F465718

General Info

Members Datasets Scaffolds Average Seq Length
578 266 1156 129

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000827|Ga0079104_100082711
Length 152
Sequence MMTCLQRTRAGNVLMINKGDEDIMLGLKQVHHIAIIATDYAASKSFYCDILGFTLLSEAYRAERDSWKGDLALNGQYVIELFSFPFPPARPGHPEACGLRHLAFSVDDLDNAVAHLKANHVDCEAIRIDPFTNKRFTFFKDPDGLPLELYEQ

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
53 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
54 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
55 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
95 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
154 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
155 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
156 2547132181 Kosakonia sacchari SP1 Isolate Stem
157 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
158 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
159 2561511199 Enterobacter sp. R4-368 Isolate Nodule
160 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
161 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
162 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
163 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
164 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
165 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
166 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
167 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
168 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
169 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
170 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
171 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
172 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
173 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
174 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
175 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
176 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
177 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
178 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
179 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
180 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
181 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
182 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
183 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
184 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
185 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
186 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
187 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
188 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
189 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
190 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
191 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
192 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
193 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
194 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
195 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
196 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
197 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
198 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
199 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
200 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
201 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
202 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
203 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
204 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
205 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
206 2636415599 Klebsiella variicola DX120E Isolate Unclassified
207 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
208 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
209 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
210 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
211 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
212 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
213 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
214 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
215 2751185917 Enterobacter sp. HK169 Isolate Unclassified
216 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
217 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
218 2775507074 Klebsiella sp. D5A Isolate Unclassified
219 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
220 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
221 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
222 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
223 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
224 2821118458 Enterobacter asburiae 609 Isolate Unclassified
225 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
226 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
227 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
228 2847085930 Erwinia persicina B64 Isolate Bulb
229 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
230 2865014394 Pantoea sp. R-71966 Isolate Unclassified
231 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
232 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
233 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
234 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
235 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
236 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
237 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
238 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
239 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
240 2937539931 Pantoea sp. LS15 Isolate Unclassified
241 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
242 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
243 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
244 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
245 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
246 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
