 1902 |
| 441 | Ga0495675_0093313 | 3300047444 | Bacteria | 1889 |
| 442 | Ga0495684_0017407 | 3300047471 | Bacteria | 5532 |
| 443 | Ga0495593_0135722 | 3300047673 | Bacteria | 1247 |
| 444 | Ga0501297_005010 | 3300049520 | Bacteria | 1374 |
| 445 | Ga0501031_0135696 | 3300049568 | Bacteria | 1608 |
| 446 | Ga0501031_0185076 | 3300049568 | Unclassified | 1360 |
| 447 | Ga0501032_0099465 | 3300049569 | Bacteria | 1927 |
| 448 | Ga0501033_0022466 | 3300049570 | Bacteria | 4759 |
| 449 | Ga0501036_0000268 | 3300049572 | Bacteria | 35567 |
| 450 | Ga0501036_0004836 | 3300049572 | Bacteria | 10884 |
| 451 | Ga0501036_0070538 | 3300049572 | Bacteria | 2955 |
| 452 | Ga0501037_0058146 | 3300049573 | Bacteria | 2822 |
| 453 | Ga0501037_0210796 | 3300049573 | Bacteria | 1370 |
| 454 | Ga0501038_0020021 | 3300049574 | Bacteria | 6023 |
| 455 | Ga0501038_0136745 | 3300049574 | Bacteria | 2007 |
| 456 | Ga0501038_0261447 | 3300049574 | Bacteria | 1368 |
| 457 | Ga0501039_0026109 | 3300049575 | Bacteria | 4488 |
| 458 | Ga0501039_0075705 | 3300049575 | Bacteria | 2616 |
| 459 | Ga0501039_0348370 | 3300049575 | Bacteria | 1164 |
| 460 | Ga0501039_0439295 | 3300049575 | Bacteria | 1025 |
| 461 | Ga0501040_0002845 | 3300049576 | Bacteria | 11165 |
| 462 | Ga0501040_0074166 | 3300049576 | Bacteria | 2351 |
| 463 | Ga0501040_0123958 | 3300049576 | Bacteria | 1814 |
| 464 | Ga0501040_0349480 | 3300049576 | Unclassified | 1059 |
| 465 | Ga0501041_0000171 | 3300049577 | Bacteria | 29019 |
| 466 | Ga0501041_0007643 | 3300049577 | Bacteria | 6348 |
| 467 | Ga0501041_0018645 | 3300049577 | Bacteria | 4133 |
| 468 | Ga0501041_0239748 | 3300049577 | Bacteria | 1139 |
| 469 | Ga0501042_0003752 | 3300049578 | Bacteria | 9600 |
| 470 | Ga0501042_0122887 | 3300049578 | Bacteria | 1869 |
| 471 | Ga0501043_0007248 | 3300049579 | Bacteria | 8807 |
| 472 | Ga0501046_0005363 | 3300049580 | Bacteria | 11467 |
| 473 | Ga0501046_0033689 | 3300049580 | Bacteria | 4137 |
| 474 | Ga0501046_0038625 | 3300049580 | Bacteria | 3829 |
| 475 | Ga0501047_0099643 | 3300049581 | Bacteria | 2785 |
| 476 | Ga0501048_0002988 | 3300049582 | Bacteria | 12906 |
| 477 | Ga0501048_0017910 | 3300049582 | Bacteria | 5212 |
| 478 | Ga0501067_0029209 | 3300049583 | Bacteria | 3056 |
| 479 | Ga0501068_0125534 | 3300049584 | Bacteria | 1602 |
| 480 | Ga0501068_0176447 | 3300049584 | Bacteria | 1350 |
| 481 | Ga0501070_0132428 | 3300049586 | Bacteria | 2059 |
| 482 | Ga0501071_0065805 | 3300049587 | Bacteria | 2632 |
| 483 | Ga0501071_0331535 | 3300049587 | Bacteria | 1157 |
| 484 | Ga0501071_0382897 | 3300049587 | Bacteria | 1073 |
| 485 | Ga0501072_0007011 | 3300049588 | Bacteria | 8555 |
| 486 | Ga0501072_0110379 | 3300049588 | Bacteria | 2189 |
| 487 | Ga0501073_0122035 | 3300049589 | Bacteria | 1806 |
| 488 | Ga0501073_0134868 | 3300049589 | Bacteria | 1711 |
| 489 | Ga0501074_0095745 | 3300049590 | Bacteria | 2126 |
| 490 | Ga0501074_0139382 | 3300049590 | Bacteria | 1735 |
| 491 | Ga0501075_0003959 | 3300049591 | Bacteria | 9983 |
| 492 | Ga0501075_0024369 | 3300049591 | Bacteria | 4436 |
| 493 | Ga0501075_0035536 | 3300049591 | Bacteria | 3717 |
| 494 | Ga0501075_0178718 | 3300049591 | Bacteria | 1619 |
| 495 | Ga0501075_0385917 | 3300049591 | Bacteria | 1068 |
| 496 | Ga0501076_0009781 | 3300049592 | Bacteria | 7082 |
| 497 | Ga0501076_0047742 | 3300049592 | Bacteria | 3385 |
| 498 | Ga0501076_0197577 | 3300049592 | Bacteria | 1642 |
| 499 | Ga0501077_0014240 | 3300049593 | Bacteria | 4994 |
| 500 | Ga0501077_0028571 | 3300049593 | Bacteria | 3545 |
| 501 | Ga0501225_0028593 | 3300049705 | Bacteria | 1532 |
| 502 | Ga0501079_0005505 | 3300049741 | Bacteria | 9436 |
| 503 | Ga0501079_0015806 | 3300049741 | Bacteria | 5767 |
| 504 | Ga0501079_0049182 | 3300049741 | Bacteria | 3254 |
| 505 | Ga0501079_0275599 | 3300049741 | Bacteria | 1315 |
| 506 | Ga0501079_0387232 | 3300049741 | Bacteria | 1096 |
| 507 | Ga0501080_0014806 | 3300049742 | Bacteria | 7183 |
| 508 | Ga0501080_0260030 | 3300049742 | Bacteria | 1582 |
| 509 | Ga0501081_0002036 | 3300049743 | Bacteria | 12604 |
| 510 | Ga0501081_0005713 | 3300049743 | Bacteria | 8049 |
| 511 | Ga0501081_0030146 | 3300049743 | Bacteria | 3670 |
| 512 | Ga0501035_0054614 | 3300049822 | Bacteria | 3569 |
| 513 | Ga0501035_0296212 | 3300049822 | Bacteria | 1364 |
| 514 | Ga0501044_0298396 | 3300049823 | Bacteria | 1541 |
| 515 | Ga0501045_0004851 | 3300049824 | Bacteria | 9307 |
| 516 | Ga0501045_0010944 | 3300049824 | Bacteria | 6355 |
| 517 | Ga0501045_0093225 | 3300049824 | Bacteria | 2227 |
| 518 | Ga0501045_0228850 | 3300049824 | Bacteria | 1384 |
| 519 | nmdc:mga05p37_288139_c1 | 3300050507 | Bacteria | 1955 |
| 520 | nmdc:mga05p37_529058_c1 | 3300050507 | Bacteria | 1347 |
| 521 | nmdc:mga05p37_775_c1 | 3300050507 | Bacteria | 35507 |
| 522 | nmdc:mga05p37_812202_c1 | 3300050507 | Bacteria | 1021 |
| 523 | nmdc:mga09592_148_c1 | 3300050508 | Bacteria | 47706 |
| 524 | nmdc:mga09592_16668_c1 | 3300050508 | Bacteria | 6013 |
| 525 | nmdc:mga09592_352385_c1 | 3300050508 | Bacteria | 1274 |
| 526 | nmdc:mga09592_35553_c1 | 3300050508 | Bacteria | 4171 |
| 527 | nmdc:mga09592_401631_c1 | 3300050508 | Bacteria | 1185 |
| 528 | nmdc:mga0qj67_308957_c1 | 3300050509 | Bacteria | 1281 |
| 529 | nmdc:mga0qj67_52913_c1 | 3300050509 | Bacteria | 3214 |
| 530 | nmdc:mga0qj67_740_c1 | 3300050509 | Bacteria | 22151 |
| 531 | nmdc:mga0qj67_90690_c1 | 3300050509 | Bacteria | 2456 |
| 532 | nmdc:mga0qj67_97038_c1 | 3300050509 | Bacteria | 2373 |
| 533 | nmdc:mga06r32_157984_c1 | 3300050510 | Bacteria | 2249 |
| 534 | nmdc:mga06r32_431354_c1 | 3300050510 | Bacteria | 1299 |
| 535 | nmdc:mga06r32_45334_c1 | 3300050510 | Bacteria | 4191 |
| 536 | nmdc:mga06r32_518552_c1 | 3300050510 | Bacteria | 1168 |
| 537 | nmdc:mga06r32_570032_c1 | 3300050510 | Bacteria | 1105 |
| 538 | nmdc:mga08y16_109792_c1 | 3300050511 | Bacteria | 2872 |
| 539 | nmdc:mga08y16_11747_c1 | 3300050511 | Bacteria | 9201 |
| 540 | nmdc:mga08y16_166513_c1 | 3300050511 | Bacteria | 2290 |
| 541 | nmdc:mga08y16_195044_c1 | 3300050511 | Bacteria | 2100 |
| 542 | nmdc:mga08y16_49876_c1 | 3300050511 | Bacteria | 4380 |
| 543 | nmdc:mga08y16_5867_c1 | 3300050511 | Bacteria | 12866 |
| 544 | nmdc:mga0n895_10506_c1 | 3300050512 | Bacteria | 8189 |
| 545 | nmdc:mga0n895_432_c1 | 3300050512 | Bacteria | 28136 |
| 546 | nmdc:mga0n895_610463_c1 | 3300050512 | Bacteria | 1092 |
| 547 | nmdc:mga0n895_866_c1 | 3300050512 | Bacteria | 21745 |
| 548 | nmdc:mga0rr50_13151_c1 | 3300050513 | Bacteria | 5377 |
| 549 | nmdc:mga0rr50_1318_c1 | 3300050513 | Bacteria | 13536 |
| 550 | nmdc:mga0rr50_469372_c1 | 3300050513 | Bacteria | 1068 |