247 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
248 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
249 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
250 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
251 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
252 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
253 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
254 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
255 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
256 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
257 8018221730 Enterobacter sp. CM29 Isolate Unclassified
258 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
259 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
260 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
261 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
262 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
263 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
264 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
265 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
266 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.45
Metatranscriptomes 0.17
Isolates 19.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0.17
Endosphere 3.98
Nodule 3.81
Rhizoplane 12.11
Rhizosphere 53.81
Stem 0.17
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1000827 3300006946 Bacteria 25760
2 SwRhRL2b_contig_127876 2162886007 Bacteria 1083
3 SwRhRL2b_contig_254572 2162886007 Bacteria 2791
4 SwRhRL2b_contig_2866101 2162886007 Bacteria 2151
5 SwRhRL2b_contig_525449 2162886007 Bacteria 3761
6 JGI24739J22299_10000196 3300001989 Bacteria 20012
7 JGI24743J22301_10022508 3300001991 Unclassified 1209
8 JGI25152J39213_1001197 3300002773 Bacteria 11931
9 JGI25150J39212_1041403 3300002774 Bacteria 594
10 rootH2_10005482 3300003320 Bacteria 14996
11 Ga0058692_1000914 3300003856 Bacteria 11616
12 Ga0058692_1003166 3300003856 Bacteria 5203
13 Ga0058692_1003199 3300003856 Bacteria 5152
14 Ga0058692_1003244 3300003856 Bacteria 5093
15 Ga0058692_1004392 3300003856 Bacteria 4189
16 Ga0058692_1004934 3300003856 Bacteria 3875
17 Ga0058692_1008383 3300003856 Bacteria 2669
18 Ga0058692_1013127 3300003856 Bacteria 1940
19 Ga0058692_1018368 3300003856 Bacteria 1513
20 Ga0058692_1019813 3300003856 Bacteria 1427
21 Ga0058692_1031863 3300003856 Bacteria 989
22 Ga0065714_10281814 3300005288 Bacteria 722
23 Ga0065704_10002491 3300005289 Bacteria 5127
24 Ga0065704_10003738 3300005289 Bacteria 4059
25 Ga0065704_10008857 3300005289 Bacteria 3567
26 Ga0065704_10075286 3300005289 Bacteria 5678
27 Ga0065704_10080077 3300005289 Bacteria 4013
28 Ga0070666_10000675 3300005335 Bacteria 20643
29 Ga0070661_100870408 3300005344 Bacteria 742
30 Ga0070668_100004559 3300005347 Bacteria 10275
31 Ga0070669_100686941 3300005353 Bacteria 863
32 Ga0070674_100302098 3300005356 Bacteria 1276
33 Ga0070673_100183559 3300005364 Bacteria 1792
34 Ga0070688_100478203 3300005365 Unclassified 936
35 Ga0070701_10192225 3300005438 Bacteria 1201
36 Ga0070662_100134352 3300005457 Bacteria 1911
37 Ga0070672_100599634 3300005543 Bacteria 959
38 Ga0070672_100904916 3300005543 Unclassified 779
39 Ga0070665_100004779 3300005548 Bacteria 14101
40 Ga0070665_100059740 3300005548 Bacteria 3822
41 Ga0070665_100902889 3300005548 Bacteria 896
42 Ga0068857_100000004 3300005577 Bacteria 171895
43 Ga0068857_100304774 3300005577 Bacteria 1469
44 Ga0068854_100593936 3300005578 Bacteria 944
45 Ga0068861_100818718 3300005719 Unclassified 875
46 Ga0068851_10022396 3300005834 Bacteria 3077
47 Ga0068860_101443838 3300005843 Bacteria 709
48 Ga0075368_10000007 3300006042 Bacteria 51082
49 Ga0075363_100000522 3300006048 Bacteria 12359
50 Ga0075364_10001937 3300006051 Bacteria 11532
51 Ga0075364_10012273 3300006051 Bacteria 5238
52 Ga0075364_10208725 3300006051 Bacteria 1324
53 Ga0075364_10797235 3300006051 Bacteria 644
54 Ga0075367_10000004 3300006178 Bacteria 47817
55 Ga0075370_10002090 3300006353 Bacteria 9098
56 Ga0079104_1000666 3300006946 Bacteria 32326
57 Ga0079104_1001780 3300006946 Bacteria 13472
58 Ga0079104_1002361 3300006946 Bacteria 10325
59 Ga0079104_1003525 3300006946 Bacteria 7208
60 Ga0079104_1003553 3300006946 Bacteria 7170
61 Ga0079104_1005147 3300006946 Bacteria 5317
62 Ga0079104_1012626 3300006946 Bacteria 2642
63 Ga0079104_1012644 3300006946 Bacteria 2639
64 Ga0079104_1029387 3300006946 Bacteria 1385
65 Ga0079104_1046731 3300006946 Bacteria 982
66 Ga0105251_10002735 3300009011 Bacteria 13507
67 Ga0105251_10003694 3300009011 Bacteria 10973
68 Ga0105251_10005879 3300009011 Bacteria 7933
69 Ga0105251_10006748 3300009011 Bacteria 7244
70 Ga0105251_10009526 3300009011 Bacteria 5728
71 Ga0105251_10010186 3300009011 Bacteria 5476
72 Ga0105251_10014987 3300009011 Bacteria 4253
73 Ga0105251_10034648 3300009011 Bacteria 2496
74 Ga0105251_10035448 3300009011 Bacteria 2462
75 Ga0105251_10065976 3300009011 Bacteria 1693
76 Ga0105251_10067935 3300009011 Bacteria 1664
77 Ga0105244_10000521 3300009036 Bacteria 34323
78 Ga0105244_10001879 3300009036 Bacteria 16324
79 Ga0105244_10002437 3300009036 Bacteria 14037
80 Ga0105244_10009491 3300009036 Bacteria 5979
81 Ga0105244_10011199 3300009036 Bacteria 5396
82 Ga0105244_10012019 3300009036 Bacteria 5148
83 Ga0105244_10017574 3300009036 Bacteria 4037
84 Ga0105244_10021005 3300009036 Bacteria 3618
85 Ga0105244_10033312 3300009036 Bacteria 2717
86 Ga0105244_10040993 3300009036 Bacteria 2401
87 Ga0105244_10046798 3300009036 Bacteria 2221
88 Ga0105244_10126453 3300009036 Bacteria 1235
89 Ga0105250_10000387 3300009092 Bacteria 32792
90 Ga0105250_10002112 3300009092 Bacteria 10202
91 Ga0105250_10007433 3300009092 Bacteria 4706
92 Ga0105250_10013305 3300009092 Bacteria 3388
93 Ga0105250_10019640 3300009092 Bacteria 2731
94 Ga0105250_10263914 3300009092 Bacteria 738
95 Ga0105250_10357864 3300009092 Bacteria 640
96 Ga0105240_11734907 3300009093 Bacteria 651
97 Ga0105243_10016152 3300009148 Bacteria 5647
98 Ga0105243_10026408 3300009148 Bacteria 4444
99 Ga0105243_10239117 3300009148 Bacteria 1615
100 Ga0105243_10839771 3300009148 Bacteria 909
101 Ga0105248_10196863 3300009177 Bacteria 2271
102 Ga0105032_103788 3300009979 Bacteria 1307
103 Ga0105028_100089 3300009993 Bacteria 9679
104 Ga0105246_10044343 3300011119 Bacteria 3022
105 Ga0157373_10042419 3300013100 Bacteria 3251
106 Ga0157373_10120236 3300013100 Bacteria 1846
107 Ga0157373_10130231 3300013100 Bacteria 1769
108 Ga0157373_10509956 3300013100 Bacteria 869
109 Ga0157371_10000907 3300013102 Bacteria 33360
110 Ga0157371_10003028 3300013102 Bacteria 15611
111 Ga0157371_10019898 3300013102 Bacteria 4945
112 Ga0157371_10140861 3300013102 Bacteria 1718
113 Ga0157371_10239825 3300013102 Bacteria 1304
114 Ga0157371_10432012 3300013102 Bacteria 966
115 Ga0157370_10002510 3300013104 Bacteria 22097
116 Ga0157370_10017240 3300013104 Bacteria 7289
117 Ga0157370_10144829 3300013104 Bacteria 2213
118 Ga0157370_10411133 3300013104 Bacteria 1245
119 Ga0157369_10000447 3300013105 Bacteria 54657
120 Ga0157369_10042060 3300013105 Bacteria 4985
121 Ga0157378_10767379 3300013297 Bacteria 988
122 Ga0163162_10069844 3300013306 Bacteria 3564
123 Ga0157372_10004636 3300013307 Bacteria 14603
124 Ga0157372_10005552 3300013307 Bacteria 13406
125 Ga0157372_10015433 3300013307 Bacteria 8186
126 Ga0157372_10035803 3300013307 Bacteria 5466
127 Ga0157372_10274762 3300013307 Bacteria 1958
128 Ga0163163_10328467 3300014325 Bacteria 1583
129 Ga0182008_10102307 3300014497 Bacteria 1417
130 Ga0182006_1000045 3300015261 Bacteria 197248
131 Ga0182006_1024282 3300015261 Bacteria 2501
132 Ga0182007_10019759 3300015262 Bacteria 2417
133 Ga0183366_1003 3300015679 Bacteria 453474
134 Ga0183370_1003 3300015680 Bacteria 454044
135 Ga0183369_1005 3300015685 Bacteria 453680
136 Ga0183368_1006 3300015687 Bacteria 551576
137 Ga0163161_10013454 3300017792 Bacteria 5695
138 Ga0206356_10210607 3300020070 Bacteria 2193
139 Ga0213876_10000026 3300021384 Bacteria 231892
140 Ga0209760_101967 3300025207 Bacteria 2005
141 Ga0209437_100063 3300025233 Bacteria 335477
142 Ga0207425_1046333 3300025245 Bacteria 810
143 Ga0209129_1000008 3300025258 Bacteria 640959
144 Ga0207656_10058488 3300025321 Bacteria 1684
145 Ga0207696_1000066 3300025711 Bacteria 231203
146 Ga0207696_1000196 3300025711 Bacteria 93398
147 Ga0207696_1000387 3300025711 Bacteria 42108
148 Ga0207696_1000588 3300025711 Bacteria 28043
149 Ga0207696_1000831 3300025711 Bacteria 19662
150 Ga0207696_1002322 3300025711 Bacteria 9427
151 Ga0207696_1014246 3300025711 Bacteria 2735
152 Ga0207655_1000017 3300025728 Bacteria 544403
153 Ga0207655_1000024 3300025728 Bacteria 459774
154 Ga0207655_1000090 3300025728 Bacteria 203398
155 Ga0207655_1000549 3300025728 Bacteria 47090
156 Ga0207655_1000842 3300025728 Bacteria 32957
157 Ga0207655_1003822 3300025728 Bacteria 10982
158 Ga0207655_1004658 3300025728 Bacteria 9620
159 Ga0207655_1005089 3300025728 Bacteria 9089
160 Ga0207655_1005219 3300025728 Bacteria 8930
161 Ga0207655_1016521 3300025728 Bacteria 4031
162 Ga0207655_1041708 3300025728 Bacteria 1963
163 Ga0207655_1043291 3300025728 Bacteria 1905
164 Ga0207655_1097924 3300025728 Bacteria 1017
165 Ga0207713_1000007 3300025735 Bacteria 564979
166 Ga0207713_1000048 3300025735 Bacteria 228272
167 Ga0207713_1000057 3300025735 Bacteria 217090
168 Ga0207713_1000164 3300025735 Bacteria 98195
169 Ga0207713_1006664 3300025735 Bacteria 6989
170 Ga0207713_1010249 3300025735 Bacteria 5201
171 Ga0207713_1018504 3300025735 Bacteria 3448
172 Ga0207713_1022403 3300025735 Bacteria 3000
173 Ga0207713_1055183 3300025735 Bacteria 1552
174 Ga0207713_1058866 3300025735 Bacteria 1477
175 Ga0207713_1059705 3300025735 Bacteria 1462
176 Ga0207713_1074012 3300025735 Bacteria 1248
177 Ga0207713_1139290 3300025735 Bacteria 794
178 Ga0207680_10000528 3300025903 Bacteria 18162
179 Ga0207647_10000001 3300025904 Bacteria 506349
180 Ga0207695_10634355 3300025913 Bacteria 949
181 Ga0207649_11172356 3300025920 Bacteria 607
182 Ga0207681_10607412 3300025923 Bacteria 904
183 Ga0207706_10166512 3300025933 Bacteria 1937
184 Ga0207709_10022182 3300025935 Bacteria 3600
185 Ga0207709_10383296 3300025935 Bacteria 1070
186 Ga0207669_10028576 3300025937 Bacteria 3070
187 Ga0207691_10944028 3300025940 Unclassified 721
188 Ga0207668_10125545 3300025972 Bacteria 1950
189 Ga0207640_12101729 3300025981 Bacteria 512
190 Ga0207674_10000009 3300026116 Bacteria 202730
191 Ga0207698_10225225 3300026142 Bacteria 1698
192 Ga0209281_1000058 3300027111 Bacteria 300244
193 Ga0209281_1000298 3300027111 Bacteria 90323
194 Ga0209281_1000719 3300027111 Bacteria 32925
195 Ga0209281_1000785 3300027111 Bacteria 30177
196 Ga0209281_1000942 3300027111 Bacteria 23779
197 Ga0209281_1001031 3300027111 Bacteria 21422
198 Ga0209281_1001360 3300027111 Bacteria 15130
199 Ga0209281_1001444 3300027111 Bacteria 13970
200 Ga0209281_1003236 3300027111 Bacteria 5543
201 Ga0209281_1007798 3300027111 Bacteria 2654
202 Ga0209371_1000014 3300027312 Bacteria 661118
203 Ga0209371_1000053 3300027312 Bacteria 264616
204 Ga0209371_1000096 3300027312 Bacteria 160552
205 Ga0209371_1000268 3300027312 Bacteria 60882
206 Ga0209371_1000355 3300027312 Bacteria 49419
207 Ga0209371_1000564 3300027312 Bacteria 33895
208 Ga0209371_1000588 3300027312 Bacteria 32686
209 Ga0209371_1000756 3300027312 Bacteria 26926
210 Ga0209371_1000875 3300027312 Bacteria 24191
211 Ga0209371_1001111 3300027312 Bacteria 19921
212 Ga0209371_1001791 3300027312 Bacteria 13437
213 Ga0209371_1002135 3300027312 Bacteria 11649
214 Ga0209371_1003057 3300027312 Bacteria 8594
215 Ga0209371_1008196 3300027312 Bacteria 3514
216 Ga0209371_1010004 3300027312 Bacteria 2960
217 Ga0209371_1015053 3300027312 Bacteria 2095
218 Ga0209371_1018808 3300027312 Bacteria 1742
219 Ga0209371_1037899 3300027312 Bacteria 998
220 Ga0209371_1055403 3300027312 Bacteria 746
221 Ga0209371_1056704 3300027312 Bacteria 732
222 Ga0209371_1066203 3300027312 Bacteria 651
223 Ga0209813_10000008 3300027866 Bacteria 102867