| 551 | nmdc:mga0rr50_7287_c1 | 3300050513 | Bacteria | 6806 |
| 552 | nmdc:mga08x19_216992_c1 | 3300050514 | Bacteria | 1314 |
| 553 | nmdc:mga08x19_219076_c1 | 3300050514 | Bacteria | 1307 |
| 554 | nmdc:mga08x19_227528_c1 | 3300050514 | Bacteria | 1283 |
| 555 | nmdc:mga08x19_263872_c1 | 3300050514 | Bacteria | 1191 |
| 556 | nmdc:mga08x19_2831_c1 | 3300050514 | Bacteria | 10471 |
| 557 | nmdc:mga08x19_4153_c1 | 3300050514 | Bacteria | 8588 |
| 558 | nmdc:mga08x19_43732_c1 | 3300050514 | Bacteria | 2857 |
| 559 | nmdc:mga0a205_13750_c1 | 3300050515 | Bacteria | 7543 |
| 560 | nmdc:mga0a205_31396_c1 | 3300050515 | Bacteria | 5089 |
| 561 | Ga0495601_0048329 | 3300053077 | Bacteria | 2679 |
| 562 | Ga0495612_0046368 | 3300053078 | Bacteria | 1780 |
| 563 | Ga0495595_0001225 | 3300053084 | Bacteria | 9989 |
| 564 | Ga0495619_0038651 | 3300053085 | Bacteria | 3113 |
| 565 | Ga0501084_0000832 | 3300054114 | Bacteria | 23774 |
| 566 | Ga0501084_0062117 | 3300054114 | Bacteria | 3127 |
| 567 | Ga0501084_0148038 | 3300054114 | Bacteria | 1978 |
| 568 | Ga0501084_0155913 | 3300054114 | Bacteria | 1926 |
| 569 | Ga0501082_0006696 | 3300060353 | Bacteria | 9967 |
| 570 | Ga0501082_0071784 | 3300060353 | Bacteria | 2982 |
| 571 | Ga0501082_0079297 | 3300060353 | Bacteria | 2833 |
| 572 | Ga0501082_0141373 | 3300060353 | Bacteria | 2089 |
| 573 | Ga0501082_0419217 | 3300060353 | Bacteria | 1169 |
| 574 | Ga0530510_0000042 | 3300061734 | Bacteria | 58436 |
| 575 | Ga0530510_0001659 | 3300061734 | Bacteria | 15060 |
| 576 | Ga0530510_0159222 | 3300061734 | Bacteria | 1670 |
| 577 | Ga0530510_0524983 | 3300061734 | Bacteria | 898 |
| 578 | Ga0530510_0620237 | 3300061734 | Unclassified | 823 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035241 | Ga0373961_0015332 | Ga0373961_0015332_730_1374 | 173 |
| 2 | 3300007788 | Ga0099795_10014970 | Ga0099795_100149702 | 182 |
| 3 | 3300010159 | Ga0099796_10043327 | Ga0099796_100433273 | 182 |
| 4 | 3300007265 | Ga0099794_10003576 | Ga0099794_100035767 | 183 |
| 5 | 3300027671 | Ga0209588_1005878 | Ga0209588_10058782 | 183 |
| 6 | 3300005546 | Ga0070696_100187444 | Ga0070696_1001874443 | 188 |
| 7 | 3300032002 | Ga0307416_100015416 | Ga0307416_1000154162 | 188 |
| 8 | 3300031665 | Ga0316575_10000042 | Ga0316575_1000004212 | 189 |
| 9 | 3300046536 | Ga0495587_0314500 | Ga0495587_0314500_193_846 | 191 |
| 10 | 3300050514 | nmdc:mga08x19_216992_c1 | nmdc:mga08x19_216992_c1_176_937 | 191 |
| 11 | 3300049822 | Ga0501035_0296212 | Ga0501035_0296212_256_1020 | 192 |
| 12 | 3300006852 | Ga0075433_10053982 | Ga0075433_100539823 | 193 |
| 13 | 3300006871 | Ga0075434_100722694 | Ga0075434_1007226942 | 193 |
| 14 | 3300007076 | Ga0075435_100017559 | Ga0075435_1000175597 | 193 |
| 15 | 3300035118 | Ga0373954_0000522 | Ga0373954_0000522_9696_10445 | 193 |
| 16 | 3300042876 | Ga0451577_0895771 | Ga0451577_0895771_11_700 | 193 |
| 17 | 3300046678 | Ga0495599_0264013 | Ga0495599_0264013_235_984 | 193 |
| 18 | 3300050513 | nmdc:mga0rr50_13151_c1 | nmdc:mga0rr50_13151_c1_785_1534 | 193 |
| 19 | 3300032133 | Ga0316583_10014149 | Ga0316583_100141494 | 194 |
| 20 | 3300061734 | Ga0530510_0620237 | Ga0530510_0620237_13_666 | 194 |
| 21 | 3300005441 | Ga0070700_100203886 | Ga0070700_1002038862 | 195 |
| 22 | 3300026075 | Ga0207708_10073796 | Ga0207708_100737964 | 195 |
| 23 | 3300026089 | Ga0207648_10336558 | Ga0207648_103365582 | 195 |
| 24 | 3300035086 | Ga0373934_0000747 | Ga0373934_0000747_4954_5703 | 195 |
| 25 | 3300035111 | Ga0373923_0003342 | Ga0373923_0003342_1221_1970 | 195 |
| 26 | 3300035113 | Ga0373936_0016985 | Ga0373936_0016985_226_975 | 195 |
| 27 | 3300035118 | Ga0373954_0000755 | Ga0373954_0000755_6578_7327 | 195 |
| 28 | 3300035119 | Ga0373956_0016277 | Ga0373956_0016277_1152_1901 | 195 |
| 29 | 3300035170 | Ga0373943_0109384 | Ga0373943_0109384_374_1123 | 195 |
| 30 | 3300035171 | Ga0373946_0094142 | Ga0373946_0094142_311_1060 | 195 |
| 31 | 3300035172 | Ga0373955_0009419 | Ga0373955_0009419_3446_4195 | 195 |
| 32 | 3300035410 | Ga0373924_0002169 | Ga0373924_0002169_4904_5653 | 195 |
| 33 | 3300035695 | Ga0373927_0065865 | Ga0373927_0065865_728_1477 | 195 |
| 34 | 3300035724 | Ga0373933_0066547 | Ga0373933_0066547_1328_2077 | 195 |
| 35 | 3300035725 | Ga0373947_0186267 | Ga0373947_0186267_59_808 | 195 |
| 36 | 3300036401 | Ga0373937_0135374 | Ga0373937_0135374_1214_1963 | 195 |
| 37 | 3300046454 | Ga0495592_0007548 | Ga0495592_0007548_5937_6686 | 195 |
| 38 | 3300046459 | Ga0495629_0061381 | Ga0495629_0061381_628_1377 | 195 |
| 39 | 3300046462 | Ga0495651_0013221 | Ga0495651_0013221_5222_5971 | 195 |
| 40 | 3300046463 | Ga0495653_0005500 | Ga0495653_0005500_3316_4065 | 195 |
| 41 | 3300046472 | Ga0495580_0007829 | Ga0495580_0007829_4957_5706 | 195 |
| 42 | 3300046473 | Ga0495582_0019116 | Ga0495582_0019116_1371_2120 | 195 |
| 43 | 3300046475 | Ga0495639_0005107 | Ga0495639_0005107_874_1623 | 195 |
| 44 | 3300046476 | Ga0495662_0007329 | Ga0495662_0007329_806_1555 | 195 |
| 45 | 3300046477 | Ga0495664_0031855 | Ga0495664_0031855_2214_2963 | 195 |
| 46 | 3300046511 | Ga0495608_0068843 | Ga0495608_0068843_341_1090 | 195 |
| 47 | 3300046514 | Ga0495618_0005079 | Ga0495618_0005079_6077_6826 | 195 |
| 48 | 3300046516 | Ga0495628_0071066 | Ga0495628_0071066_687_1436 | 195 |
| 49 | 3300046517 | Ga0495630_0002610 | Ga0495630_0002610_8248_8997 | 195 |
| 50 | 3300046526 | Ga0495666_0002721 | Ga0495666_0002721_6632_7381 | 195 |
| 51 | 3300046529 | Ga0495652_0099656 | Ga0495652_0099656_1271_2020 | 195 |
| 52 | 3300046533 | Ga0495640_0018976 | Ga0495640_0018976_3056_3805 | 195 |
| 53 | 3300046535 | Ga0495586_0011069 | Ga0495586_0011069_988_1737 | 195 |
| 54 | 3300046536 | Ga0495587_0044872 | Ga0495587_0044872_1539_2288 | 195 |
| 55 | 3300046557 | Ga0495622_0042429 | Ga0495622_0042429_130_879 | 195 |
| 56 | 3300046559 | Ga0495667_0025720 | Ga0495667_0025720_1130_1879 | 195 |
| 57 | 3300046642 | Ga0495634_0018115 | Ga0495634_0018115_1214_1963 | 195 |
| 58 | 3300046663 | Ga0495635_0009581 | Ga0495635_0009581_5481_6230 | 195 |
| 59 | 3300046675 | Ga0495657_0004048 | Ga0495657_0004048_5494_6243 | 195 |
| 60 | 3300046678 | Ga0495599_0018760 | Ga0495599_0018760_3488_4237 | 195 |
| 61 | 3300046681 | Ga0495647_0001320 | Ga0495647_0001320_5074_5823 | 195 |
| 62 | 3300046683 | Ga0495658_0010870 | Ga0495658_0010870_3065_3814 | 195 |
| 63 | 3300046690 | Ga0495624_0004793 | Ga0495624_0004793_5655_6404 | 195 |
| 64 | 3300046809 | Ga0495600_0021205 | Ga0495600_0021205_3070_3819 | 195 |
| 65 | 3300047317 | Ga0495604_0094456 | Ga0495604_0094456_107_856 | 195 |
| 66 | 3300047319 | Ga0495674_0010827 | Ga0495674_0010827_6078_6827 | 195 |
| 67 | 3300047322 | Ga0495680_0082638 | Ga0495680_0082638_446_1195 | 195 |
| 68 | 3300047471 | Ga0495684_0017407 | Ga0495684_0017407_4306_5055 | 195 |
| 69 | 3300053078 | Ga0495612_0046368 | Ga0495612_0046368_380_1129 | 195 |
| 70 | 3300053084 | Ga0495595_0001225 | Ga0495595_0001225_4056_4805 | 195 |
| 71 | 3300053085 | Ga0495619_0038651 | Ga0495619_0038651_1681_2430 | 195 |
| 72 | 3300005343 | Ga0070687_100083756 | Ga0070687_1000837561 | 196 |
| 73 | 3300005544 | Ga0070686_100040646 | Ga0070686_1000406463 | 196 |
| 74 | 3300006847 | Ga0075431_100156970 | Ga0075431_1001569704 | 196 |
| 75 | 3300006871 | Ga0075434_100005526 | Ga0075434_10000552613 | 196 |
| 76 | 3300006881 | Ga0068865_100204073 | Ga0068865_1002040732 | 196 |
| 77 | 3300006914 | Ga0075436_100221666 | Ga0075436_1002216662 | 196 |
| 78 | 3300007076 | Ga0075435_100584460 | Ga0075435_1005844601 | 196 |
| 79 | 3300025942 | Ga0207689_10223258 | Ga0207689_102232582 | 196 |
| 80 | 3300031731 | Ga0307405_10522557 | Ga0307405_105225572 | 196 |
| 81 | 3300034957 | Ga0373938_0030247 | Ga0373938_0030247_265_1026 | 196 |
| 82 | 3300035085 | Ga0373929_0042022 | Ga0373929_0042022_103_864 | 196 |
| 83 | 3300035207 | Ga0373942_0013216 | Ga0373942_0013216_1089_1850 | 196 |
| 84 | 3300035241 | Ga0373961_0018666 | Ga0373961_0018666_412_1173 | 196 |
| 85 | 3300035691 | Ga0373931_0009676 | Ga0373931_0009676_2261_3022 | 196 |
| 86 | 3300042156 | Ga0439446_0033516 | Ga0439446_0033516_137_904 | 196 |
| 87 | 3300042435 | Ga0439434_0001404 | Ga0439434_0001404_910_1677 | 196 |
| 88 | 3300042436 | Ga0439435_0000172 | Ga0439435_0000172_6277_7044 | 196 |
| 89 | 3300049520 | Ga0501297_005010 | Ga0501297_005010_174_929 | 196 |
| 90 | 3300050509 | nmdc:mga0qj67_90690_c1 | nmdc:mga0qj67_90690_c1_1199_1954 | 196 |
| 91 | 3300050512 | nmdc:mga0n895_866_c1 | nmdc:mga0n895_866_c1_16172_16870 | 196 |
| 92 | 3300050513 | nmdc:mga0rr50_469372_c1 | nmdc:mga0rr50_469372_c1_122_820 | 196 |
| 93 | 3300050514 | nmdc:mga08x19_219076_c1 | nmdc:mga08x19_219076_c1_441_1190 | 196 |
| 94 | 3300005985 | Ga0081539_10000365 | Ga0081539_1000036579 | 197 |
| 95 | 3300025907 | Ga0207645_10128850 | Ga0207645_101288503 | 197 |
| 96 | 3300005440 | Ga0070705_100007908 | Ga0070705_1000079082 | 198 |
| 97 | 3300005444 | Ga0070694_100035178 | Ga0070694_1000351784 | 198 |
| 98 | 3300005545 | Ga0070695_100016391 | Ga0070695_1000163915 | 198 |
| 99 | 3300005546 | Ga0070696_100028586 | Ga0070696_1000285862 | 198 |
| 100 | 3300005547 | Ga0070693_100317232 | Ga0070693_1003172321 | 198 |
| 101 | 3300005549 | Ga0070704_100011615 | Ga0070704_1000116156 | 198 |
| 102 | 3300006173 | Ga0070716_100007007 | Ga0070716_1000070076 | 199 |
| 103 | 3300006914 | Ga0075436_100033749 | Ga0075436_1000337492 | 199 |
| 104 | 3300007265 | Ga0099794_10010226 | Ga0099794_100102265 | 199 |
| 105 | 3300025905 | Ga0207685_10031561 | Ga0207685_100315612 | 199 |
| 106 | 3300027671 | Ga0209588_1033196 | Ga0209588_10331962 | 199 |
| 107 | 3300050514 | nmdc:mga08x19_43732_c1 | nmdc:mga08x19_43732_c1_988_1737 | 199 |
| 108 | 3300005549 | Ga0070704_100024563 | Ga0070704_1000245634 | 200 |
| 109 | 3300025912 | Ga0207707_10043157 | Ga0207707_100431572 | 200 |
| 110 | 3300035121 | Ga0373960_0007932 | Ga0373960_0007932_997_1725 | 200 |
| 111 | 3300035691 | Ga0373931_0203521 | Ga0373931_0203521_146_874 | 200 |
| 112 | 3300005546 | Ga0070696_100386375 | Ga0070696_1003863751 | 202 |
| 113 | 3300046529 | Ga0495652_0099940 | Ga0495652_0099940_540_1292 | 203 |
| 114 | 3300005546 | Ga0070696_100302821 | Ga0070696_1003028211 | 204 |
| 115 | 3300005547 | Ga0070693_100159559 | Ga0070693_1001595592 | 204 |
| 116 | 3300006358 | Ga0068871_100560157 | Ga0068871_1005601571 | 204 |
| 117 | 3300009098 | Ga0105245_10498409 | Ga0105245_104984091 | 204 |
| 118 | 3300035086 | Ga0373934_0000072 | Ga0373934_0000072_14781_15530 | 204 |
| 119 | 3300035118 | Ga0373954_0111032 | Ga0373954_0111032_430_1179 | 204 |
| 120 | 3300035119 | Ga0373956_0000032 | Ga0373956_0000032_4905_5654 | 204 |
| 121 | 3300035172 | Ga0373955_0001531 | Ga0373955_0001531_338_1087 | 204 |
| 122 | 3300035724 | Ga0373933_0001253 | Ga0373933_0001253_6473_7222 | 204 |
| 123 | 3300036401 | Ga0373937_0000487 | Ga0373937_0000487_7985_8734 | 204 |
| 124 | 3300045051 | Ga0451576_0074363 | Ga0451576_0074363_2674_3438 | 204 |
| 125 | 3300046462 | Ga0495651_0004123 | Ga0495651_0004123_2993_3742 | 204 |
| 126 | 3300046675 | Ga0495657_0106086 | Ga0495657_0106086_320_1069 | 204 |
| 127 | 3300047322 | Ga0495680_0124320 | Ga0495680_0124320_618_1367 | 204 |
| 128 | 3300047444 | Ga0495675_0093313 | Ga0495675_0093313_243_992 | 204 |
| 129 | 3300013100 | Ga0157373_10109519 | Ga0157373_101095191 | 205 |
| 130 | 3300035172 | Ga0373955_0387682 | Ga0373955_0387682_23_781 | 205 |
| 131 | 3300036401 | Ga0373937_0396936 | Ga0373937_0396936_168_926 | 205 |
| 132 | 3300042001 | Ga0439441_004254 | Ga0439441_004254_328_1092 | 205 |
| 133 | 3300046454 | Ga0495592_0037461 | Ga0495592_0037461_486_1244 | 205 |
| 134 | 3300046463 | Ga0495653_0080908 | Ga0495653_0080908_415_1173 | 205 |
| 135 | 3300046476 | Ga0495662_0020468 | Ga0495662_0020468_363_1121 | 205 |
| 136 | 3300046511 | Ga0495608_0083082 | Ga0495608_0083082_908_1666 | 205 |
| 137 | 3300046516 | Ga0495628_0033897 | Ga0495628_0033897_1267_2025 | 205 |
| 138 | 3300046517 | Ga0495630_0166258 | Ga0495630_0166258_689_1447 | 205 |
| 139 | 3300046526 | Ga0495666_0038695 | Ga0495666_0038695_833_1591 | 205 |
| 140 | 3300046533 | Ga0495640_0023869 | Ga0495640_0023869_1051_1809 | 205 |
| 141 | 3300046535 | Ga0495586_0014694 | Ga0495586_0014694_1057_1815 | 205 |
| 142 | 3300046536 | Ga0495587_0026224 | Ga0495587_0026224_2359_3117 | 205 |
| 143 | 3300046559 | Ga0495667_0045846 | Ga0495667_0045846_1390_2148 | 205 |
| 144 | 3300046642 | Ga0495634_0017568 | Ga0495634_0017568_1039_1797 | 205 |
| 145 | 3300046678 | Ga0495599_0105421 | Ga0495599_0105421_230_988 | 205 |
| 146 | 3300046683 | Ga0495658_0045919 | Ga0495658_0045919_1054_1812 | 205 |
| 147 | 3300046689 | Ga0495613_0012771 | Ga0495613_0012771_1531_2289 | 205 |
| 148 | 3300046690 | Ga0495624_0359481 | Ga0495624_0359481_97_855 | 205 |
| 149 | 3300046809 | Ga0495600_0017744 | Ga0495600_0017744_1087_1845 | 205 |
| 150 | 3300047317 | Ga0495604_0031525 | Ga0495604_0031525_168_926 | 205 |
| 151 | 3300047322 | Ga0495680_0004125 | Ga0495680_0004125_2477_3235 | 205 |
| 152 | 3300047673 | Ga0495593_0135722 | Ga0495593_0135722_434_1192 | 205 |
| 153 | 3300049572 | Ga0501036_0000268 | Ga0501036_0000268_12696_13445 | 205 |
| 154 | 3300049592 | Ga0501076_0197577 | Ga0501076_0197577_495_1250 | 205 |
| 155 | 3300049741 | Ga0501079_0387232 | Ga0501079_0387232_176_931 | 205 |