224 Ga0268266_10000665 3300028379 Bacteria 46420
225 Ga0268266_10046884 3300028379 Bacteria 3700
226 Ga0268266_11616533 3300028379 Bacteria 623
227 Ga0268264_12470754 3300028381 Unclassified 525
228 Ga0268256_1000021 3300030500 Bacteria 542735
229 Ga0268256_1000025 3300030500 Bacteria 484317
230 Ga0268256_1000053 3300030500 Bacteria 264616
231 Ga0268256_1000086 3300030500 Bacteria 160533
232 Ga0268256_1000302 3300030500 Bacteria 49352
233 Ga0268256_1000460 3300030500 Bacteria 35580
234 Ga0268256_1000657 3300030500 Bacteria 26305
235 Ga0268256_1001009 3300030500 Bacteria 19076
236 Ga0268256_1001242 3300030500 Bacteria 15974
237 Ga0268256_1001562 3300030500 Bacteria 13437
238 Ga0268256_1001872 3300030500 Bacteria 11649
239 Ga0268256_1002741 3300030500 Bacteria 8594
240 Ga0268256_1010670 3300030500 Bacteria 2960
241 Ga0268256_1016675 3300030500 Bacteria 2095
242 Ga0268256_1021077 3300030500 Bacteria 1742
243 Ga0268256_1035189 3300030500 Bacteria 1166
244 Ga0268256_1043080 3300030500 Bacteria 998
245 Ga0268256_1062119 3300030500 Bacteria 746
246 Ga0268256_1073786 3300030500 Bacteria 651
247 Ga0307414_10025461 3300032004 Bacteria 3791
248 Ga0436365_0084998 3300039437 Bacteria 507888
249 Ga0439438_000003 3300041405 Bacteria 464587
250 Ga0439438_000782 3300041405 Bacteria 14151
251 Ga0439438_003784 3300041405 Bacteria 5981
252 Ga0439438_022628 3300041405 Bacteria 1741
253 Ga0439438_052301 3300041405 Bacteria 1035
254 Ga0439447_003756 3300041407 Bacteria 5338
255 Ga0439447_004396 3300041407 Bacteria 4859
256 Ga0439447_019515 3300041407 Bacteria 1806
257 Ga0439466_0000161 3300041411 Bacteria 26751
258 Ga0451843_0778412 3300041509 Bacteria 749
259 Ga0451853_2759828 3300041512 Bacteria 3106
260 Ga0439432_003062 3300042006 Bacteria 6226
261 Ga0439432_009881 3300042006 Bacteria 3319
262 Ga0439432_118992 3300042006 Bacteria 783
263 Ga0439452_000004 3300042010 Bacteria 764268
264 Ga0439452_000005 3300042010 Bacteria 646919
265 Ga0439452_000007 3300042010 Bacteria 613625
266 Ga0439452_000074 3300042010 Bacteria 88357
267 Ga0439452_000553 3300042010 Bacteria 19786
268 Ga0439452_001187 3300042010 Bacteria 11225
269 Ga0439452_012897 3300042010 Bacteria 2361
270 Ga0439463_005144 3300042016 Bacteria 3251
271 Ga0439434_0091567 3300042435 Bacteria 973
272 Ga0439464_0021917 3300042439 Bacteria 1756
273 Ga0439464_0031254 3300042439 Bacteria 1493
274 Ga0466981_0000344 3300044669 Bacteria 15726
275 Ga0495617_006553 3300046452 Bacteria 4077
276 Ga0495627_067263 3300046453 Bacteria 1051
277 Ga0495591_000047 3300046458 Bacteria 140371
278 Ga0495591_001549 3300046458 Bacteria 14060
279 Ga0495591_003692 3300046458 Bacteria 7773
280 Ga0495638_0014728 3300046460 Bacteria 5274
281 Ga0495650_0000377 3300046471 Bacteria 77543
282 Ga0495650_0001722 3300046471 Bacteria 20057
283 Ga0495650_0028927 3300046471 Bacteria 2533
284 Ga0495605_0056410 3300046474 Bacteria 1894
285 Ga0495584_0008360 3300046491 Bacteria 5359
286 Ga0495585_0124781 3300046492 Bacteria 1359
287 Ga0495596_0176566 3300046500 Bacteria 830
288 Ga0495607_0015288 3300046501 Bacteria 4977
289 Ga0495606_0004074 3300046507 Bacteria 14872
290 Ga0495620_0007119 3300046515 Bacteria 6096
291 Ga0495637_0230120 3300046520 Bacteria 672
292 Ga0495643_0233473 3300046522 Bacteria 866
293 Ga0495644_0003920 3300046523 Bacteria 5854
294 Ga0495648_0007389 3300046524 Bacteria 8798
295 Ga0495648_0011361 3300046524 Bacteria 6710
296 Ga0495654_0000163 3300046530 Bacteria 65805
297 Ga0495654_0008256 3300046530 Bacteria 5761
298 Ga0495609_0047771 3300046538 Bacteria 1914
299 Ga0495597_0002930 3300046542 Bacteria 10362
300 Ga0495625_0009526 3300046660 Bacteria 8114
301 Ga0495588_0005844 3300046674 Bacteria 5507
302 Ga0495671_0189383 3300046692 Bacteria 999
303 Ga0495649_0004849 3300046694 Bacteria 8699
304 Ga0495649_0007906 3300046694 Bacteria 6434
305 Ga0495589_0053132 3300046794 Bacteria 2000
306 Ga0495660_0000158 3300046810 Bacteria 73369
307 Ga0495660_0027883 3300046810 Bacteria 3193
308 Ga0495672_0000029 3300047320 Bacteria 305231
309 Ga0495672_0000049 3300047320 Bacteria 240851
310 Ga0495672_0000054 3300047320 Bacteria 230777
311 Ga0495683_0045184 3300047323 Bacteria 2213
312 Ga0495679_000647 3300047446 Bacteria 23261
313 Ga0495679_001865 3300047446 Bacteria 11350
314 Ga0495679_004167 3300047446 Bacteria 6751
315 Ga0495679_017557 3300047446 Bacteria 2559
316 Ga0495679_058100 3300047446 Bacteria 1142
317 Ga0495673_0000047 3300047469 Bacteria 266522
318 Ga0495673_0000092 3300047469 Bacteria 187963
319 Ga0495681_0065552 3300047470 Bacteria 1660
320 Ga0496100_0012503 3300048903 Bacteria 4870
321 Ga0496100_0031045 3300048903 Bacteria 3318
322 Ga0496100_0204145 3300048903 Bacteria 1442
323 Ga0496101_0043170 3300048904 Bacteria 3221
324 Ga0496101_0175631 3300048904 Bacteria 1647
325 Ga0496102_0020810 3300048905 Bacteria 5798
326 Ga0496102_0351403 3300048905 Bacteria 1388
327 Ga0496102_1187668 3300048905 Bacteria 682
328 Ga0496104_0000259 3300048907 Bacteria 46783
329 Ga0496104_0049244 3300048907 Bacteria 3974
330 Ga0496104_0115096 3300048907 Bacteria 2580
331 Ga0496105_0002976 3300048908 Bacteria 12447
332 Ga0496105_0006448 3300048908 Bacteria 9022
333 Ga0496105_0075253 3300048908 Bacteria 2789
334 Ga0496105_0185558 3300048908 Bacteria 1702
335 Ga0496110_0356014 3300048913 Bacteria 1334
336 Ga0496113_0569718 3300048916 Bacteria 908
337 Ga0496116_0001830 3300048919 Bacteria 23023
338 Ga0496116_0008319 3300048919 Bacteria 9015
339 Ga0496116_0021876 3300048919 Bacteria 4809
340 Ga0496116_0040398 3300048919 Bacteria 3212
341 Ga0496116_0052095 3300048919 Bacteria 2713
342 Ga0496116_0053696 3300048919 Bacteria 2659
343 Ga0496116_0070926 3300048919 Bacteria 2208
344 Ga0496116_0111202 3300048919 Bacteria 1609
345 Ga0496116_0306930 3300048919 Bacteria 751
346 Ga0496117_0000350 3300048920 Bacteria 81439
347 Ga0496117_0000895 3300048920 Bacteria 45877
348 Ga0496117_0001186 3300048920 Bacteria 39159
349 Ga0496117_0005322 3300048920 Bacteria 13587
350 Ga0496117_0008518 3300048920 Bacteria 9725
351 Ga0496117_0032130 3300048920 Bacteria 3993