| 156 | 3300049742 | Ga0501080_0260030 | Ga0501080_0260030_322_1077 | 205 |
| 157 | 3300053077 | Ga0495601_0048329 | Ga0495601_0048329_1776_2534 | 205 |
| 158 | 3300005345 | Ga0070692_10080478 | Ga0070692_100804782 | 206 |
| 159 | 3300005471 | Ga0070698_100629251 | Ga0070698_1006292511 | 206 |
| 160 | 3300005547 | Ga0070693_100336340 | Ga0070693_1003363402 | 206 |
| 161 | 3300006871 | Ga0075434_100000306 | Ga0075434_1000003062 | 206 |
| 162 | 3300007076 | Ga0075435_100040195 | Ga0075435_1000401956 | 206 |
| 163 | 3300049572 | Ga0501036_0070538 | Ga0501036_0070538_1296_2060 | 206 |
| 164 | 3300049574 | Ga0501038_0136745 | Ga0501038_0136745_409_1173 | 206 |
| 165 | 3300049576 | Ga0501040_0074166 | Ga0501040_0074166_1134_1898 | 206 |
| 166 | 3300049577 | Ga0501041_0018645 | Ga0501041_0018645_2895_3659 | 206 |
| 167 | 3300049578 | Ga0501042_0122887 | Ga0501042_0122887_421_1185 | 206 |
| 168 | 3300049580 | Ga0501046_0033689 | Ga0501046_0033689_474_1238 | 206 |
| 169 | 3300049591 | Ga0501075_0035536 | Ga0501075_0035536_214_978 | 206 |
| 170 | 3300049824 | Ga0501045_0010944 | Ga0501045_0010944_3330_4094 | 206 |
| 171 | 3300050512 | nmdc:mga0n895_432_c1 | nmdc:mga0n895_432_c1_26775_27536 | 206 |
| 172 | 3300050513 | nmdc:mga0rr50_1318_c1 | nmdc:mga0rr50_1318_c1_1188_1949 | 206 |
| 173 | 3300050514 | nmdc:mga08x19_263872_c1 | nmdc:mga08x19_263872_c1_143_904 | 206 |
| 174 | 3300054114 | Ga0501084_0155913 | Ga0501084_0155913_261_1025 | 206 |
| 175 | 3300060353 | Ga0501082_0141373 | Ga0501082_0141373_994_1758 | 206 |
| 176 | 3300061734 | Ga0530510_0524983 | Ga0530510_0524983_26_790 | 206 |
| 177 | 3300006880 | Ga0075429_100014658 | Ga0075429_1000146582 | 207 |
| 178 | 3300027378 | Ga0209981_1004502 | Ga0209981_10045022 | 207 |
| 179 | 3300027462 | Ga0210000_1000415 | Ga0210000_10004153 | 207 |
| 180 | 3300027471 | Ga0209995_1023225 | Ga0209995_10232252 | 207 |
| 181 | 3300027543 | Ga0209999_1000420 | Ga0209999_10004208 | 207 |
| 182 | 3300027671 | Ga0209588_1065684 | Ga0209588_10656842 | 207 |
| 183 | 3300032133 | Ga0316583_10001814 | Ga0316583_100018144 | 207 |
| 184 | 3300045051 | Ga0451576_0002938 | Ga0451576_0002938_22162_22905 | 207 |
| 185 | 3300045051 | Ga0451576_0018770 | Ga0451576_0018770_1306_2049 | 207 |
| 186 | 3300046684 | Ga0495669_0091583 | Ga0495669_0091583_242_997 | 207 |
| 187 | 3300049575 | Ga0501039_0439295 | Ga0501039_0439295_79_843 | 207 |
| 188 | 3300050508 | nmdc:mga09592_35553_c1 | nmdc:mga09592_35553_c1_331_1086 | 207 |
| 189 | 3300006844 | Ga0075428_100023486 | Ga0075428_1000234868 | 208 |
| 190 | 3300006880 | Ga0075429_100000145 | Ga0075429_10000014512 | 208 |
| 191 | 3300009094 | Ga0111539_10228482 | Ga0111539_102284822 | 208 |
| 192 | 3300009147 | Ga0114129_10000393 | Ga0114129_1000039331 | 208 |
| 193 | 3300027907 | Ga0207428_10000766 | Ga0207428_1000076611 | 208 |
| 194 | 3300034817 | Ga0373948_0025531 | Ga0373948_0025531_53_817 | 208 |
| 195 | 3300034818 | Ga0373950_0002602 | Ga0373950_0002602_270_1034 | 208 |
| 196 | 3300034819 | Ga0373958_0014186 | Ga0373958_0014186_29_793 | 208 |
| 197 | 3300035084 | Ga0373928_0001280 | Ga0373928_0001280_2215_2979 | 208 |
| 198 | 3300035088 | Ga0373940_0019347 | Ga0373940_0019347_771_1535 | 208 |
| 199 | 3300035091 | Ga0373951_0010704 | Ga0373951_0010704_390_1154 | 208 |
| 200 | 3300035112 | Ga0373932_0010269 | Ga0373932_0010269_51_815 | 208 |
| 201 | 3300035112 | Ga0373932_0024058 | Ga0373932_0024058_391_1152 | 208 |
| 202 | 3300035114 | Ga0373939_0003004 | Ga0373939_0003004_2589_3353 | 208 |
| 203 | 3300035241 | Ga0373961_0013208 | Ga0373961_0013208_129_893 | 208 |
| 204 | 3300035242 | Ga0373962_0008139 | Ga0373962_0008139_152_916 | 208 |
| 205 | 3300035691 | Ga0373931_0003092 | Ga0373931_0003092_1639_2403 | 208 |
| 206 | 3300035691 | Ga0373931_0021192 | Ga0373931_0021192_780_1541 | 208 |
| 207 | 3300045051 | Ga0451576_0044507 | Ga0451576_0044507_2148_2909 | 208 |
| 208 | 3300045051 | Ga0451576_0056464 | Ga0451576_0056464_3124_3888 | 208 |
| 209 | 3300045051 | Ga0451576_0069422 | Ga0451576_0069422_418_1194 | 208 |
| 210 | 3300046473 | Ga0495582_0172851 | Ga0495582_0172851_264_1016 | 208 |
| 211 | 3300046684 | Ga0495669_0002492 | Ga0495669_0002492_159_920 | 208 |
| 212 | 3300047318 | Ga0495636_0127975 | Ga0495636_0127975_85_846 | 208 |
| 213 | 3300050507 | nmdc:mga05p37_775_c1 | nmdc:mga05p37_775_c1_18300_19064 | 208 |
| 214 | 3300050508 | nmdc:mga09592_148_c1 | nmdc:mga09592_148_c1_45178_45942 | 208 |
| 215 | 3300050511 | nmdc:mga08y16_5867_c1 | nmdc:mga08y16_5867_c1_9964_10728 | 208 |
| 216 | 3300050512 | nmdc:mga0n895_610463_c1 | nmdc:mga0n895_610463_c1_239_1003 | 208 |
| 217 | 3300006844 | Ga0075428_100027836 | Ga0075428_1000278368 | 209 |
| 218 | 3300006844 | Ga0075428_100092047 | Ga0075428_1000920471 | 209 |
| 219 | 3300006846 | Ga0075430_100130127 | Ga0075430_1001301274 | 209 |
| 220 | 3300006847 | Ga0075431_100029256 | Ga0075431_1000292564 | 209 |
| 221 | 3300006847 | Ga0075431_100132076 | Ga0075431_1001320764 | 209 |
| 222 | 3300009147 | Ga0114129_10527216 | Ga0114129_105272162 | 209 |
| 223 | 3300027360 | Ga0209969_1014600 | Ga0209969_10146002 | 209 |
| 224 | 3300027695 | Ga0209966_1003058 | Ga0209966_10030584 | 209 |
| 225 | 3300031901 | Ga0307406_10123946 | Ga0307406_101239462 | 209 |
| 226 | 3300045051 | Ga0451576_0219033 | Ga0451576_0219033_590_1354 | 209 |
| 227 | 3300049591 | Ga0501075_0385917 | Ga0501075_0385917_222_977 | 209 |
| 228 | 3300050509 | nmdc:mga0qj67_97038_c1 | nmdc:mga0qj67_97038_c1_599_1378 | 209 |
| 229 | 3300050510 | nmdc:mga06r32_157984_c1 | nmdc:mga06r32_157984_c1_627_1406 | 209 |
| 230 | 3300050510 | nmdc:mga06r32_431354_c1 | nmdc:mga06r32_431354_c1_510_1286 | 209 |
| 231 | 3300050510 | nmdc:mga06r32_518552_c1 | nmdc:mga06r32_518552_c1_112_867 | 209 |
| 232 | 3300005617 | Ga0068859_100191583 | Ga0068859_1001915833 | 210 |
| 233 | 3300006880 | Ga0075429_100636054 | Ga0075429_1006360541 | 210 |
| 234 | 3300006914 | Ga0075436_100034850 | Ga0075436_1000348506 | 210 |
| 235 | 3300006931 | Ga0097620_100191604 | Ga0097620_1001916042 | 210 |
| 236 | 3300007265 | Ga0099794_10057932 | Ga0099794_100579322 | 210 |
| 237 | 3300025936 | Ga0207670_10066673 | Ga0207670_100666734 | 210 |
| 238 | 3300032002 | Ga0307416_100104870 | Ga0307416_1001048702 | 210 |
| 239 | 3300035119 | Ga0373956_0025568 | Ga0373956_0025568_1074_1844 | 210 |
| 240 | 3300035172 | Ga0373955_0052590 | Ga0373955_0052590_788_1558 | 210 |
| 241 | 3300035410 | Ga0373924_0015038 | Ga0373924_0015038_1729_2499 | 210 |
| 242 | 3300036401 | Ga0373937_0004354 | Ga0373937_0004354_6695_7465 | 210 |
| 243 | 3300046517 | Ga0495630_0093905 | Ga0495630_0093905_1250_2020 | 210 |
| 244 | 3300046529 | Ga0495652_0362788 | Ga0495652_0362788_64_834 | 210 |
| 245 | 3300047322 | Ga0495680_0024998 | Ga0495680_0024998_2776_3546 | 210 |
| 246 | 3300050514 | nmdc:mga08x19_227528_c1 | nmdc:mga08x19_227528_c1_125_886 | 210 |
| 247 | 3300005330 | Ga0070690_100002508 | Ga0070690_1000025084 | 211 |
| 248 | 3300005334 | Ga0068869_100000144 | Ga0068869_10000014411 | 211 |
| 249 | 3300005335 | Ga0070666_10173642 | Ga0070666_101736422 | 211 |
| 250 | 3300005336 | Ga0070680_100018653 | Ga0070680_1000186536 | 211 |
| 251 | 3300005338 | Ga0068868_100008988 | Ga0068868_1000089885 | 211 |
| 252 | 3300005340 | Ga0070689_100006117 | Ga0070689_1000061175 | 211 |
| 253 | 3300005341 | Ga0070691_10011728 | Ga0070691_100117283 | 211 |
| 254 | 3300005343 | Ga0070687_100000509 | Ga0070687_10000050910 | 211 |
| 255 | 3300005345 | Ga0070692_10003000 | Ga0070692_100030004 | 211 |
| 256 | 3300005354 | Ga0070675_100264514 | Ga0070675_1002645142 | 211 |
| 257 | 3300005365 | Ga0070688_100128551 | Ga0070688_1001285513 | 211 |
| 258 | 3300005437 | Ga0070710_10012695 | Ga0070710_100126954 | 211 |
| 259 | 3300005438 | Ga0070701_10001813 | Ga0070701_100018133 | 211 |
| 260 | 3300005440 | Ga0070705_100000974 | Ga0070705_10000097413 | 211 |
| 261 | 3300005441 | Ga0070700_100002307 | Ga0070700_1000023074 | 211 |
| 262 | 3300005444 | Ga0070694_100001628 | Ga0070694_1000016283 | 211 |
| 263 | 3300005445 | Ga0070708_100325454 | Ga0070708_1003254542 | 211 |
| 264 | 3300005458 | Ga0070681_10084421 | Ga0070681_100844214 | 211 |
| 265 | 3300005459 | Ga0068867_100002155 | Ga0068867_1000021558 | 211 |
| 266 | 3300005518 | Ga0070699_100053074 | Ga0070699_1000530741 | 211 |
| 267 | 3300005530 | Ga0070679_100006806 | Ga0070679_10000680610 | 211 |
| 268 | 3300005544 | Ga0070686_100000966 | Ga0070686_10000096610 | 211 |
| 269 | 3300005545 | Ga0070695_100002253 | Ga0070695_10000225310 | 211 |
| 270 | 3300005546 | Ga0070696_100000933 | Ga0070696_10000093319 | 211 |
| 271 | 3300005547 | Ga0070693_100038627 | Ga0070693_1000386273 | 211 |
| 272 | 3300005549 | Ga0070704_100000093 | Ga0070704_1000000936 | 211 |
| 273 | 3300005563 | Ga0068855_100006371 | Ga0068855_1000063715 | 211 |
| 274 | 3300005578 | Ga0068854_100009430 | Ga0068854_1000094306 | 211 |
| 275 | 3300005614 | Ga0068856_100124470 | Ga0068856_1001244704 | 211 |
| 276 | 3300005615 | Ga0070702_100000565 | Ga0070702_1000005653 | 211 |
| 277 | 3300005617 | Ga0068859_100006294 | Ga0068859_10000629411 | 211 |
| 278 | 3300005718 | Ga0068866_10000746 | Ga0068866_100007466 | 211 |
| 279 | 3300005719 | Ga0068861_100001913 | Ga0068861_10000191313 | 211 |
| 280 | 3300005842 | Ga0068858_100009592 | Ga0068858_1000095926 | 211 |
| 281 | 3300005843 | Ga0068860_100089396 | Ga0068860_1000893963 | 211 |
| 282 | 3300005844 | Ga0068862_100003161 | Ga0068862_10000316110 | 211 |
| 283 | 3300006237 | Ga0097621_100001187 | Ga0097621_10000118713 | 211 |
| 284 | 3300006358 | Ga0068871_100019737 | Ga0068871_1000197373 | 211 |
| 285 | 3300006881 | Ga0068865_100001100 | Ga0068865_10000110013 | 211 |
| 286 | 3300006931 | Ga0097620_100006294 | Ga0097620_10000629411 | 211 |
| 287 | 3300009098 | Ga0105245_10005883 | Ga0105245_100058836 | 211 |
| 288 | 3300009148 | Ga0105243_10004719 | Ga0105243_100047196 | 211 |
| 289 | 3300009174 | Ga0105241_10605128 | Ga0105241_106051281 | 211 |
| 290 | 3300009176 | Ga0105242_10000296 | Ga0105242_1000029641 | 211 |
| 291 | 3300009553 | Ga0105249_10018583 | Ga0105249_100185837 | 211 |
| 292 | 3300011119 | Ga0105246_10138338 | Ga0105246_101383384 | 211 |
| 293 | 3300013102 | Ga0157371_10163266 | Ga0157371_101632662 | 211 |
| 294 | 3300013297 | Ga0157378_10003195 | Ga0157378_1000319512 | 211 |
| 295 | 3300013306 | Ga0163162_10115490 | Ga0163162_101154903 | 211 |
| 296 | 3300013308 | Ga0157375_10181878 | Ga0157375_101818784 | 211 |
| 297 | 3300014326 | Ga0157380_10182425 | Ga0157380_101824252 | 211 |
| 298 | 3300014745 | Ga0157377_10092033 | Ga0157377_100920332 | 211 |
| 299 | 3300014969 | Ga0157376_10000936 | Ga0157376_1000093615 | 211 |
| 300 | 3300025899 | Ga0207642_10003197 | Ga0207642_100031972 | 211 |
| 301 | 3300025901 | Ga0207688_10008525 | Ga0207688_100085254 | 211 |
| 302 | 3300025903 | Ga0207680_10225926 | Ga0207680_102259262 | 211 |
| 303 | 3300025908 | Ga0207643_10025392 | Ga0207643_100253925 | 211 |
| 304 | 3300025912 | Ga0207707_10066126 | Ga0207707_100661264 | 211 |
| 305 | 3300025917 | Ga0207660_10020901 | Ga0207660_100209014 | 211 |
| 306 | 3300025918 | Ga0207662_10000408 | Ga0207662_1000040810 | 211 |
| 307 | 3300025927 | Ga0207687_10004862 | Ga0207687_100048627 | 211 |
| 308 | 3300025934 | Ga0207686_10001177 | Ga0207686_100011773 | 211 |
| 309 | 3300025935 | Ga0207709_10004109 | Ga0207709_100041098 | 211 |
| 310 | 3300025936 | Ga0207670_10005181 | Ga0207670_100051815 | 211 |
| 311 | 3300025938 | Ga0207704_10000918 | Ga0207704_100009183 | 211 |
| 312 | 3300025942 | Ga0207689_10005174 | Ga0207689_1000517410 | 211 |
| 313 | 3300025949 | Ga0207667_10029335 | Ga0207667_100293354 | 211 |
| 314 | 3300025960 | Ga0207651_10398279 | Ga0207651_103982792 | 211 |
| 315 | 3300025961 | Ga0207712_10013791 | Ga0207712_100137916 | 211 |
| 316 | 3300025981 | Ga0207640_10006940 | Ga0207640_100069402 | 211 |
| 317 | 3300026023 | Ga0207677_10012594 | Ga0207677_100125946 | 211 |
| 318 | 3300026035 | Ga0207703_10054571 | Ga0207703_100545713 | 211 |
| 319 | 3300026041 | Ga0207639_10090935 | Ga0207639_100909352 | 211 |
| 320 | 3300026075 | Ga0207708_10002074 | Ga0207708_1000207412 | 211 |
| 321 | 3300026078 | Ga0207702_10027487 | Ga0207702_100274873 | 211 |
| 322 | 3300026089 | Ga0207648_10005161 | Ga0207648_100051614 | 211 |
| 323 | 3300026118 | Ga0207675_100002609 | Ga0207675_10000260910 | 211 |
| 324 | 3300028380 | Ga0268265_10051998 | Ga0268265_100519983 | 211 |
| 325 | 3300028381 | Ga0268264_10004281 | Ga0268264_1000428111 | 211 |
| 326 | 3300035089 | Ga0373944_0003130 | Ga0373944_0003130_157_918 | 211 |
| 327 | 3300035113 | Ga0373936_0011228 | Ga0373936_0011228_1964_2725 | 211 |
| 328 | 3300035115 | Ga0373941_0066842 | Ga0373941_0066842_327_1088 | 211 |
| 329 | 3300035207 | Ga0373942_0005856 | Ga0373942_0005856_397_1158 | 211 |
| 330 | 3300035695 | Ga0373927_0133582 | Ga0373927_0133582_307_1068 | 211 |
| 331 | 3300035725 | Ga0373947_0001813 | Ga0373947_0001813_4731_5492 | 211 |
| 332 | 3300036401 | Ga0373937_0241761 | Ga0373937_0241761_96_842 | 211 |
| 333 | 3300036401 | Ga0373937_0249614 | Ga0373937_0249614_245_1000 | 211 |
| 334 | 3300045051 | Ga0451576_0004225 | Ga0451576_0004225_4561_5322 | 211 |
| 335 | 3300046455 | Ga0495603_0010021 | Ga0495603_0010021_3206_3967 | 211 |