352 Ga0496117_0049103 3300048920 Bacteria 3005
353 Ga0496117_0051022 3300048920 Bacteria 2928
354 Ga0496117_0069627 3300048920 Bacteria 2368
355 Ga0496117_0239439 3300048920 Bacteria 997
356 Ga0496118_0001869 3300048921 Bacteria 30129
357 Ga0496118_0004714 3300048921 Bacteria 15966
358 Ga0496118_0006316 3300048921 Bacteria 13094
359 Ga0496118_0006373 3300048921 Bacteria 13002
360 Ga0496118_0006706 3300048921 Bacteria 12544
361 Ga0496118_0022061 3300048921 Bacteria 5581
362 Ga0496118_0031993 3300048921 Bacteria 4345
363 Ga0496118_0036245 3300048921 Bacteria 3990
364 Ga0496118_0064565 3300048921 Bacteria 2685
365 Ga0496118_0187829 3300048921 Bacteria 1239
366 Ga0496118_0239038 3300048921 Bacteria 1041
367 Ga0496118_0380579 3300048921 Bacteria 740
368 Ga0496119_0000134 3300048922 Bacteria 104139
369 Ga0496119_0000171 3300048922 Bacteria 91583
370 Ga0496119_0001006 3300048922 Bacteria 36126
371 Ga0496119_0003121 3300048922 Bacteria 17465
372 Ga0496119_0013082 3300048922 Bacteria 6654
373 Ga0496119_0024415 3300048922 Bacteria 4253
374 Ga0496119_0068436 3300048922 Bacteria 2090
375 Ga0496119_0101108 3300048922 Bacteria 1618
376 Ga0496120_0000017 3300048923 Bacteria 269222
377 Ga0496120_0000616 3300048923 Bacteria 53766
378 Ga0496120_0002689 3300048923 Bacteria 17465
379 Ga0496120_0007161 3300048923 Bacteria 8362
380 Ga0496120_0008874 3300048923 Bacteria 7207
381 Ga0496120_0015517 3300048923 Bacteria 5020
382 Ga0496120_0029913 3300048923 Bacteria 3319
383 Ga0496120_0050487 3300048923 Bacteria 2381
384 Ga0496120_0085221 3300048923 Bacteria 1701
385 Ga0496121_0001624 3300048924 Bacteria 37256
386 Ga0496121_0007674 3300048924 Bacteria 12957
387 Ga0496121_0012955 3300048924 Bacteria 9015
388 Ga0496121_0017073 3300048924 Bacteria 7442
389 Ga0496121_0017671 3300048924 Bacteria 7260
390 Ga0496121_0042047 3300048924 Bacteria 3982
391 Ga0496121_0070051 3300048924 Bacteria 2826
392 Ga0496121_0092433 3300048924 Bacteria 2358
393 Ga0496121_0115710 3300048924 Bacteria 2035
394 Ga0496122_0000419 3300048925 Bacteria 89990
395 Ga0496122_0006471 3300048925 Bacteria 13434
396 Ga0496122_0014905 3300048925 Bacteria 7482
397 Ga0496122_0023132 3300048925 Bacteria 5494
398 Ga0496122_0028908 3300048925 Bacteria 4688
399 Ga0496122_0029676 3300048925 Bacteria 4604
400 Ga0496122_0032384 3300048925 Bacteria 4324
401 Ga0496122_0041869 3300048925 Bacteria 3612
402 Ga0496122_0086707 3300048925 Bacteria 2153
403 Ga0496122_0089947 3300048925 Bacteria 2097
404 Ga0496122_0095306 3300048925 Bacteria 2011
405 Ga0496122_0112377 3300048925 Bacteria 1784
406 Ga0496122_0160854 3300048925 Bacteria 1369
407 Ga0496123_0001552 3300048926 Bacteria 31622
408 Ga0496123_0004223 3300048926 Bacteria 15325
409 Ga0496123_0005354 3300048926 Bacteria 12958
410 Ga0496123_0007683 3300048926 Bacteria 10078
411 Ga0496123_0010057 3300048926 Bacteria 8420
412 Ga0496123_0019433 3300048926 Bacteria 5354
413 Ga0496123_0024128 3300048926 Bacteria 4632
414 Ga0496123_0026643 3300048926 Bacteria 4324
415 Ga0496123_0032642 3300048926 Bacteria 3763
416 Ga0496123_0033217 3300048926 Bacteria 3716
417 Ga0496123_0064078 3300048926 Bacteria 2344
418 Ga0496123_0088859 3300048926 Bacteria 1843
419 Ga0496123_0155345 3300048926 Bacteria 1227
420 Ga0496124_0000452 3300048927 Bacteria 72015
421 Ga0496124_0000646 3300048927 Bacteria 57503
422 Ga0496124_0001272 3300048927 Bacteria 38410
423 Ga0496124_0012472 3300048927 Bacteria 8388
424 Ga0496124_0023666 3300048927 Bacteria 5602
425 Ga0496124_0024644 3300048927 Bacteria 5464
426 Ga0496124_0031576 3300048927 Bacteria 4687
427 Ga0496124_0034620 3300048927 Bacteria 4429
428 Ga0496124_0056175 3300048927 Bacteria 3321
429 Ga0496124_0057080 3300048927 Bacteria 3290
430 Ga0496124_0104187 3300048927 Bacteria 2294
431 Ga0496124_0109628 3300048927 Bacteria 2224
432 Ga0496124_0160359 3300048927 Bacteria 1753
433 Ga0496124_0172575 3300048927 Bacteria 1672
434 Ga0496125_0002256 3300048928 Bacteria 25587
435 Ga0496125_0009798 3300048928 Bacteria 9764
436 Ga0496125_0024637 3300048928 Bacteria 5527
437 Ga0496125_0027259 3300048928 Bacteria 5183
438 Ga0496125_0037444 3300048928 Bacteria 4217
439 Ga0496125_0076398 3300048928 Bacteria 2586
440 Ga0496125_0135416 3300048928 Bacteria 1724
441 Ga0496125_0445197 3300048928 Bacteria 744
442 Ga0496126_0006481 3300048929 Bacteria 13034
443 Ga0496126_0028763 3300048929 Bacteria 5290
444 Ga0496126_0034603 3300048929 Bacteria 4743
445 Ga0496126_0063520 3300048929 Bacteria 3309
446 Ga0496126_0097230 3300048929 Bacteria 2580
447 Ga0496126_0100956 3300048929 Bacteria 2524
448 Ga0496126_0166394 3300048929 Bacteria 1881
449 Ga0496126_0169433 3300048929 Bacteria 1861
450 Ga0496126_0206115 3300048929 Bacteria 1657
451 Ga0496126_0398674 3300048929 Bacteria 1116
452 Ga0496126_0430209 3300048929 Bacteria 1065
453 Ga0496126_0478925 3300048929 Bacteria 997
454 Ga0496126_0602086 3300048929 Bacteria 866
455 Ga0496126_0762346 3300048929 Bacteria 746
456 Ga0495678_001808 3300049459 Bacteria 15743
457 Ga0495678_011745 3300049459 Bacteria 4180
458 Ga0495682_0000003 3300049460 Bacteria 515787
459 nmdc:mga03n38_313_c1 3300050490 Bacteria 11661
460 nmdc:mga00v17_1108_c1 3300050491 Bacteria 14169
461 nmdc:mga00v17_128582_c1 3300050491 Bacteria 1618
462 nmdc:mga00v17_4279_c1 3300050491 Bacteria 7412
463 nmdc:mga06z11_5_c2 3300050494 Bacteria 66259
464 nmdc:mga04h51_9_c1 3300050495 Bacteria 107099
465 Ga0500621_000006 3300053126 Bacteria 245480
466 Ga0500656_000221 3300053732 Bacteria 3768
467 2522548463 2522125168 Bacteria 7376607
468 2547696710 2547132181 Bacteria 4945084
469 2548650606 2547132416 Bacteria 4633861
470 2555261949 2554235234 Bacteria 5762085
471 2562466068 2561511199 Bacteria 5155034
472 2599412310 2599185169 Bacteria 5441380
473 2599928302 2599185299 Bacteria 4854625
474 2601525500 2600255254 Bacteria 5281859
475 2601530527 2600255255 Bacteria 5282785
476 2601534120 2600255256 Bacteria 5597742
477 2601540288 2600255257 Bacteria 5597196
478 2601617621 2600255280 Bacteria 5292309
479 2601622655 2600255281 Bacteria 5288753