| 336 | 3300046472 | Ga0495580_0017367 | Ga0495580_0017367_2908_3669 | 211 |
| 337 | 3300046475 | Ga0495639_0017538 | Ga0495639_0017538_1411_2172 | 211 |
| 338 | 3300046526 | Ga0495666_0017571 | Ga0495666_0017571_1882_2643 | 211 |
| 339 | 3300046529 | Ga0495652_0453987 | Ga0495652_0453987_119_874 | 211 |
| 340 | 3300046531 | Ga0495665_0012747 | Ga0495665_0012747_706_1467 | 211 |
| 341 | 3300046535 | Ga0495586_0004390 | Ga0495586_0004390_2781_3542 | 211 |
| 342 | 3300046537 | Ga0495598_0010846 | Ga0495598_0010846_1227_2000 | 211 |
| 343 | 3300046539 | Ga0495621_0055655 | Ga0495621_0055655_430_1203 | 211 |
| 344 | 3300046674 | Ga0495588_0064633 | Ga0495588_0064633_1084_1845 | 211 |
| 345 | 3300046681 | Ga0495647_0000533 | Ga0495647_0000533_7571_8332 | 211 |
| 346 | 3300046683 | Ga0495658_0008849 | Ga0495658_0008849_1104_1865 | 211 |
| 347 | 3300047321 | Ga0495676_0054045 | Ga0495676_0054045_1114_1875 | 211 |
| 348 | 3300005336 | Ga0070680_100292477 | Ga0070680_1002924772 | 212 |
| 349 | 3300005444 | Ga0070694_100371692 | Ga0070694_1003716921 | 212 |
| 350 | 3300005545 | Ga0070695_100165611 | Ga0070695_1001656112 | 212 |
| 351 | 3300005546 | Ga0070696_100000739 | Ga0070696_10000073920 | 212 |
| 352 | 3300006852 | Ga0075433_10094574 | Ga0075433_100945745 | 212 |
| 353 | 3300025922 | Ga0207646_10219473 | Ga0207646_102194732 | 212 |
| 354 | 3300032002 | Ga0307416_100100170 | Ga0307416_1001001702 | 212 |
| 355 | 3300035118 | Ga0373954_0001068 | Ga0373954_0001068_7226_7975 | 212 |
| 356 | 3300045051 | Ga0451576_0023848 | Ga0451576_0023848_5637_6401 | 212 |
| 357 | 3300046536 | Ga0495587_0309198 | Ga0495587_0309198_13_762 | 212 |
| 358 | 3300046559 | Ga0495667_0114313 | Ga0495667_0114313_299_1048 | 212 |
| 359 | 3300049574 | Ga0501038_0261447 | Ga0501038_0261447_542_1303 | 212 |
| 360 | 3300049575 | Ga0501039_0348370 | Ga0501039_0348370_339_1100 | 212 |
| 361 | 3300049590 | Ga0501074_0095745 | Ga0501074_0095745_556_1317 | 212 |
| 362 | 3300049591 | Ga0501075_0178718 | Ga0501075_0178718_581_1342 | 212 |
| 363 | 3300049741 | Ga0501079_0275599 | Ga0501079_0275599_331_1092 | 212 |
| 364 | 3300050507 | nmdc:mga05p37_812202_c1 | nmdc:mga05p37_812202_c1_117_863 | 212 |
| 365 | 3300050515 | nmdc:mga0a205_31396_c1 | nmdc:mga0a205_31396_c1_1820_2590 | 212 |
| 366 | 3300060353 | Ga0501082_0419217 | Ga0501082_0419217_299_1060 | 212 |
| 367 | 3300061734 | Ga0530510_0159222 | Ga0530510_0159222_363_1124 | 212 |
| 368 | 3300009094 | Ga0111539_10006143 | Ga0111539_1000614313 | 213 |
| 369 | 3300026075 | Ga0207708_10267808 | Ga0207708_102678082 | 213 |
| 370 | 3300027907 | Ga0207428_10141373 | Ga0207428_101413732 | 213 |
| 371 | 3300035112 | Ga0373932_0009768 | Ga0373932_0009768_445_1215 | 213 |
| 372 | 3300041406 | Ga0439439_0077659 | Ga0439439_0077659_50_814 | 213 |
| 373 | 3300049577 | Ga0501041_0007643 | Ga0501041_0007643_868_1623 | 213 |
| 374 | 3300050508 | nmdc:mga09592_352385_c1 | nmdc:mga09592_352385_c1_136_900 | 213 |
| 375 | 3300050511 | nmdc:mga08y16_109792_c1 | nmdc:mga08y16_109792_c1_297_1061 | 213 |
| 376 | 3300005334 | Ga0068869_100048555 | Ga0068869_1000485554 | 214 |
| 377 | 3300005435 | Ga0070714_100045792 | Ga0070714_1000457925 | 214 |
| 378 | 3300006173 | Ga0070716_100308631 | Ga0070716_1003086312 | 214 |
| 379 | 3300025929 | Ga0207664_10160319 | Ga0207664_101603194 | 214 |
| 380 | 3300025939 | Ga0207665_10317898 | Ga0207665_103178982 | 214 |
| 381 | 3300025942 | Ga0207689_10175046 | Ga0207689_101750462 | 214 |
| 382 | 3300028380 | Ga0268265_10360178 | Ga0268265_103601782 | 214 |
| 383 | 3300045051 | Ga0451576_0189098 | Ga0451576_0189098_1284_2048 | 214 |
| 384 | 3300049568 | Ga0501031_0185076 | Ga0501031_0185076_559_1311 | 214 |
| 385 | 3300049569 | Ga0501032_0099465 | Ga0501032_0099465_334_1086 | 214 |
| 386 | 3300049570 | Ga0501033_0022466 | Ga0501033_0022466_927_1679 | 214 |
| 387 | 3300049572 | Ga0501036_0004836 | Ga0501036_0004836_4436_5188 | 214 |
| 388 | 3300049573 | Ga0501037_0058146 | Ga0501037_0058146_104_856 | 214 |
| 389 | 3300049574 | Ga0501038_0020021 | Ga0501038_0020021_2781_3533 | 214 |
| 390 | 3300049575 | Ga0501039_0026109 | Ga0501039_0026109_898_1650 | 214 |
| 391 | 3300049576 | Ga0501040_0002845 | Ga0501040_0002845_4242_4994 | 214 |
| 392 | 3300049577 | Ga0501041_0000171 | Ga0501041_0000171_23995_24747 | 214 |
| 393 | 3300049578 | Ga0501042_0003752 | Ga0501042_0003752_4622_5374 | 214 |
| 394 | 3300049579 | Ga0501043_0007248 | Ga0501043_0007248_3554_4306 | 214 |
| 395 | 3300049580 | Ga0501046_0005363 | Ga0501046_0005363_4216_4968 | 214 |
| 396 | 3300049581 | Ga0501047_0099643 | Ga0501047_0099643_457_1209 | 214 |
| 397 | 3300049582 | Ga0501048_0002988 | Ga0501048_0002988_3649_4401 | 214 |
| 398 | 3300049584 | Ga0501068_0125534 | Ga0501068_0125534_397_1149 | 214 |
| 399 | 3300049586 | Ga0501070_0132428 | Ga0501070_0132428_13_765 | 214 |
| 400 | 3300049588 | Ga0501072_0007011 | Ga0501072_0007011_5978_6730 | 214 |
| 401 | 3300049589 | Ga0501073_0122035 | Ga0501073_0122035_132_884 | 214 |
| 402 | 3300049590 | Ga0501074_0139382 | Ga0501074_0139382_681_1433 | 214 |
| 403 | 3300049591 | Ga0501075_0003959 | Ga0501075_0003959_4815_5567 | 214 |
| 404 | 3300049592 | Ga0501076_0009781 | Ga0501076_0009781_3341_4093 | 214 |
| 405 | 3300049593 | Ga0501077_0014240 | Ga0501077_0014240_4208_4960 | 214 |
| 406 | 3300049705 | Ga0501225_0028593 | Ga0501225_0028593_312_1064 | 214 |
| 407 | 3300049741 | Ga0501079_0005505 | Ga0501079_0005505_4190_4942 | 214 |
| 408 | 3300049743 | Ga0501081_0005713 | Ga0501081_0005713_4320_5072 | 214 |
| 409 | 3300049822 | Ga0501035_0054614 | Ga0501035_0054614_242_994 | 214 |
| 410 | 3300049824 | Ga0501045_0093225 | Ga0501045_0093225_468_1220 | 214 |
| 411 | 3300054114 | Ga0501084_0000832 | Ga0501084_0000832_4622_5374 | 214 |
| 412 | 3300060353 | Ga0501082_0006696 | Ga0501082_0006696_4214_4966 | 214 |
| 413 | 3300061734 | Ga0530510_0001659 | Ga0530510_0001659_4475_5227 | 214 |
| 414 | 3300005329 | Ga0070683_100090729 | Ga0070683_1000907294 | 215 |
| 415 | 3300005330 | Ga0070690_100004385 | Ga0070690_1000043856 | 215 |
| 416 | 3300005343 | Ga0070687_100107079 | Ga0070687_1001070793 | 215 |
| 417 | 3300005354 | Ga0070675_100099912 | Ga0070675_1000999122 | 215 |
| 418 | 3300005438 | Ga0070701_10081724 | Ga0070701_100817242 | 215 |
| 419 | 3300005441 | Ga0070700_100033731 | Ga0070700_1000337314 | 215 |
| 420 | 3300005518 | Ga0070699_100075896 | Ga0070699_1000758963 | 215 |
| 421 | 3300005530 | Ga0070679_100155517 | Ga0070679_1001555173 | 215 |
| 422 | 3300005544 | Ga0070686_100058329 | Ga0070686_1000583292 | 215 |
| 423 | 3300005615 | Ga0070702_100415800 | Ga0070702_1004158002 | 215 |
| 424 | 3300005617 | Ga0068859_100597435 | Ga0068859_1005974352 | 215 |