480 2601644437 2600255287 Bacteria 5210468
481 2601650929 2600255288 Bacteria 5282738
482 2601655979 2600255289 Bacteria 5281907
483 2601660741 2600255290 Bacteria 5282218
484 2601664602 2600255291 Bacteria 5217298
485 2601697530 2600255298 Bacteria 5215185
486 2601702918 2600255299 Bacteria 5218662
487 2601708745 2600255300 Bacteria 5287774
488 2601713603 2600255301 Bacteria 5280532
489 2601718828 2600255302 Bacteria 5288235
490 2601722423 2600255303 Bacteria 5219315
491 2601728691 2600255304 Bacteria 5283973
492 2601733614 2600255305 Bacteria 5282329
493 2601738589 2600255306 Bacteria 5281613
494 2601743079 2600255307 Bacteria 5439064
495 2601753873 2600255309 Bacteria 5431045
496 2601758729 2600255310 Bacteria 5600903
497 2601762920 2600255311 Bacteria 5598766
498 2602020597 2600255392 Bacteria 5437392
499 2603640773 2602042046 Bacteria 5483348
500 2603644434 2602042047 Bacteria 4697674
501 2603663081 2602042052 Bacteria 5215873
502 2603667979 2602042053 Bacteria 5214361
503 2603700293 2602042066 Bacteria 4423871
504 2603706093 2602042067 Bacteria 4863713
505 2603841298 2602042103 Bacteria 5284714
506 2603846370 2602042104 Bacteria 5281639
507 2603851445 2602042105 Bacteria 5282303
508 2603856512 2602042106 Bacteria 5282744
509 2603868724 2602042109 Bacteria 5152801
510 2603874092 2602042110 Bacteria 5283285
511 2603878787 2602042111 Bacteria 5212080
512 2606051272 2603880178 Bacteria 5283018
513 2606072091 2603880184 Bacteria 5217896
514 2606148797 2603880202 Bacteria 5284684
515 2606179163 2603880211 Bacteria 5284226
516 2608670360 2608642108 Bacteria 4104624
517 2609911795 2609459761 Bacteria 5513740
518 2637226970 2636415599 Bacteria 5718434
519 2650900041 2648501693 Bacteria 5069560
520 2671103548 2667528172 Bacteria 5170840
521 2671587887 2671180115 Bacteria 5353919
522 2676409542 2675903046 Bacteria 5451247
523 2681997002 2681812866 Bacteria 4552357
524 2682008788 2681812869 Bacteria 5014465
525 2686354280 2684622997 Bacteria 4624240
526 2712470754 2711768156 Bacteria 4471618
527 2753854721 2751185917 Bacteria 4551186
528 2765587586 2765235842 Bacteria 4799256
529 2775540980 2775506706 Bacteria 4873073
530 2777021368 2775507074 Bacteria 5532402
531 2792313485 2791355010 Bacteria 4864581
532 2793406742 2791355275 Bacteria 4429597
533 2809124431 2808606414 Bacteria 4917181
534 2813730465 2811995292 Bacteria 5303342
535 2814698073 2814123068 Bacteria 5687681
536 2821121584 2821118458 Bacteria 4714306
537 2823377293 2823373977 Bacteria 4779415
538 2844426282 2844425489 Bacteria 4854065
539 2844532435 2844528606 Bacteria 4733806
540 2847088938 2847085930 Bacteria 5070450
541 2847801130 2847797336 Bacteria 5176640
542 2865018444 2865014394 Bacteria 4764573
543 2881612713 2881609920 Bacteria 4405319
544 2884090314 2884086401 Bacteria 5005459
545 2891671964 2891670763 Bacteria 4967099
546 2896347377 2896344016 Bacteria 3811746
547 2904516310 2904513164 Bacteria 5476410
548 2919112482 2919108558 Bacteria 5897419
549 2923638134 2923634449 Bacteria 4753480
550 2927835446 2927833300 Bacteria 4923934
551 2935628077 2935625433 Bacteria 5042964
552 2937542134 2937539931 Bacteria 4639830
553 2939571427 2939568625 Bacteria 4542555
554 2939576208 2939573065 Bacteria 4926053
555 2939609318 2939607340 Bacteria 4719256
556 2939619504 2939617950 Bacteria 4820956
557 2939646164 2939642701 Bacteria 4475280
558 2945879618 2945874760 Bacteria 5527237
559 2945954163 2945951305 Bacteria 4918162
560 2969083981 2969079654 Bacteria 5439582
561 2971825457 2971820967 Bacteria 5823634
562 2974313478 2974310843 Bacteria 4947816
563 2974437103 2974435778 Bacteria 4876478
564 2984497957 2984494565 Bacteria 5000175
565 2984561058 2984559226 Bacteria 5683096
566 2984599131 2984595703 Bacteria 5682994
567 2990264527 2990261002 Bacteria 4919493
568 3000380368 3000376612 Bacteria 4705565
569 8018225558 8018221730 Bacteria 4616064
570 8018410177 8018405270 Bacteria 4978981
571 8019506975 8019504834 Bacteria 4819156
572 8054845599 8054844752 Bacteria 4450330
573 8054853751 8054849141 Bacteria 5232694
574 8055092449 8055087960 Bacteria 4784273
575 8055093648 8055092621 Bacteria 4873875
576 8055100520 8055097453 Bacteria 4865496
577 8055697383 8055693939 Bacteria 4772047
578 8057307189 8057304971 Bacteria 4649742
579 Ga0079104_1000827
580 SwRhRL2b_contig_127876
581 SwRhRL2b_contig_254572
582 SwRhRL2b_contig_2866101
583 SwRhRL2b_contig_525449
584 JGI24739J22299_10000196
585 JGI24743J22301_10022508
586 JGI25152J39213_1001197
587 JGI25150J39212_1041403
588 rootH2_10005482
589 Ga0058692_1000914
590 Ga0058692_1003166
591 Ga0058692_1003199
592 Ga0058692_1003244
593 Ga0058692_1004392
594 Ga0058692_1004934
595 Ga0058692_1008383
596 Ga0058692_1013127
597 Ga0058692_1018368
598 Ga0058692_1019813
599 Ga0058692_1031863
600 Ga0065714_10281814
601 Ga0065704_10002491
602 Ga0065704_10003738
603 Ga0065704_10008857
604 Ga0065704_10075286
605 Ga0065704_10080077
606 Ga0070666_10000675
607 Ga0070661_100870408
608 Ga0070668_100004559
609 Ga0070669_100686941
610 Ga0070674_100302098
611 Ga0070673_100183559
612 Ga0070688_100478203
613 Ga0070701_10192225
614 Ga0070662_100134352
615 Ga0070672_100599634
616 Ga0070672_100904916
617 Ga0070665_100004779
618 Ga0070665_100059740
619 Ga0070665_100902889
620 Ga0068857_100000004
621 Ga0068857_100304774
622 Ga0068854_100593936
623 Ga0068861_100818718
624 Ga0068851_10022396
625 Ga0068860_101443838
626 Ga0075368_10000007
627 Ga0075363_100000522
628 Ga0075364_10001937
629 Ga0075364_10012273
630 Ga0075364_10208725
631 Ga0075364_10797235
632 Ga0075367_10000004
633 Ga0075370_10002090
634 Ga0079104_1000666
635 Ga0079104_1001780
636 Ga0079104_1002361
637 Ga0079104_1003525
638 Ga0079104_1003553
639 Ga0079104_1005147
640 Ga0079104_1012626
641 Ga0079104_1012644
642 Ga0079104_1029387
643 Ga0079104_1046731
644 Ga0105251_10002735
645 Ga0105251_10003694
646 Ga0105251_10005879
647 Ga0105251_10006748
648 Ga0105251_10009526
649 Ga0105251_10010186
650 Ga0105251_10014987
651 Ga0105251_10034648
652 Ga0105251_10035448
653 Ga0105251_10065976
654 Ga0105251_10067935
655 Ga0105244_10000521
656 Ga0105244_10001879
657 Ga0105244_10002437
658 Ga0105244_10009491
659 Ga0105244_10011199
660 Ga0105244_10012019
661 Ga0105244_10017574
662 Ga0105244_10021005
663 Ga0105244_10033312
664 Ga0105244_10040993
665 Ga0105244_10046798
666 Ga0105244_10126453
667 Ga0105250_10000387
668 Ga0105250_10002112
669 Ga0105250_10007433
670 Ga0105250_10013305
671 Ga0105250_10019640
672 Ga0105250_10263914
673 Ga0105250_10357864
674 Ga0105240_11734907
675 Ga0105243_10016152
676 Ga0105243_10026408
677 Ga0105243_10239117
678 Ga0105243_10839771
679 Ga0105248_10196863
680 Ga0105032_103788
681 Ga0105028_100089
682 Ga0105246_10044343
683 Ga0157373_10042419
684 Ga0157373_10120236
685 Ga0157373_10130231
686 Ga0157373_10509956
687 Ga0157371_10000907
688 Ga0157371_10003028
689 Ga0157371_10019898
690 Ga0157371_10140861
691 Ga0157371_10239825
692 Ga0157371_10432012
693 Ga0157370_10002510
694 Ga0157370_10017240
695 Ga0157370_10144829
696 Ga0157370_10411133
697 Ga0157369_10000447
698 Ga0157369_10042060
699 Ga0157378_10767379
700 Ga0163162_10069844
701 Ga0157372_10004636
702 Ga0157372_10005552
703 Ga0157372_10015433
704 Ga0157372_10035803
705 Ga0157372_10274762
706 Ga0163163_10328467
707 Ga0182008_10102307
708 Ga0182006_1000045
709 Ga0182006_1024282
710 Ga0182007_10019759
711 Ga0183366_1003
712 Ga0183370_1003
713 Ga0183369_1005
714 Ga0183368_1006
715 Ga0163161_10013454
716 Ga0206356_10210607
717 Ga0213876_10000026
718 Ga0209760_101967
719 Ga0209437_100063
720 Ga0207425_1046333
721 Ga0209129_1000008
722 Ga0207656_10058488
723 Ga0207696_1000066
724 Ga0207696_1000196
725 Ga0207696_1000387
726 Ga0207696_1000588
727 Ga0207696_1000831
728 Ga0207696_1002322
729 Ga0207696_1014246
730 Ga0207655_1000017
731 Ga0207655_1000024
732 Ga0207655_1000090
733 Ga0207655_1000549
734 Ga0207655_1000842
735 Ga0207655_1003822
736 Ga0207655_1004658
737 Ga0207655_1005089
738 Ga0207655_1005219
739 Ga0207655_1016521
740 Ga0207655_1041708
741 Ga0207655_1043291
742 Ga0207655_1097924
743 Ga0207713_1000007
744 Ga0207713_1000048
745 Ga0207713_1000057
746 Ga0207713_1000164
747 Ga0207713_1006664
748 Ga0207713_1010249
749 Ga0207713_1018504
750 Ga0207713_1022403
751 Ga0207713_1055183
752 Ga0207713_1058866
753 Ga0207713_1059705
754 Ga0207713_1074012
755 Ga0207713_1139290
756 Ga0207680_10000528
757 Ga0207647_10000001
758 Ga0207695_10634355
759 Ga0207649_11172356
760 Ga0207681_10607412
761 Ga0207706_10166512
762 Ga0207709_10022182
763 Ga0207709_10383296
764 Ga0207669_10028576
765 Ga0207691_10944028
766 Ga0207668_10125545
767 Ga0207640_12101729
768 Ga0207674_10000009
769 Ga0207698_10225225
770 Ga0209281_1000058
771 Ga0209281_1000298
772 Ga0209281_1000719
773 Ga0209281_1000785
774 Ga0209281_1000942
775 Ga0209281_1001031
776 Ga0209281_1001360
777 Ga0209281_1001444
778 Ga0209281_1003236
779 Ga0209281_1007798
780 Ga0209371_1000014
781 Ga0209371_1000053
782 Ga0209371_1000096
783 Ga0209371_1000268
784 Ga0209371_1000355
785 Ga0209371_1000564
786 Ga0209371_1000588
787 Ga0209371_1000756
788 Ga0209371_1000875
789 Ga0209371_1001111
790 Ga0209371_1001791
791 Ga0209371_1002135
792 Ga0209371_1003057
793 Ga0209371_1008196
794 Ga0209371_1010004
795 Ga0209371_1015053
796 Ga0209371_1018808
797 Ga0209371_1037899
798 Ga0209371_1055403
799 Ga0209371_1056704
800 Ga0209371_1066203
801 Ga0209813_10000008
802 Ga0268266_10000665
803 Ga0268266_10046884
804 Ga0268266_11616533
805 Ga0268264_12470754
806 Ga0268256_1000021
807 Ga0268256_1000025
808 Ga0268256_1000053
809 Ga0268256_1000086
810 Ga0268256_1000302
811 Ga0268256_1000460
812 Ga0268256_1000657
813 Ga0268256_1001009
814 Ga0268256_1001242
815 Ga0268256_1001562
816 Ga0268256_1001872
817 Ga0268256_1002741
818 Ga0268256_1010670
819 Ga0268256_1016675
820 Ga0268256_1021077
821 Ga0268256_1035189
822 Ga0268256_1043080
823 Ga0268256_1062119
824 Ga0268256_1073786
825 Ga0307414_10025461
826 Ga0436365_0084998
827 Ga0439438_000003
828 Ga0439438_000782
829 Ga0439438_003784
830 Ga0439438_022628
831 Ga0439438_052301
832 Ga0439447_003756
833 Ga0439447_004396
834 Ga0439447_019515
835 Ga0439466_0000161
836 Ga0451843_0778412
837 Ga0451853_2759828
838 Ga0439432_003062
839 Ga0439432_009881
840 Ga0439432_118992
841 Ga0439452_000004
842 Ga0439452_000005
843 Ga0439452_000007
844 Ga0439452_000074
845 Ga0439452_000553
846 Ga0439452_001187
847 Ga0439452_012897
848 Ga0439463_005144
849 Ga0439434_0091567
850 Ga0439464_0021917
851 Ga0439464_0031254
852 Ga0466981_0000344
853 Ga0495617_006553
854 Ga0495627_067263
855 Ga0495591_000047
856 Ga0495591_001549
857 Ga0495591_003692
858 Ga0495638_0014728
859 Ga0495650_0000377
860 Ga0495650_0001722
861 Ga0495650_0028927
862 Ga0495605_0056410
863 Ga0495584_0008360
864 Ga0495585_0124781
865 Ga0495596_0176566
866 Ga0495607_0015288
867 Ga0495606_0004074
868 Ga0495620_0007119
869 Ga0495637_0230120
870 Ga0495643_0233473
871 Ga0495644_0003920
872 Ga0495648_0007389
873 Ga0495648_0011361
874 Ga0495654_0000163
875 Ga0495654_0008256
876 Ga0495609_0047771
877 Ga0495597_0002930
878 Ga0495625_0009526
879 Ga0495588_0005844
880 Ga0495671_0189383
881 Ga0495649_0004849
882 Ga0495649_0007906
883 Ga0495589_0053132
884 Ga0495660_0000158
885 Ga0495660_0027883
886 Ga0495672_0000029
887 Ga0495672_0000049
888 Ga0495672_0000054
889 Ga0495683_0045184
890 Ga0495679_000647
891 Ga0495679_001865
892 Ga0495679_004167
893 Ga0495679_017557
894 Ga0495679_058100
895 Ga0495673_0000047
896 Ga0495673_0000092
897 Ga0495681_0065552
898 Ga0496100_0012503
899 Ga0496100_0031045
900 Ga0496100_0204145
901 Ga0496101_0043170
902 Ga0496101_0175631
903 Ga0496102_0020810
904 Ga0496102_0351403
905 Ga0496102_1187668
906 Ga0496104_0000259
907 Ga0496104_0049244
908 Ga0496104_0115096
909 Ga0496105_0002976
910 Ga0496105_0006448
911 Ga0496105_0075253
912 Ga0496105_0185558
913 Ga0496110_0356014
914 Ga0496113_0569718
915 Ga0496116_0001830
916 Ga0496116_0008319
917 Ga0496116_0021876
918 Ga0496116_0040398
919 Ga0496116_0052095
920 Ga0496116_0053696
921 Ga0496116_0070926
922 Ga0496116_0111202
923 Ga0496116_0306930
924 Ga0496117_0000350
925 Ga0496117_0000895
926 Ga0496117_0001186
927 Ga0496117_0005322
928 Ga0496117_0008518
929 Ga0496117_0032130
930 Ga0496117_0049103
931 Ga0496117_0051022
932 Ga0496117_0069627
933 Ga0496117_0239439
934 Ga0496118_0001869
935 Ga0496118_0004714
936 Ga0496118_0006316
937 Ga0496118_0006373
938 Ga0496118_0006706
939 Ga0496118_0022061
940 Ga0496118_0031993
941 Ga0496118_0036245
942 Ga0496118_0064565
943 Ga0496118_0187829
944 Ga0496118_0239038
945 Ga0496118_0380579
946 Ga0496119_0000134
947 Ga0496119_0000171
948 Ga0496119_0001006
949 Ga0496119_0003121
950 Ga0496119_0013082
951 Ga0496119_0024415
952 Ga0496119_0068436
953 Ga0496119_0101108
954 Ga0496120_0000017
955 Ga0496120_0000616
956 Ga0496120_0002689
957 Ga0496120_0007161
958 Ga0496120_0008874
959 Ga0496120_0015517
960 Ga0496120_0029913
961 Ga0496120_0050487
962 Ga0496120_0085221
963 Ga0496121_0001624
964 Ga0496121_0007674
965 Ga0496121_0012955
966 Ga0496121_0017073
967 Ga0496121_0017671
968 Ga0496121_0042047
969 Ga0496121_0070051
970 Ga0496121_0092433
971 Ga0496121_0115710
972 Ga0496122_0000419
973 Ga0496122_0006471
974 Ga0496122_0014905
975 Ga0496122_0023132
976 Ga0496122_0028908
977 Ga0496122_0029676
978 Ga0496122_0032384
979 Ga0496122_0041869
980 Ga0496122_0086707
981 Ga0496122_0089947
982 Ga0496122_0095306
983 Ga0496122_0112377
984 Ga0496122_0160854
985 Ga0496123_0001552
986 Ga0496123_0004223
987 Ga0496123_0005354
988 Ga0496123_0007683
989 Ga0496123_0010057
990 Ga0496123_0019433
991 Ga0496123_0024128
992 Ga0496123_0026643
993 Ga0496123_0032642
994 Ga0496123_0033217
995 Ga0496123_0064078
996 Ga0496123_0088859
997 Ga0496123_0155345
998 Ga0496124_0000452
999 Ga0496124_0000646
1000 Ga0496124_0001272
1001 Ga0496124_0012472
1002 Ga0496124_0023666
1003 Ga0496124_0024644
1004 Ga0496124_0031576
1005 Ga0496124_0034620
1006 Ga0496124_0056175
1007 Ga0496124_0057080
1008 Ga0496124_0104187
1009 Ga0496124_0109628
1010 Ga0496124_0160359
1011 Ga0496124_0172575
1012 Ga0496125_0002256
1013 Ga0496125_0009798
1014 Ga0496125_0024637
1015 Ga0496125_0027259
1016 Ga0496125_0037444
1017 Ga0496125_0076398
1018 Ga0496125_0135416
1019 Ga0496125_0445197
1020 Ga0496126_0006481
1021 Ga0496126_0028763
1022 Ga0496126_0034603
1023 Ga0496126_0063520
1024 Ga0496126_0097230
1025 Ga0496126_0100956
1026 Ga0496126_0166394
1027 Ga0496126_0169433
1028 Ga0496126_0206115
1029 Ga0496126_0398674
1030 Ga0496126_0430209
1031 Ga0496126_0478925
1032 Ga0496126_0602086
1033 Ga0496126_0762346
1034 Ga0495678_001808
1035 Ga0495678_011745
1036 Ga0495682_0000003
1037 nmdc:mga03n38_313_c1
1038 nmdc:mga00v17_1108_c1
1039 nmdc:mga00v17_128582_c1
1040 nmdc:mga00v17_4279_c1
1041 nmdc:mga06z11_5_c2
1042 nmdc:mga04h51_9_c1
1043 Ga0500621_000006
1044 Ga0500656_000221
1045 2522548463
1046 2547696710
1047 2548650606
1048 2555261949
1049 2562466068
1050 2599412310
1051 2599928302
1052 2601525500
1053 2601530527
1054 2601534120
1055 2601540288
1056 2601617621
1057 2601622655
1058 2601644437
1059 2601650929
1060 2601655979
1061 2601660741
1062 2601664602
1063 2601697530
1064 2601702918
1065 2601708745
1066 2601713603
1067 2601718828
1068 2601722423
1069 2601728691
1070 2601733614
1071 2601738589
1072 2601743079
1073 2601753873
1074 2601758729
1075 2601762920
1076 2602020597
1077 2603640773
1078 2603644434
1079 2603663081
1080 2603667979
1081 2603700293
1082 2603706093
1083 2603841298
1084 2603846370
1085 2603851445
1086 2603856512
1087 2603868724
1088 2603874092
1089 2603878787
1090 2606051272
1091 2606072091
1092 2606148797
1093 2606179163
1094 2608670360
1095 2609911795
1096 2637226970
1097 2650900041
1098 2671103548
1099 2671587887
1100 2676409542
1101 2681997002
1102 2682008788
1103 2686354280
1104 2712470754
1105 2753854721
1106 2765587586
1107 2775540980
1108 2777021368
1109 2792313485
1110 2793406742
1111 2809124431
1112 2813730465
1113 2814698073
1114 2821121584
1115 2823377293
1116 2844426282
1117 2844532435
1118 2847088938
1119 2847801130
1120 2865018444
1121 2881612713
1122 2884090314
1123 2891671964
1124 2896347377
1125 2904516310
1126 2919112482
1127 2923638134
1128 2927835446
1129 2935628077
1130 2937542134
1131 2939571427
1132 2939576208
1133 2939609318
1134 2939619504
1135 2939646164
1136 2945879618
1137 2945954163
1138 2969083981
1139 2971825457
1140 2974313478
1141 2974437103
1142 2984497957
1143 2984561058
1144 2984599131
1145 2990264527
1146 3000380368
1147 8018225558
1148 8018410177
1149 8019506975
1150 8054845599
1151 8054853751
1152 8055092449
1153 8055093648
1154 8055100520
1155 8055697383
1156 8057307189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

149

0.98

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

138

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p25-assembly1.cif.gz_A-2 the crystal structure of the glyoxalase family protein from enterococcus faecalis 0.9223 5 127
3l7t-assembly2.cif.gz_C crystal structure of smu.1112c 0.9155 4 127
2p25-assembly1.cif.gz_A-2 the crystal structure of the glyoxalase family protein from enterococcus faecalis 0.888 5 127
3l7t-assembly2.cif.gz_C crystal structure of smu.1112c 0.875 4 127
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8738 4 129
ID Description Score Start End Superfamily
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9821 9 127 3.10.180.10
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9659 9 127 3.10.180.10
2p25A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9244 9 127 3.10.180.10
2p25A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9098 9 127 3.10.180.10
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.891 80 129 3.10.180.10
ID Description Score Start End GO Terms
AF-I2NIQ0-F1-model_v4 VOC domain-containing protein 1.002 79 129
AF-A0A3D4ENV6-F1-model_v4 VOC domain-containing protein 0.9863 75 129
AF-A0A0K0GKZ7-F1-model_v4 Glyoxylase I family protein 0.9824 76 129
AF-A0A077ZHJ6-F1-model_v4 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) 0.9817 1 129 GO:0005524
GO:0005737
GO:0006400
GO:0032267
AF-A0A4P8SKJ3-F1-model_v4 VOC family protein 0.9813 1 129

Map