| 425 | 3300005719 | Ga0068861_100563487 | Ga0068861_1005634872 | 215 |
| 426 | 3300005840 | Ga0068870_10099655 | Ga0068870_100996553 | 215 |
| 427 | 3300006237 | Ga0097621_100083845 | Ga0097621_1000838452 | 215 |
| 428 | 3300006358 | Ga0068871_100002265 | Ga0068871_1000022658 | 215 |
| 429 | 3300006844 | Ga0075428_100040409 | Ga0075428_1000404094 | 215 |
| 430 | 3300006844 | Ga0075428_100724492 | Ga0075428_1007244921 | 215 |
| 431 | 3300006846 | Ga0075430_100006267 | Ga0075430_1000062677 | 215 |
| 432 | 3300006846 | Ga0075430_100092323 | Ga0075430_1000923234 | 215 |
| 433 | 3300006847 | Ga0075431_100023107 | Ga0075431_1000231073 | 215 |
| 434 | 3300006847 | Ga0075431_100382558 | Ga0075431_1003825582 | 215 |
| 435 | 3300006880 | Ga0075429_100024792 | Ga0075429_1000247923 | 215 |
| 436 | 3300006914 | Ga0075436_100000375 | Ga0075436_10000037529 | 215 |
| 437 | 3300006931 | Ga0097620_100597501 | Ga0097620_1005975012 | 215 |
| 438 | 3300009147 | Ga0114129_10661176 | Ga0114129_106611762 | 215 |
| 439 | 3300009177 | Ga0105248_10077763 | Ga0105248_100777635 | 215 |
| 440 | 3300014969 | Ga0157376_10022734 | Ga0157376_100227345 | 215 |
| 441 | 3300025917 | Ga0207660_10137290 | Ga0207660_101372902 | 215 |
| 442 | 3300025917 | Ga0207660_10395852 | Ga0207660_103958522 | 215 |
| 443 | 3300025918 | Ga0207662_10167497 | Ga0207662_101674972 | 215 |
| 444 | 3300025921 | Ga0207652_10201665 | Ga0207652_102016652 | 215 |
| 445 | 3300025926 | Ga0207659_10060428 | Ga0207659_100604282 | 215 |
| 446 | 3300025941 | Ga0207711_10145934 | Ga0207711_101459344 | 215 |
| 447 | 3300025944 | Ga0207661_10080217 | Ga0207661_100802174 | 215 |
| 448 | 3300027364 | Ga0209967_1005621 | Ga0209967_10056212 | 215 |
| 449 | 3300027378 | Ga0209981_1005358 | Ga0209981_10053582 | 215 |
| 450 | 3300027395 | Ga0209996_1009691 | Ga0209996_10096911 | 215 |
| 451 | 3300027462 | Ga0210000_1001858 | Ga0210000_10018583 | 215 |
| 452 | 3300027462 | Ga0210000_1009389 | Ga0210000_10093892 | 215 |
| 453 | 3300027526 | Ga0209968_1003895 | Ga0209968_10038954 | 215 |
| 454 | 3300027614 | Ga0209970_1001627 | Ga0209970_10016273 | 215 |
| 455 | 3300027671 | Ga0209588_1005808 | Ga0209588_10058082 | 215 |
| 456 | 3300027695 | Ga0209966_1003212 | Ga0209966_10032124 | 215 |
| 457 | 3300027876 | Ga0209974_10006215 | Ga0209974_100062156 | 215 |
| 458 | 3300031691 | Ga0316579_10004329 | Ga0316579_100043293 | 215 |
| 459 | 3300031728 | Ga0316578_10198494 | Ga0316578_101984942 | 215 |
| 460 | 3300032133 | Ga0316583_10011406 | Ga0316583_100114062 | 215 |
| 461 | 3300035118 | Ga0373954_0000059 | Ga0373954_0000059_28448_29212 | 215 |
| 462 | 3300035207 | Ga0373942_0004062 | Ga0373942_0004062_1090_1845 | 215 |
| 463 | 3300036401 | Ga0373937_0002664 | Ga0373937_0002664_8321_9085 | 215 |
| 464 | 3300036647 | Ga0316582_0013731 | Ga0316582_0013731_1399_2154 | 215 |
| 465 | 3300036712 | Ga0316584_0165789 | Ga0316584_0165789_235_990 | 215 |
| 466 | 3300041408 | Ga0439453_0004469 | Ga0439453_0004469_474_1229 | 215 |
| 467 | 3300041501 | Ga0451845_0636266 | Ga0451845_0636266_92_862 | 215 |
| 468 | 3300042001 | Ga0439441_025778 | Ga0439441_025778_140_895 | 215 |
| 469 | 3300042003 | Ga0439443_020685 | Ga0439443_020685_64_819 | 215 |
| 470 | 3300042435 | Ga0439434_0066952 | Ga0439434_0066952_25_780 | 215 |
| 471 | 3300042436 | Ga0439435_0003451 | Ga0439435_0003451_646_1401 | 215 |
| 472 | 3300042436 | Ga0439435_0060401 | Ga0439435_0060401_160_915 | 215 |
| 473 | 3300042437 | Ga0439444_0001310 | Ga0439444_0001310_504_1259 | 215 |
| 474 | 3300042461 | Ga0439460_0008178 | Ga0439460_0008178_406_1161 | 215 |
| 475 | 3300042532 | Ga0450893_0015742 | Ga0450893_0015742_15_770 | 215 |
| 476 | 3300045976 | Ga0466967_0021254 | Ga0466967_0021254_3405_4178 | 215 |
| 477 | 3300047317 | Ga0495604_0415784 | Ga0495604_0415784_12_776 | 215 |
| 478 | 3300049568 | Ga0501031_0135696 | Ga0501031_0135696_149_904 | 215 |
| 479 | 3300049573 | Ga0501037_0210796 | Ga0501037_0210796_497_1252 | 215 |
| 480 | 3300049575 | Ga0501039_0075705 | Ga0501039_0075705_1153_1908 | 215 |
| 481 | 3300049576 | Ga0501040_0123958 | Ga0501040_0123958_713_1468 | 215 |
| 482 | 3300049580 | Ga0501046_0038625 | Ga0501046_0038625_1917_2672 | 215 |
| 483 | 3300049582 | Ga0501048_0017910 | Ga0501048_0017910_3943_4698 | 215 |
| 484 | 3300049583 | Ga0501067_0029209 | Ga0501067_0029209_1578_2342 | 215 |
| 485 | 3300049587 | Ga0501071_0331535 | Ga0501071_0331535_347_1111 | 215 |
| 486 | 3300049587 | Ga0501071_0382897 | Ga0501071_0382897_169_924 | 215 |
| 487 | 3300049588 | Ga0501072_0110379 | Ga0501072_0110379_11_766 | 215 |
| 488 | 3300049593 | Ga0501077_0028571 | Ga0501077_0028571_313_1068 | 215 |
| 489 | 3300049741 | Ga0501079_0015806 | Ga0501079_0015806_534_1289 | 215 |
| 490 | 3300049742 | Ga0501080_0014806 | Ga0501080_0014806_3640_4395 | 215 |
| 491 | 3300049743 | Ga0501081_0002036 | Ga0501081_0002036_246_1001 | 215 |
| 492 | 3300049824 | Ga0501045_0004851 | Ga0501045_0004851_3465_4220 | 215 |
| 493 | 3300050507 | nmdc:mga05p37_288139_c1 | nmdc:mga05p37_288139_c1_594_1370 | 215 |
| 494 | 3300050507 | nmdc:mga05p37_529058_c1 | nmdc:mga05p37_529058_c1_169_924 | 215 |
| 495 | 3300050508 | nmdc:mga09592_16668_c1 | nmdc:mga09592_16668_c1_2270_3025 | 215 |
| 496 | 3300050508 | nmdc:mga09592_401631_c1 | nmdc:mga09592_401631_c1_195_971 | 215 |
| 497 | 3300050509 | nmdc:mga0qj67_308957_c1 | nmdc:mga0qj67_308957_c1_29_784 | 215 |
| 498 | 3300050509 | nmdc:mga0qj67_52913_c1 | nmdc:mga0qj67_52913_c1_909_1685 | 215 |
| 499 | 3300050509 | nmdc:mga0qj67_740_c1 | nmdc:mga0qj67_740_c1_932_1687 | 215 |
| 500 | 3300050510 | nmdc:mga06r32_45334_c1 | nmdc:mga06r32_45334_c1_2939_3694 | 215 |
| 501 | 3300050510 | nmdc:mga06r32_570032_c1 | nmdc:mga06r32_570032_c1_114_869 | 215 |
| 502 | 3300050514 | nmdc:mga08x19_2831_c1 | nmdc:mga08x19_2831_c1_2982_3743 | 215 |
| 503 | 3300054114 | Ga0501084_0062117 | Ga0501084_0062117_2224_2979 | 215 |
| 504 | 3300060353 | Ga0501082_0071784 | Ga0501082_0071784_2143_2898 | 215 |
| 505 | 3300061734 | Ga0530510_0000042 | Ga0530510_0000042_13239_13994 | 215 |
| 506 | 3300005614 | Ga0068856_100031990 | Ga0068856_1000319902 | 216 |
| 507 | 3300007265 | Ga0099794_10009950 | Ga0099794_100099503 | 216 |
| 508 | 3300013307 | Ga0157372_10224087 | Ga0157372_102240872 | 216 |
| 509 | 3300025912 | Ga0207707_10499526 | Ga0207707_104995262 | 216 |
| 510 | 3300025944 | Ga0207661_10159581 | Ga0207661_101595811 | 216 |
| 511 | 3300026078 | Ga0207702_10372245 | Ga0207702_103722452 | 216 |
| 512 | 3300027907 | Ga0207428_10113601 | Ga0207428_101136012 | 216 |
| 513 | 3300035119 | Ga0373956_0123871 | Ga0373956_0123871_322_1098 | 216 |
| 514 | 3300035724 | Ga0373933_0188902 | Ga0373933_0188902_506_1282 | 216 |
| 515 | 3300049576 | Ga0501040_0349480 | Ga0501040_0349480_70_834 | 216 |
| 516 | 3300049577 | Ga0501041_0239748 | Ga0501041_0239748_357_1121 | 216 |
| 517 | 3300049584 | Ga0501068_0176447 | Ga0501068_0176447_204_968 | 216 |
| 518 | 3300049587 | Ga0501071_0065805 | Ga0501071_0065805_1229_1993 | 216 |
| 519 | 3300049589 | Ga0501073_0134868 | Ga0501073_0134868_372_1136 | 216 |
| 520 | 3300049591 | Ga0501075_0024369 | Ga0501075_0024369_2251_3015 | 216 |
| 521 | 3300049592 | Ga0501076_0047742 | Ga0501076_0047742_1899_2663 | 216 |
| 522 | 3300049741 | Ga0501079_0049182 | Ga0501079_0049182_100_864 | 216 |
| 523 | 3300049743 | Ga0501081_0030146 | Ga0501081_0030146_441_1205 | 216 |
| 524 | 3300049823 | Ga0501044_0298396 | Ga0501044_0298396_765_1529 | 216 |
| 525 | 3300049824 | Ga0501045_0228850 | Ga0501045_0228850_272_1036 | 216 |
| 526 | 3300050511 | nmdc:mga08y16_195044_c1 | nmdc:mga08y16_195044_c1_104_865 | 216 |
| 527 | 3300050512 | nmdc:mga0n895_10506_c1 | nmdc:mga0n895_10506_c1_6645_7406 | 216 |
| 528 | 3300050513 | nmdc:mga0rr50_7287_c1 | nmdc:mga0rr50_7287_c1_414_1175 | 216 |
| 529 | 3300050514 | nmdc:mga08x19_4153_c1 | nmdc:mga08x19_4153_c1_6000_6761 | 216 |
| 530 | 3300050515 | nmdc:mga0a205_13750_c1 | nmdc:mga0a205_13750_c1_6184_6945 | 216 |
| 531 | 3300054114 | Ga0501084_0148038 | Ga0501084_0148038_470_1234 | 216 |
| 532 | 3300060353 | Ga0501082_0079297 | Ga0501082_0079297_1279_2043 | 216 |
| 533 | 3300005345 | Ga0070692_10118553 | Ga0070692_101185532 | 218 |
| 534 | 3300005347 | Ga0070668_100008339 | Ga0070668_1000083392 | 218 |
| 535 | 3300005353 | Ga0070669_100036598 | Ga0070669_1000365983 | 218 |
| 536 | 3300005441 | Ga0070700_100017735 | Ga0070700_1000177354 | 218 |
| 537 | 3300005459 | Ga0068867_100001149 | Ga0068867_10000114918 | 218 |
| 538 | 3300005543 | Ga0070672_100310759 | Ga0070672_1003107591 | 218 |
| 539 | 3300005546 | Ga0070696_100453030 | Ga0070696_1004530302 | 218 |
| 540 | 3300005719 | Ga0068861_100008115 | Ga0068861_1000081153 | 218 |
| 541 | 3300005840 | Ga0068870_10206131 | Ga0068870_102061312 | 218 |
| 542 | 3300005844 | Ga0068862_100042303 | Ga0068862_1000423033 | 218 |
| 543 | 3300006881 | Ga0068865_100011242 | Ga0068865_1000112422 | 218 |
| 544 | 3300009094 | Ga0111539_10096120 | Ga0111539_100961204 | 218 |
| 545 | 3300009148 | Ga0105243_10044229 | Ga0105243_100442293 | 218 |
| 546 | 3300009553 | Ga0105249_10001763 | Ga0105249_1000176320 | 218 |
| 547 | 3300014326 | Ga0157380_10108561 | Ga0157380_101085613 | 218 |
| 548 | 3300025899 | Ga0207642_10008706 | Ga0207642_100087064 | 218 |
| 549 | 3300025908 | Ga0207643_10262359 | Ga0207643_102623592 | 218 |
| 550 | 3300025923 | Ga0207681_10005406 | Ga0207681_100054068 | 218 |
| 551 | 3300025935 | Ga0207709_10012991 | Ga0207709_100129912 | 218 |
| 552 | 3300025938 | Ga0207704_10004148 | Ga0207704_100041484 | 218 |
| 553 | 3300025940 | Ga0207691_10194578 | Ga0207691_101945781 | 218 |
| 554 | 3300025961 | Ga0207712_10009287 | Ga0207712_100092872 | 218 |
| 555 | 3300025972 | Ga0207668_10003596 | Ga0207668_100035968 | 218 |
| 556 | 3300026075 | Ga0207708_10041848 | Ga0207708_100418484 | 218 |
| 557 | 3300026089 | Ga0207648_10003015 | Ga0207648_100030155 | 218 |
| 558 | 3300026118 | Ga0207675_100000954 | Ga0207675_1000009542 | 218 |
| 559 | 3300027907 | Ga0207428_10013958 | Ga0207428_100139585 | 218 |
| 560 | 3300028380 | Ga0268265_10001934 | Ga0268265_100019346 | 218 |
| 561 | 3300050511 | nmdc:mga08y16_49876_c1 | nmdc:mga08y16_49876_c1_1635_2411 | 218 |
| 562 | 3300031901 | Ga0307406_10372161 | Ga0307406_103721612 | 219 |
| 563 | 3300032002 | Ga0307416_100844077 | Ga0307416_1008440771 | 219 |
| 564 | 3300005328 | Ga0070676_10085050 | Ga0070676_100850503 | 222 |
| 565 | 3300005330 | Ga0070690_100329531 | Ga0070690_1003295311 | 222 |
| 566 | 3300005364 | Ga0070673_100226793 | Ga0070673_1002267933 | 222 |
| 567 | 3300005615 | Ga0070702_100158585 | Ga0070702_1001585852 | 222 |
| 568 | 3300005844 | Ga0068862_100042246 | Ga0068862_1000422464 | 222 |
| 569 | 3300009094 | Ga0111539_10052933 | Ga0111539_100529333 | 222 |
| 570 | 3300009094 | Ga0111539_10189542 | Ga0111539_101895424 | 222 |
| 571 | 3300013308 | Ga0157375_10406823 | Ga0157375_104068232 | 222 |
| 572 | 3300025918 | Ga0207662_10124796 | Ga0207662_101247962 | 222 |
| 573 | 3300026121 | Ga0207683_10434713 | Ga0207683_104347132 | 222 |
| 574 | 3300027907 | Ga0207428_10014517 | Ga0207428_100145177 | 222 |
| 575 | 3300028380 | Ga0268265_10050233 | Ga0268265_100502333 | 222 |
| 576 | 3300035241 | Ga0373961_0081094 | Ga0373961_0081094_48_827 | 222 |
| 577 | 3300050511 | nmdc:mga08y16_11747_c1 | nmdc:mga08y16_11747_c1_3668_4444 | 222 |
| 578 | 3300050511 | nmdc:mga08y16_166513_c1 | nmdc:mga08y16_166513_c1_1298_2077 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o24-assembly1.cif.gz_A | structure of the foamy viral protease-reverse transcriptase in complex with dsdna. | 0.7121 | 193 | 218 |
| 8u01-assembly1.cif.gz_A | crystal structure of the glycoside hydrolase family 2 tim barrel-domain containing protein from phocaeicola plebeius | 0.6651 | 104 | 213 |
| 2r2c-assembly1.cif.gz_A | crystal structure of a domain of the outer membrane lipoprotein omp28 from porphyromonas gingivalis | 0.6589 | 104 | 214 |
| 6ncw-assembly1.cif.gz_A | crystal structure of a gh2 beta-galacturonidase from eisenbergiella tayi bound to glycerol | 0.6077 | 104 | 214 |
| 7edd-assembly1.cif.gz_A | crystal structure of a serine protease from streptococcus pyogenes | 0.6065 | 117 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06864_208_318_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6298 | 105 | 215 | 2.60.40.10 |
| 2r2cA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6148 | 104 | 214 | 2.60.40.10 |
| af_Q8ITZ2_1_146_2.60.120.260 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.6147 | 110 | 201 | 2.60.120.260 |
| af_P16620_439_548_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6114 | 109 | 213 | 2.60.40.10 |
| af_Q8WSR7_104_226_2.60.40.640 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6103 | 104 | 213 | 2.60.40.640 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353Y2R7-F1-model_v4 | Uncharacterized protein | 0.8854 | 103 | 219 |
GO:0016020
|
| AF-A0A7Y5UVS6-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.8843 | 86 | 215 |
GO:0000166
GO:0016491 |
| AF-A0A257X1Z9-F1-model_v4 | Uncharacterized protein | 0.8738 | 97 | 215 |
|
| AF-A0A2R5EKD3-F1-model_v4 | Uncharacterized protein | 0.8642 | 103 | 214 |
|
| AF-A0A6A7RSE6-F1-model_v4 | Uncharacterized protein | 0.8513 | 120 | 215 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar