F465723

General Info

Members Datasets Scaffolds Average Seq Length
578 384 1156 303

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10250765|Ga0105238_102507652
Length 352
Sequence MGPNCGLILRDAAGAAPQDEGFADNKRNDPMKAYVYGANGAAITDVPKPAPKGTQVLVKVHACGLNRADLGMTKGHAHGAAGGVGTVLGMEWAGEVAELGPDAKGVKVGDKIMGSGGSAFAEYTLADHGRLFRAPSNMNFDEAATLPVALATMHNAVVTNGALQPGQSVMIQGASSGVGLMAMQIAKLKGAKLVVGSSTDPYRRGRLKEFGADLAVDSSDPGWVDEVLKATNGEGVDLIVDQVSGKVMNQNLAATKIKGRIVNVGRLGGTRAEFNFDLHAARRISYIGVTFRTRSIEEVREIFDEVRRDIWGAVESRKLQLPIDKVYKFEDIGKAFEHMEANKHLGKIVVTL

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
279 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
280 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
287 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
290 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
291 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
292 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
293 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
300 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
301 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
302 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
303 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
304 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
305 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
306 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
307 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
308 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
309 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
310 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
311 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
312 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
313 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
314 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
315 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
316 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
317 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
318 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
319 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
320 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
321 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
322 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
323 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
324 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
325 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
326 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
327 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
328 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
329 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
330 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
331 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
332 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
333 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
334 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
335 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
336 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
337 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
338 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
339 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
340 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
341 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
342 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
343 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
344 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
345 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
346 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
347 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
348 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
349 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
350 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
351 2904699407
352 2906610324
353 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
354 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
355 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
356 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
357 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
358 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
359 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
360 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
361 2922425934
362 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
363 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
364 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
365 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
366 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
367 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
368 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
369 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
370 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
371 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
372 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
373 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
374 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
375 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
376 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
377 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
378 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
379 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
380 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
381 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
382 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
383 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
384 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.57
Metatranscriptomes 0
Isolates 14.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 10.55
Rhizoplane 6.06
Rhizosphere 58.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10250765 3300009551 Bacteria 1748
2 JGI25406J46586_10000021 3300003203 Bacteria 84514
3 JGI25406J46586_10016723 3300003203 Bacteria 3051
4 JGI25160J50197_1006462 3300003354 Bacteria 4742
5 JGI25404J52841_10023995 3300003659 Bacteria 1315
6 Ga0065165_1001283 3300005262 Bacteria 28362
7 Ga0070658_10443915 3300005327 Bacteria 1117
8 Ga0070683_100020392 3300005329 Bacteria 5899
9 Ga0070683_100091955 3300005329 Bacteria 2849
10 Ga0070683_100142442 3300005329 Bacteria 2271
11 Ga0070680_100062296 3300005336 Bacteria 3054
12 Ga0070680_100066425 3300005336 Bacteria 2957
13 Ga0070680_100106009 3300005336 Bacteria 2337
14 Ga0070682_100018684 3300005337 Bacteria 4056
15 Ga0070660_100016099 3300005339 Bacteria 5420
16 Ga0070660_100188978 3300005339 Bacteria 1668
17 Ga0070674_100052465 3300005356 Bacteria 2813
18 Ga0070709_10017401 3300005434 Bacteria 4122
19 Ga0070714_100008845 3300005435 Bacteria 7876
20 Ga0070714_100011360 3300005435 Bacteria 7065
21 Ga0070714_100088105 3300005435 Bacteria 2715
22 Ga0070714_100219322 3300005435 Bacteria 1747
23 Ga0070713_100003607 3300005436 Bacteria 10231
24 Ga0070713_100007249 3300005436 Bacteria 7765
25 Ga0070713_100112787 3300005436 Bacteria 2373
26 Ga0070713_100121064 3300005436 Bacteria 2295
27 Ga0070710_10000708 3300005437 Bacteria 15866
28 Ga0070710_10003983 3300005437 Bacteria 7002
29 Ga0070710_10007420 3300005437 Bacteria 5310
30 Ga0070711_100010293 3300005439 Bacteria 5784
31 Ga0070711_100067656 3300005439 Bacteria 2507
32 Ga0070711_100070979 3300005439 Bacteria 2453
33 Ga0070708_100092186 3300005445 Bacteria 2760
34 Ga0070663_100053860 3300005455 Bacteria 2873
35 Ga0070663_100253703 3300005455 Bacteria 1393
36 Ga0070678_100179583 3300005456 Bacteria 1731
37 Ga0070681_10145484 3300005458 Bacteria 2299
38 Ga0068867_100026289 3300005459 Bacteria 4179
39 Ga0070706_100060174 3300005467 Bacteria 3506
40 Ga0070707_100106031 3300005468 Bacteria 2725
41 Ga0070698_100163268 3300005471 Bacteria 2171
42 Ga0070679_100043461 3300005530 Bacteria 4476
43 Ga0070679_100055274 3300005530 Bacteria 3953
44 Ga0070679_100222919 3300005530 Bacteria 1846
45 Ga0070679_100379164 3300005530 Bacteria 1361
46 Ga0070684_100011602 3300005535 Bacteria 7022
47 Ga0068853_100055695 3300005539 Bacteria 3408
48 Ga0068853_100227659 3300005539 Bacteria 1705
49 Ga0070665_100386310 3300005548 Bacteria 1407
50 Ga0068855_100109884 3300005563 Bacteria 3165
51 Ga0068855_100125665 3300005563 Bacteria 2933
52 Ga0068855_100259195 3300005563 Bacteria 1938
53 Ga0068855_100357908 3300005563 Bacteria 1606
54 Ga0068854_100156385 3300005578 Bacteria 1762
55 Ga0068856_100023694 3300005614 Bacteria 5969
56 Ga0068852_100109398 3300005616 Bacteria 2510
57 Ga0068864_100352679 3300005618 Bacteria 1388
58 Ga0068866_10053236 3300005718 Bacteria 2069
59 Ga0068861_100252161 3300005719 Bacteria 1506
60 Ga0068851_10017694 3300005834 Bacteria 3427
61 Ga0068863_100281933 3300005841 Bacteria 1610
62 Ga0068858_100160769 3300005842 Bacteria 2115
63 Ga0068858_100242536 3300005842 Bacteria 1710
64 Ga0068860_100000471 3300005843 Bacteria 50128
65 Ga0068862_100058558 3300005844 Bacteria 3304
66 Ga0081455_10069621 3300005937 Bacteria 2925
67 Ga0081455_10119730 3300005937 Bacteria 2076
68 Ga0081455_10160945 3300005937 Bacteria 1721
69 Ga0081540_1004707 3300005983 Bacteria 10325
70 Ga0081540_1005778 3300005983 Bacteria 9157
71 Ga0081540_1016036 3300005983 Bacteria 4715
72 Ga0081540_1023016 3300005983 Bacteria 3661
73 Ga0081540_1089534 3300005983 Bacteria 1357
74 Ga0081539_10000051 3300005985 Bacteria 268337
75 Ga0081539_10000148 3300005985 Bacteria 163442
76 Ga0081539_10009620 3300005985 Bacteria 8026
77 Ga0081539_10027637 3300005985 Bacteria 3588
78 Ga0070717_10000402 3300006028 Bacteria 27731
79 Ga0070717_10077668 3300006028 Bacteria 2781
80 Ga0075365_10089588 3300006038 Bacteria 2094
81 Ga0075363_100063425 3300006048 Bacteria 1994
82 Ga0075363_100139562 3300006048 Bacteria 1364
83 Ga0075364_10045080 3300006051 Bacteria 2870
84 Ga0070715_10045714 3300006163 Bacteria 1858
85 Ga0070716_100006048 3300006173 Bacteria 5897
86 Ga0070716_100101461 3300006173 Bacteria 1765
87 Ga0070716_100112940 3300006173 Bacteria 1687
88 Ga0070712_100008186 3300006175 Bacteria 6567
89 Ga0070712_100037180 3300006175 Bacteria 3317
90 Ga0075362_10078256 3300006177 Bacteria 1521
91 Ga0075367_10057509 3300006178 Bacteria 2312
92 Ga0075369_10024782 3300006186 Bacteria 2489
93 Ga0075370_10032834 3300006353 Bacteria 2903
94 Ga0075434_100024593 3300006871 Bacteria 5889
95 Ga0075434_100122913 3300006871 Bacteria 2612
96 Ga0099824_1031084 3300006942 Bacteria 2066
97 Ga0099822_1001873 3300006943 Bacteria 25386
98 Ga0075435_100021468 3300007076 Bacteria 4967
99 Ga0099794_10125561 3300007265 Bacteria 1294
100 Ga0105240_10177078 3300009093 Bacteria 2521
101 Ga0105240_10436842 3300009093 Bacteria 1467
102 Ga0105247_10005426 3300009101 Bacteria 8033
103 Ga0105241_10508225 3300009174 Bacteria 1076
104 Ga0105248_10101265 3300009177 Bacteria 3247
105 Ga0105237_10056507 3300009545 Bacteria 3929
106 Ga0105237_10136799 3300009545 Bacteria 2444
107 Ga0105238_10024830 3300009551 Bacteria 6108
108 Ga0105238_10250583 3300009551 Bacteria 1749
109 Ga0105239_10043806 3300010375 Bacteria 4907
110 Ga0157335_1000871 3300012492 Bacteria 1514
111 Ga0157370_10043441 3300013104 Bacteria 4325
112 Ga0157370_10148417 3300013104 Bacteria 2183
113 Ga0157369_10011746 3300013105 Bacteria 9942
114 Ga0157369_10024696 3300013105 Bacteria 6679
115 Ga0157369_10466917 3300013105 Bacteria 1307
116 Ga0157374_10034436 3300013296 Bacteria 4626
117 Ga0157374_10100276 3300013296 Bacteria 2776
118 Ga0157378_10025057 3300013297 Bacteria 5255
119 Ga0163162_10417115 3300013306 Bacteria 1475
120 Ga0157372_10428630 3300013307 Bacteria 1541
121 Ga0157375_10164872 3300013308 Bacteria 2360
122 Ga0163163_10581492 3300014325 Bacteria 1183
123 Ga0213876_10000670 3300021384 Bacteria 24379
124 Ga0209233_1020676 3300025261 Bacteria 1719
125 Ga0209564_1000390 3300025295 Bacteria 78822
126 Ga0209758_1003610 3300025297 Bacteria 13850
127 Ga0209758_1004758 3300025297 Bacteria 11016
128 Ga0209758_1007379 3300025297 Bacteria 7515
129 Ga0209758_1008034 3300025297 Bacteria 6970
130 Ga0209758_1014022 3300025297 Bacteria 4308
131 Ga0209758_1038002 3300025297 Bacteria 1852
132 Ga0207426_1000574 3300025302 Bacteria 49411
133 Ga0207426_1000837 3300025302 Bacteria 32586
134 Ga0207692_10007642 3300025898 Bacteria 4435
135 Ga0207692_10013743 3300025898 Bacteria 3520
136 Ga0207642_10048609 3300025899 Bacteria 1902
137 Ga0207710_10008835 3300025900 Bacteria 4242
138 Ga0207710_10052194 3300025900 Bacteria 1838
139 Ga0207688_10059228 3300025901 Bacteria 2157
140 Ga0207680_10153454 3300025903 Bacteria 1537
141 Ga0207647_10112567 3300025904 Bacteria 1608
142 Ga0207685_10047408 3300025905 Bacteria 1640
143 Ga0207699_10040745 3300025906 Bacteria 2678
144 Ga0207684_10052020 3300025910 Bacteria 3475
145 Ga0207654_10115909 3300025911 Bacteria 1674
146 Ga0207707_10007987 3300025912 Bacteria 9192
147 Ga0207707_10049332 3300025912 Bacteria 3667
148 Ga0207707_10370869 3300025912 Bacteria 1231
149 Ga0207695_10062924 3300025913 Bacteria 3827
150 Ga0207695_10255184 3300025913 Bacteria 1652
151 Ga0207695_10432675 3300025913 Bacteria 1199
152 Ga0207671_10089913 3300025914 Bacteria 2312
153 Ga0207671_10246522 3300025914 Bacteria 1404
154 Ga0207693_10001058 3300025915 Bacteria 24605
155 Ga0207693_10002843 3300025915 Bacteria 15000
156 Ga0207693_10022562 3300025915 Bacteria 5001
157 Ga0207693_10105736 3300025915 Bacteria 2207
158 Ga0207693_10152974 3300025915 Bacteria 1815
159 Ga0207663_10002609 3300025916 Bacteria 8675
160 Ga0207663_10002786 3300025916 Bacteria 8431
161 Ga0207663_10115576 3300025916 Bacteria 1828
162 Ga0207663_10137978 3300025916 Bacteria 1695
163 Ga0207663_10254420 3300025916 Bacteria 1294
164 Ga0207660_10019450 3300025917 Bacteria 4540
165 Ga0207660_10419381 3300025917 Bacteria 1079
166 Ga0207662_10158406 3300025918 Bacteria 1445
167 Ga0207657_10013488 3300025919 Bacteria 8014
168 Ga0207652_10019069 3300025921 Bacteria 5635
169 Ga0207652_10050398 3300025921 Bacteria 3567
170 Ga0207652_10412294 3300025921 Bacteria 1219
171 Ga0207646_10088457 3300025922 Bacteria 2772
172 Ga0207694_10046849 3300025924 Bacteria 3342
173 Ga0207687_10174475 3300025927 Bacteria 1661
174 Ga0207700_10012252 3300025928 Bacteria 5521
175 Ga0207700_10014889 3300025928 Bacteria 5110
176 Ga0207700_10044345 3300025928 Bacteria 3273
177 Ga0207700_10048261 3300025928 Bacteria 3160
178 Ga0207664_10023663 3300025929 Bacteria 4605
179 Ga0207664_10025806 3300025929 Bacteria 4433
180 Ga0207664_10162118 3300025929 Bacteria 1908
181 Ga0207664_10369767 3300025929 Bacteria 1271
182 Ga0207644_10218011 3300025931 Bacteria 1511
183 Ga0207690_10280649 3300025932 Bacteria 1297
184 Ga0207706_10016927 3300025933 Bacteria 6576
185 Ga0207669_10059747 3300025937 Bacteria 2333
186 Ga0207665_10005334 3300025939 Bacteria 8591
187 Ga0207665_10010410 3300025939 Bacteria 6108
188 Ga0207665_10100792 3300025939 Bacteria 2016
189 Ga0207691_10090453 3300025940 Bacteria 2743
190 Ga0207661_10009413 3300025944 Bacteria 7006
191 Ga0207667_10045963 3300025949 Bacteria 4623
192 Ga0207667_10223048 3300025949 Bacteria 1931
193 Ga0207667_10422432 3300025949 Bacteria 1356
194 Ga0207668_10056602 3300025972 Bacteria 2731
195 Ga0207658_10232301 3300025986 Bacteria 1558
196 Ga0207703_10280566 3300026035 Bacteria 1513
197 Ga0207639_10061108 3300026041 Bacteria 2908
198 Ga0207639_10394740 3300026041 Bacteria 1245
199 Ga0207678_10007212 3300026067 Bacteria 9854
200 Ga0207678_10085267 3300026067 Bacteria 2701
201 Ga0207678_10130926 3300026067 Bacteria 2140
202 Ga0207702_10003237 3300026078 Bacteria 15044
203 Ga0207641_10479857 3300026088 Bacteria 1205
204 Ga0207648_10163419 3300026089 Bacteria 1967
205 Ga0207674_10393525 3300026116 Bacteria 1339
206 Ga0207674_10547330 3300026116 Bacteria 1118
207 Ga0207683_10011530 3300026121 Bacteria 7545
208 Ga0207698_10126059 3300026142 Bacteria 2178
209 Ga0207698_10300397 3300026142 Bacteria 1494
210 Ga0209589_1000001 3300027357 Bacteria 794224
211 Ga0209489_100001 3300027361 Bacteria 794224
212 Ga0209700_100001 3300027363 Bacteria 794224
213 Ga0209588_1015010 3300027671 Bacteria 2379
214 Ga0207428_10088058 3300027907 Bacteria 2415
215 Ga0268266_10019183 3300028379 Bacteria 5823
216 Ga0268266_10227592 3300028379 Bacteria 1716
217 Ga0268265_10120862 3300028380 Bacteria 2157
218 Ga0268265_10297071 3300028380 Bacteria 1452
219 Ga0268264_10000048 3300028381 Bacteria 334457
220 Ga0265323_10027004 3300028653 Bacteria 2159
221 Ga0265336_10002023 3300028666 Bacteria 8653
222 Ga0265338_10000034 3300028800 Bacteria 244623
223 Ga0265328_10037150 3300031239 Bacteria 1799
224 Ga0265329_10052548 3300031242 Bacteria 1296
225 Ga0265340_10002448 3300031247 Bacteria 10562
226 Ga0265339_10019603 3300031249 Bacteria 3968
227 Ga0265339_10052502 3300031249 Bacteria 2220
228 Ga0265339_10119678 3300031249 Bacteria 1355
229 Ga0265316_10175752 3300031344 Bacteria 1596
230 Ga0307509_10017893 3300031507 Bacteria 8139
231 Ga0307509_10057532 3300031507 Bacteria 4122
232 Ga0307509_10074154 3300031507 Bacteria 3540
233 Ga0307509_10089606 3300031507 Bacteria 3154
234 Ga0307508_10000003 3300031616 Bacteria 321602
235 Ga0307508_10158265 3300031616 Bacteria 1868
236 Ga0265314_10000412 3300031711 Bacteria 57508
237 Ga0265314_10031282 3300031711 Bacteria 3932
238 Ga0265314_10169392 3300031711 Bacteria 1320
239 Ga0307516_10029440 3300031730 Bacteria 5553
240 Ga0307516_10050482 3300031730 Bacteria 4081
241 Ga0307516_10079612 3300031730 Bacteria 3121
242 Ga0307516_10091060 3300031730 Bacteria 2878
243 Ga0307516_10113310 3300031730 Bacteria 2510
244 Ga0307413_10006633 3300031824 Bacteria 5308
245 Ga0307410_10183178 3300031852 Bacteria 1587
246 Ga0307409_100143463 3300031995 Bacteria 2061
247 Ga0307416_100194684 3300032002 Bacteria 1916
248 Ga0307411_10110610 3300032005 Bacteria 1965
249 Ga0307415_100089816 3300032126 Bacteria 2220
250 Ga0307507_10030513 3300033179 Bacteria 5686
251 Ga0307510_10020754 3300033180 Bacteria 7670
252 Ga0307510_10041569 3300033180 Bacteria 5023
253 Ga0307510_10150176 3300033180 Bacteria 1951
254 Ga0315911_1000002 3300033442 Bacteria 926833
255 Ga0373923_0042435 3300035111 Bacteria 1879
256 Ga0373936_0050404 3300035113 Bacteria 1684
257 Ga0373943_0074817 3300035170 Bacteria 1723
258 Ga0373931_0023120 3300035691 Bacteria 3136
259 Ga0373935_0091029 3300035692 Bacteria 1997
260 Ga0373927_0004705 3300035695 Bacteria 9513
261 Ga0373927_0006809 3300035695 Bacteria 7774
262 Ga0373927_0030173 3300035695 Bacteria 3538
263 Ga0373933_0000062 3300035724 Bacteria 64991
264 Ga0373933_0155585 3300035724 Bacteria 1450
265 Ga0373947_0053958 3300035725 Bacteria 2425
266 Ga0373947_0114144 3300035725 Bacteria 1710
267 Ga0373937_0094825 3300036401 Bacteria 2767
268 Ga0373937_0113241 3300036401 Bacteria 2524
269 Ga0373937_0116659 3300036401 Bacteria 2486
270 Ga0373925_0011279 3300037068 Bacteria 6482
271 Ga0373925_0046835 3300037068 Bacteria 3216
272 Ga0373925_0057037 3300037068 Bacteria 2926
273 Ga0373925_0074965 3300037068 Bacteria 2563
274 Ga0373925_0334022 3300037068 Bacteria 1228
275 Ga0395898_0039271 3300037466 Bacteria 4686
276 Ga0395898_0553571 3300037466 Bacteria 1092
277 Ga0436364_0043851 3300037853 Bacteria 2654
278 Ga0436364_0563114 3300037853 Bacteria 3856
279 Ga0395901_0190471 3300038443 Bacteria 2151
280 Ga0395901_0195365 3300038443 Bacteria 2122
281 Ga0436365_1128219 3300039437 Bacteria 41762
282 Ga0436363_1161902 3300039450 Bacteria 3363
283 Ga0436363_1526803 3300039450 Bacteria 2254
284 Ga0436362_1099153 3300039453 Bacteria 4320
285 Ga0451833_0238202 3300041491 Bacteria 1281
286 Ga0466969_0097593 3300044656 Bacteria 1386
287 Ga0466966_0082034 3300044684 Bacteria 2007
288 Ga0466961_0213404 3300044693 Bacteria 1191
289 Ga0466963_0235375 3300044694 Bacteria 1284
290 Ga0466957_0025693 3300044842 Bacteria 3492
291 Ga0466959_0104437 3300045049 Bacteria 2027
292 Ga0466959_0214765 3300045049 Bacteria 1336
293 Ga0466967_0061760 3300045976 Bacteria 3325
294 Ga0495603_0005525 3300046455 Bacteria 7543
295 Ga0495603_0012346 3300046455 Bacteria 5171
296 Ga0495603_0105380 3300046455 Bacteria 1645
297 Ga0495590_0048919 3300046457 Bacteria 1475
298 Ga0495629_0271696 3300046459 Bacteria 1164
299 Ga0495638_0163295 3300046460 Bacteria 1283
300 Ga0495580_0038757 3300046472 Bacteria 3412
301 Ga0495580_0104752 3300046472 Bacteria 1966
302 Ga0495664_0073584 3300046477 Bacteria 2043
303 Ga0495594_0129948 3300046499 Bacteria 1426
304 Ga0495596_0075723 3300046500 Bacteria 1307
305 Ga0495606_0010333 3300046507 Bacteria 7762
306 Ga0495606_0031814 3300046507 Bacteria 3663
307 Ga0495606_0127059 3300046507 Bacteria 1519
308 Ga0495608_0014261 3300046511 Bacteria 5514
309 Ga0495618_0066493 3300046514 Bacteria 2291
310 Ga0495630_0045415 3300046517 Bacteria 3283
311 Ga0495631_0091022 3300046518 Bacteria 1313
312 Ga0495631_0109839 3300046518 Bacteria 1186
313 Ga0495632_0043498 3300046519 Bacteria 2244
314 Ga0495632_0092587 3300046519 Bacteria 1431
315 Ga0495644_0040630 3300046523 Bacteria 1753
316 Ga0495586_0146333 3300046535 Bacteria 1328
317 Ga0495622_0011122 3300046557 Bacteria 4154
318 Ga0495622_0060991 3300046557 Bacteria 1747
319 Ga0495633_0068849 3300046558 Bacteria 1652
320 Ga0495656_0001312 3300046615 Bacteria 8094
321 Ga0495625_0229996 3300046660 Bacteria 1211
322 Ga0495635_0007949 3300046663 Bacteria 7410
323 Ga0495635_0029732 3300046663 Bacteria 3800
324 Ga0495599_0040564 3300046678 Bacteria 2923
325 Ga0495623_0083349 3300046679 Bacteria 1975
326 Ga0495624_0034259 3300046690 Bacteria 3285
327 Ga0495600_0015512 3300046809 Bacteria 4817
328 Ga0495581_0080602 3300047315 Bacteria 1884
329 Ga0495581_0093146 3300047315 Bacteria 1749
330 Ga0495604_0159387 3300047317 Bacteria 1596
331 Ga0495674_0300154 3300047319 Bacteria 1312
332 Ga0495675_0067179 3300047444 Bacteria 2265
333 Ga0495673_0019752 3300047469 Bacteria 3371
334 Ga0495684_0011020 3300047471 Bacteria 6991
335 Ga0495684_0054971 3300047471 Bacteria 3036
336 Ga0495602_0053387 3300048088 Bacteria 3580
337 Ga0495602_0062293 3300048088 Bacteria 3236
338 Ga0496100_0041289 3300048903 Bacteria 2940
339 Ga0496100_0051585 3300048903 Bacteria 2671
340 Ga0496101_0067965 3300048904 Bacteria 2604
341 Ga0496101_0273747 3300048904 Bacteria 1318
342 Ga0496102_0029057 3300048905 Bacteria 4943
343 Ga0496102_0048191 3300048905 Bacteria 3874
344 Ga0496104_0189719 3300048907 Bacteria 1966
345 Ga0496105_0000208 3300048908 Bacteria 39305
346 Ga0496106_0001007 3300048909 Bacteria 20622
347 Ga0496106_0001121 3300048909 Bacteria 19807
348 Ga0496106_0095549 3300048909 Bacteria 2299
349 Ga0496107_0044783 3300048910 Bacteria 3182
350 Ga0496107_0080650 3300048910 Bacteria 2373
351 Ga0496108_0000415 3300048911 Bacteria 34866
352 Ga0496108_0062625 3300048911 Bacteria 3132
353 Ga0496108_0312184 3300048911 Bacteria 1370
354 Ga0496109_0061834 3300048912 Bacteria 3424
355 Ga0496109_0298254 3300048912 Bacteria 1519
356 Ga0496110_0021125 3300048913 Bacteria 5503
357 Ga0496111_0005833 3300048914 Bacteria 7941
358 Ga0496112_0000004 3300048915 Bacteria 553294
359 Ga0496112_0012818 3300048915 Bacteria 7716
360 Ga0496112_0026322 3300048915 Bacteria 5595
361 Ga0496112_0037479 3300048915 Bacteria 4732
362 Ga0496112_0044181 3300048915 Bacteria 4365
363 Ga0496112_0241052 3300048915 Bacteria 1761
364 Ga0496113_0042178 3300048916 Bacteria 3370
365 Ga0496113_0075426 3300048916 Bacteria 2574
366 Ga0496114_0132994 3300048917 Bacteria 2149
367 Ga0496115_0029851 3300048918 Bacteria 4287
368 Ga0496115_0049377 3300048918 Bacteria 3368
369 Ga0496115_0159449 3300048918 Bacteria 1864
370 Ga0496115_0299601 3300048918 Bacteria 1317
371 Ga0496115_0390914 3300048918 Bacteria 1130
372 Ga0496117_0091713 3300048920 Bacteria 1953
373 Ga0496118_0006738 3300048921 Bacteria 12512
374 Ga0496119_0030642 3300048922 Bacteria 3622
375 Ga0496119_0056162 3300048922 Bacteria 2386
376 Ga0496120_0027428 3300048923 Bacteria 3502
377 Ga0496121_0005409 3300048924 Bacteria 16397
378 Ga0496121_0014219 3300048924 Bacteria 8466
379 Ga0496121_0018372 3300048924 Bacteria 7055
380 Ga0496121_0026682 3300048924 Bacteria 5431
381 Ga0496121_0029827 3300048924 Bacteria 5028
382 Ga0496121_0094400 3300048924 Bacteria 2327
383 Ga0496124_0052593 3300048927 Bacteria 3459
384 Ga0496124_0181117 3300048927 Bacteria 1621
385 Ga0496125_0000040 3300048928 Bacteria 314478
386 Ga0496125_0001260 3300048928 Bacteria 37764
387 Ga0496125_0023458 3300048928 Bacteria 5694
388 Ga0496126_0005981 3300048929 Bacteria 13673
389 Ga0496126_0006080 3300048929 Bacteria 13539
390 Ga0496126_0008347 3300048929 Bacteria 11179
391 Ga0496126_0049358 3300048929 Bacteria 3842
392 Ga0496126_0083208 3300048929 Bacteria 2825
393 Ga0496126_0114010 3300048929 Bacteria 2352
394 Ga0496126_0135884 3300048929 Bacteria 2121
395 Ga0496126_0194465 3300048929 Bacteria 1716
396 Ga0496126_0354999 3300048929 Bacteria 1198
397 Ga0496126_0431532 3300048929 Bacteria 1063
398 Ga0501031_0013260 3300049568 Bacteria 5378
399 Ga0501031_0200539 3300049568 Bacteria 1302
400 Ga0501032_0000038 3300049569 Bacteria 115810
401 Ga0501033_0000089 3300049570 Bacteria 86782
402 Ga0501033_0041227 3300049570 Bacteria 3445
403 Ga0501033_0106426 3300049570 Bacteria 2043
404 Ga0501034_0000228 3300049571 Bacteria 106111
405 Ga0501034_0179401 3300049571 Bacteria 2083
406 Ga0501036_0000010 3300049572 Bacteria 163304
407 Ga0501036_0165755 3300049572 Bacteria 1862
408 Ga0501037_0000135 3300049573 Bacteria 68925
409 Ga0501038_0000054 3300049574 Bacteria 94123
410 Ga0501039_0013587 3300049575 Bacteria 6227
411 Ga0501039_0361440 3300049575 Bacteria 1140
412 Ga0501041_0052655 3300049577 Bacteria 2482
413 Ga0501043_0000021 3300049579 Bacteria 155025
414 Ga0501043_0065543 3300049579 Bacteria 2852
415 Ga0501043_0178711 3300049579 Bacteria 1654
416 Ga0501046_0000341 3300049580 Bacteria 47097
417 Ga0501046_0032068 3300049580 Bacteria 4256
418 Ga0501047_0000041 3300049581 Bacteria 184355
419 Ga0501047_0132080 3300049581 Bacteria 2377
420 Ga0501047_0135509 3300049581 Bacteria 2343
421 Ga0501048_0000022 3300049582 Bacteria 68365
422 Ga0501067_0000206 3300049583 Bacteria 33049
423 Ga0501069_0160172 3300049585 Bacteria 1296
424 Ga0501070_0101273 3300049586 Bacteria 2383
425 Ga0501071_0057194 3300049587 Bacteria 2818
426 Ga0501071_0250546 3300049587 Bacteria 1337
427 Ga0501072_0007562 3300049588 Bacteria 8245
428 Ga0501073_0000082 3300049589 Bacteria 59745
429 Ga0501074_0000415 3300049590 Bacteria 25490
430 Ga0501079_0006095 3300049741 Bacteria 9037
431 Ga0501080_0000506 3300049742 Bacteria 30607
432 Ga0501080_0384947 3300049742 Bacteria 1263
433 Ga0501083_0023204 3300049744 Bacteria 4303
434 Ga0501035_0000146 3300049822 Bacteria 86011
435 Ga0501035_0172819 3300049822 Bacteria 1866
436 Ga0501044_0001064 3300049823 Bacteria 32992
437 Ga0501044_0002044 3300049823 Bacteria 23277
438 Ga0501044_0111045 3300049823 Bacteria 2750
439 Ga0501045_0067513 3300049824 Bacteria 2626
440 nmdc:mga0yw44_20422_c1 3300050492 Bacteria 3676
441 nmdc:mga0yw44_243758_c1 3300050492 Bacteria 1195
442 nmdc:mga0yw44_35246_c1 3300050492 Bacteria 2939
443 nmdc:mga0k408_157891_c1 3300050493 Bacteria 1351
444 nmdc:mga06z11_155976_c1 3300050494 Bacteria 1301
445 nmdc:mga07m45_215527_c1 3300050496 Bacteria 1117
446 nmdc:mga08y16_137652_c1 3300050511 Bacteria 2538
447 nmdc:mga0n895_228832_c1 3300050512 Bacteria 1887
448 nmdc:mga0n895_6543_c1 3300050512 Bacteria 9913
449 nmdc:mga0sz30_26893_c1 3300050516 Bacteria 2360
450 Ga0495601_0186288 3300053077 Bacteria 1357
451 Ga0500635_0038327 3300053080 Bacteria 1589
452 Ga0495595_0074248 3300053084 Bacteria 1612
453 Ga0495619_0038800 3300053085 Bacteria 3107
454 Ga0500578_0142492 3300053086 Bacteria 1498
455 Ga0500643_000046 3300053087 Bacteria 150388
456 Ga0500644_0028886 3300053088 Bacteria 1739
457 Ga0500647_0016078 3300053091 Bacteria 3432
458 Ga0500647_0079381 3300053091 Bacteria 1574
459 Ga0500583_0037675 3300053092 Bacteria 2173
460 Ga0500651_0003779 3300053093 Bacteria 8346
461 Ga0500566_0001776 3300053094 Bacteria 12676
462 Ga0500641_0025728 3300053096 Bacteria 2279
463 Ga0500555_012563 3300053103 Bacteria 2438
464 Ga0500556_0000002 3300053104 Bacteria 773626
465 Ga0500557_000020 3300053105 Bacteria 91933
466 Ga0500572_000151 3300053111 Bacteria 24045
467 Ga0500591_040856 3300053115 Bacteria 2208
468 Ga0500595_002109 3300053119 Bacteria 10154
469 Ga0500595_006280 3300053119 Bacteria 5063
470 Ga0500595_015185 3300053119 Bacteria 2894
471 Ga0500608_023013 3300053122 Bacteria 2895
472 Ga0500608_095632 3300053122 Bacteria 1382
473 Ga0500559_0001510 3300053136 Bacteria 13085
474 Ga0500568_0008904 3300053139 Bacteria 4801
475 Ga0500573_0122294 3300053140 Bacteria 1447
476 Ga0500590_075300 3300053148 Bacteria 1669
477 Ga0500590_118112 3300053148 Bacteria 1247
478 Ga0500603_000816 3300053150 Bacteria 7434
479 Ga0500616_0000034 3300053153 Bacteria 396651
480 Ga0500619_049611 3300053154 Bacteria 1354
481 Ga0500630_000657 3300053159 Bacteria 15701
482 Ga0500634_0104618 3300053161 Bacteria 1410
483 Ga0500638_055089 3300053162 Bacteria 1917
484 Ga0500638_107593 3300053162 Bacteria 1292
485 Ga0500639_000002 3300053163 Bacteria 233548
486 Ga0500636_0000436 3300053177 Bacteria 22986
487 Ga0500636_0163531 3300053177 Bacteria 1210
488 Ga0500637_0000328 3300053178 Bacteria 17873
489 Ga0500596_003112 3300053735 Bacteria 3190
490 Ga0500596_008375 3300053735 Bacteria 1651
491 Ga0501084_0001986 3300054114 Bacteria 16326
492 Ga0501082_0016806 3300060353 Bacteria 6301
493 2507507866 2507262055 Bacteria 8048963
494 2513653840 2513237096 Bacteria 8722461
495 2513677685 2513237098 Bacteria 9902361
496 2513695714 2513237101 Bacteria 7952346
497 2513856279 2513237137 Bacteria 9558895
498 2513891454 2513237141 Bacteria 8496279
499 2513918180 2513237145 Bacteria 8979722
500 2514009631 2513237161 Bacteria 8871253
501 2517103940 2517093001 Bacteria 9002274
502 2517891582 2517572143 Bacteria 9484767
503 2524463546 2524023210 Bacteria 9029266
504 2524538656 2524023228 Bacteria 10118060
505 2617372509 2617270741 Bacteria 8201522
506 2671118646 2667528175 Bacteria 7532676
507 2723846961 2721755755 Bacteria 8322773
508 2728749350 2728368998 Bacteria 8720350
509 2793064548 2791355196 Bacteria 7323613
510 2793066942 2791355197 Bacteria 8420563
511 2824608722 2824600985 Bacteria 8488197
512 2824613524 2824609381 Bacteria 8672835
513 2824622854 2824617872 Bacteria 8814715
514 2824631995 2824626560 Bacteria 8813858
515 2824638574 2824635225 Bacteria 8785348
516 2824647720 2824644064 Bacteria 8743947
517 2824659331 2824653114 Bacteria 8493680
518 2824675006 2824671348 Bacteria 8369588
519 2824681476 2824679649 Bacteria 8248951
520 2824693371 2824687955 Bacteria 8360029
521 2824716228 2824714736 Bacteria 8717648
522 2824726804 2824723954 Bacteria 8758240
523 2824777345 2824773399 Bacteria 8360218
524 2838122862 2838122688 Bacteria 8803140
525 2841944850 2841941048 Bacteria 8688029
526 2841950875 2841949485 Bacteria 8680857
527 2841959901 2841957949 Bacteria 8652217
528 2841973673 2841966195 Bacteria 8673214
529 2841978568 2841974524 Bacteria 8931498
530 2841988930 2841983080 Bacteria 8395090
531 2849078586 2849076700 Bacteria 7039503
532 2874611074 2874604998 Bacteria 7834745
533 2876817269 2876808645 Bacteria 8824342
534 2879114509 2879110137 Bacteria 8907982
535 2879148435 2879142872 Bacteria 8267021
536 2881364743 2881364244 Bacteria 7710352
537 2883577594 2883577096 Bacteria 4709178
538 2885381643 2885374607 Bacteria 8927485
539 2885409823 2885409591 Bacteria 9235467
540 2888425402 2888419890 Bacteria 7857137
541 2889038228 2889033259 Bacteria 9099371
542 2903755238 2903748898 Bacteria 9972761
543 2903772889 2903768456 Bacteria 9749579
544 2904694433 2904690495 Bacteria 9412302
545 2904704699
546 2906616756
547 2906640165 2906635258 Bacteria 8601019
548 2906646931 2906643746 Bacteria 8722424
549 2906667085 2906660503 Bacteria 8595048
550 2908741929 2908739725 Bacteria 8628932
551 2908759622 2908756301 Bacteria 8864324
552 2922362653 2922361189 Bacteria 7436256
553 2922387533 2922386360 Bacteria 7017218
554 2922397272 2922393267 Bacteria 8285685
555 2922431184
556 2929620450 2929615660 Bacteria 9193770
557 2929626343 2929624759 Bacteria 9339455
558 2933582368 2933577622 Bacteria 9116884
559 2935633812 2935630451 Bacteria 8169952
560 2941510885 2941507105 Bacteria 8166816
561 2941518269 2941515067 Bacteria 8166720
562 2941526860 2941523033 Bacteria 8169134
563 3005481001 3005474847 Bacteria 9259049
564 3005587255 3005587118 Bacteria 7794411
565 3005600041 3005594810 Bacteria 8716512
566 3005722964 3005718088 Bacteria 8283608
567 8006939703 8006933436 Bacteria 10410654
568 8006968467 8006964411 Bacteria 8966052
569 8006979452 8006973647 Bacteria 10679141
570 8006987402 8006984368 Bacteria 9651211
571 8006994905 8006994254 Bacteria 8309700
572 8019565598 8019555841 Bacteria 9642137
573 8019575692 8019565922 Bacteria 9639779
574 8019661399 8019659431 Bacteria 8577854
575 8055745312 8055742211 Bacteria 9226248
576 8056679475 8056673599 Bacteria 7871253
577 8056684995 8056681323 Bacteria 8472857
578 8056693457 8056689827 Bacteria 6712655
579 Ga0105238_10250765
580 JGI25406J46586_10000021
581 JGI25406J46586_10016723
582 JGI25160J50197_1006462
583 JGI25404J52841_10023995
584 Ga0065165_1001283
585 Ga0070658_10443915
586 Ga0070683_100020392
587 Ga0070683_100091955
588 Ga0070683_100142442
589 Ga0070680_100062296
590 Ga0070680_100066425
591 Ga0070680_100106009
592 Ga0070682_100018684
593 Ga0070660_100016099
594 Ga0070660_100188978
595 Ga0070674_100052465
596 Ga0070709_10017401
597 Ga0070714_100008845
598 Ga0070714_100011360
599 Ga0070714_100088105
600 Ga0070714_100219322
601 Ga0070713_100003607
602 Ga0070713_100007249
603 Ga0070713_100112787
604 Ga0070713_100121064
605 Ga0070710_10000708
606 Ga0070710_10003983
607 Ga0070710_10007420
608 Ga0070711_100010293
609 Ga0070711_100067656
610 Ga0070711_100070979
611 Ga0070708_100092186
612 Ga0070663_100053860
613 Ga0070663_100253703
614 Ga0070678_100179583
615 Ga0070681_10145484
616 Ga0068867_100026289
617 Ga0070706_100060174
618 Ga0070707_100106031
619 Ga0070698_100163268
620 Ga0070679_100043461
621 Ga0070679_100055274
622 Ga0070679_100222919
623 Ga0070679_100379164
624 Ga0070684_100011602
625 Ga0068853_100055695
626 Ga0068853_100227659
627 Ga0070665_100386310
628 Ga0068855_100109884
629 Ga0068855_100125665
630 Ga0068855_100259195
631 Ga0068855_100357908
632 Ga0068854_100156385
633 Ga0068856_100023694
634 Ga0068852_100109398
635 Ga0068864_100352679
636 Ga0068866_10053236
637 Ga0068861_100252161
638 Ga0068851_10017694
639 Ga0068863_100281933
640 Ga0068858_100160769
641 Ga0068858_100242536
642 Ga0068860_100000471
643 Ga0068862_100058558
644 Ga0081455_10069621
645 Ga0081455_10119730
646 Ga0081455_10160945
647 Ga0081540_1004707
648 Ga0081540_1005778
649 Ga0081540_1016036
650 Ga0081540_1023016
651 Ga0081540_1089534
652 Ga0081539_10000051
653 Ga0081539_10000148
654 Ga0081539_10009620
655 Ga0081539_10027637
656 Ga0070717_10000402
657 Ga0070717_10077668
658 Ga0075365_10089588
659 Ga0075363_100063425
660 Ga0075363_100139562
661 Ga0075364_10045080
662 Ga0070715_10045714
663 Ga0070716_100006048
664 Ga0070716_100101461
665 Ga0070716_100112940
666 Ga0070712_100008186
667 Ga0070712_100037180
668 Ga0075362_10078256
669 Ga0075367_10057509
670 Ga0075369_10024782
671 Ga0075370_10032834
672 Ga0075434_100024593
673 Ga0075434_100122913
674 Ga0099824_1031084
675 Ga0099822_1001873
676 Ga0075435_100021468
677 Ga0099794_10125561
678 Ga0105240_10177078
679 Ga0105240_10436842
680 Ga0105247_10005426
681 Ga0105241_10508225
682 Ga0105248_10101265
683 Ga0105237_10056507
684 Ga0105237_10136799
685 Ga0105238_10024830
686 Ga0105238_10250583
687 Ga0105239_10043806
688 Ga0157335_1000871
689 Ga0157370_10043441
690 Ga0157370_10148417
691 Ga0157369_10011746
692 Ga0157369_10024696
693 Ga0157369_10466917
694 Ga0157374_10034436
695 Ga0157374_10100276
696 Ga0157378_10025057
697 Ga0163162_10417115
698 Ga0157372_10428630
699 Ga0157375_10164872
700 Ga0163163_10581492
701 Ga0213876_10000670
702 Ga0209233_1020676
703 Ga0209564_1000390
704 Ga0209758_1003610
705 Ga0209758_1004758
706 Ga0209758_1007379
707 Ga0209758_1008034
708 Ga0209758_1014022
709 Ga0209758_1038002
710 Ga0207426_1000574
711 Ga0207426_1000837
712 Ga0207692_10007642
713 Ga0207692_10013743
714 Ga0207642_10048609
715 Ga0207710_10008835
716 Ga0207710_10052194
717 Ga0207688_10059228
718 Ga0207680_10153454
719 Ga0207647_10112567
720 Ga0207685_10047408
721 Ga0207699_10040745
722 Ga0207684_10052020
723 Ga0207654_10115909
724 Ga0207707_10007987
725 Ga0207707_10049332
726 Ga0207707_10370869
727 Ga0207695_10062924
728 Ga0207695_10255184
729 Ga0207695_10432675
730 Ga0207671_10089913
731 Ga0207671_10246522
732 Ga0207693_10001058
733 Ga0207693_10002843
734 Ga0207693_10022562
735 Ga0207693_10105736
736 Ga0207693_10152974
737 Ga0207663_10002609
738 Ga0207663_10002786
739 Ga0207663_10115576
740 Ga0207663_10137978
741 Ga0207663_10254420
742 Ga0207660_10019450
743 Ga0207660_10419381
744 Ga0207662_10158406
745 Ga0207657_10013488
746 Ga0207652_10019069
747 Ga0207652_10050398
748 Ga0207652_10412294
749 Ga0207646_10088457
750 Ga0207694_10046849
751 Ga0207687_10174475
752 Ga0207700_10012252
753 Ga0207700_10014889
754 Ga0207700_10044345
755 Ga0207700_10048261
756 Ga0207664_10023663
757 Ga0207664_10025806
758 Ga0207664_10162118
759 Ga0207664_10369767
760 Ga0207644_10218011
761 Ga0207690_10280649
762 Ga0207706_10016927
763 Ga0207669_10059747
764 Ga0207665_10005334
765 Ga0207665_10010410
766 Ga0207665_10100792
767 Ga0207691_10090453
768 Ga0207661_10009413
769 Ga0207667_10045963
770 Ga0207667_10223048
771 Ga0207667_10422432
772 Ga0207668_10056602
773 Ga0207658_10232301
774 Ga0207703_10280566
775 Ga0207639_10061108
776 Ga0207639_10394740
777 Ga0207678_10007212
778 Ga0207678_10085267
779 Ga0207678_10130926
780 Ga0207702_10003237
781 Ga0207641_10479857
782 Ga0207648_10163419
783 Ga0207674_10393525
784 Ga0207674_10547330
785 Ga0207683_10011530
786 Ga0207698_10126059
787 Ga0207698_10300397
788 Ga0209589_1000001
789 Ga0209489_100001
790 Ga0209700_100001
791 Ga0209588_1015010
792 Ga0207428_10088058
793 Ga0268266_10019183
794 Ga0268266_10227592
795 Ga0268265_10120862
796 Ga0268265_10297071
797 Ga0268264_10000048
798 Ga0265323_10027004
799 Ga0265336_10002023
800 Ga0265338_10000034
801 Ga0265328_10037150
802 Ga0265329_10052548
803 Ga0265340_10002448
804 Ga0265339_10019603
805 Ga0265339_10052502
806 Ga0265339_10119678
807 Ga0265316_10175752
808 Ga0307509_10017893
809 Ga0307509_10057532
810 Ga0307509_10074154
811 Ga0307509_10089606
812 Ga0307508_10000003
813 Ga0307508_10158265
814 Ga0265314_10000412
815 Ga0265314_10031282
816 Ga0265314_10169392
817 Ga0307516_10029440
818 Ga0307516_10050482
819 Ga0307516_10079612
820 Ga0307516_10091060
821 Ga0307516_10113310
822 Ga0307413_10006633
823 Ga0307410_10183178
824 Ga0307409_100143463
825 Ga0307416_100194684
826 Ga0307411_10110610
827 Ga0307415_100089816
828 Ga0307507_10030513
829 Ga0307510_10020754
830 Ga0307510_10041569
831 Ga0307510_10150176
832 Ga0315911_1000002
833 Ga0373923_0042435
834 Ga0373936_0050404
835 Ga0373943_0074817
836 Ga0373931_0023120
837 Ga0373935_0091029
838 Ga0373927_0004705
839 Ga0373927_0006809
840 Ga0373927_0030173
841 Ga0373933_0000062
842 Ga0373933_0155585
843 Ga0373947_0053958
844 Ga0373947_0114144
845 Ga0373937_0094825
846 Ga0373937_0113241
847 Ga0373937_0116659
848 Ga0373925_0011279
849 Ga0373925_0046835
850 Ga0373925_0057037
851 Ga0373925_0074965
852 Ga0373925_0334022
853 Ga0395898_0039271
854 Ga0395898_0553571
855 Ga0436364_0043851
856 Ga0436364_0563114
857 Ga0395901_0190471
858 Ga0395901_0195365
859 Ga0436365_1128219
860 Ga0436363_1161902
861 Ga0436363_1526803
862 Ga0436362_1099153
863 Ga0451833_0238202
864 Ga0466969_0097593
865 Ga0466966_0082034
866 Ga0466961_0213404
867 Ga0466963_0235375
868 Ga0466957_0025693
869 Ga0466959_0104437
870 Ga0466959_0214765
871 Ga0466967_0061760
872 Ga0495603_0005525
873 Ga0495603_0012346
874 Ga0495603_0105380
875 Ga0495590_0048919
876 Ga0495629_0271696
877 Ga0495638_0163295
878 Ga0495580_0038757
879 Ga0495580_0104752
880 Ga0495664_0073584
881 Ga0495594_0129948
882 Ga0495596_0075723
883 Ga0495606_0010333
884 Ga0495606_0031814
885 Ga0495606_0127059
886 Ga0495608_0014261
887 Ga0495618_0066493
888 Ga0495630_0045415
889 Ga0495631_0091022
890 Ga0495631_0109839
891 Ga0495632_0043498
892 Ga0495632_0092587
893 Ga0495644_0040630
894 Ga0495586_0146333
895 Ga0495622_0011122
896 Ga0495622_0060991
897 Ga0495633_0068849
898 Ga0495656_0001312
899 Ga0495625_0229996
900 Ga0495635_0007949
901 Ga0495635_0029732
902 Ga0495599_0040564
903 Ga0495623_0083349
904 Ga0495624_0034259
905 Ga0495600_0015512
906 Ga0495581_0080602
907 Ga0495581_0093146
908 Ga0495604_0159387
909 Ga0495674_0300154
910 Ga0495675_0067179
911 Ga0495673_0019752
912 Ga0495684_0011020
913 Ga0495684_0054971
914 Ga0495602_0053387
915 Ga0495602_0062293
916 Ga0496100_0041289
917 Ga0496100_0051585
918 Ga0496101_0067965
919 Ga0496101_0273747
920 Ga0496102_0029057
921 Ga0496102_0048191
922 Ga0496104_0189719
923 Ga0496105_0000208
924 Ga0496106_0001007
925 Ga0496106_0001121
926 Ga0496106_0095549
927 Ga0496107_0044783
928 Ga0496107_0080650
929 Ga0496108_0000415
930 Ga0496108_0062625
931 Ga0496108_0312184
932 Ga0496109_0061834
933 Ga0496109_0298254
934 Ga0496110_0021125
935 Ga0496111_0005833
936 Ga0496112_0000004
937 Ga0496112_0012818
938 Ga0496112_0026322
939 Ga0496112_0037479
940 Ga0496112_0044181
941 Ga0496112_0241052
942 Ga0496113_0042178
943 Ga0496113_0075426
944 Ga0496114_0132994
945 Ga0496115_0029851
946 Ga0496115_0049377
947 Ga0496115_0159449
948 Ga0496115_0299601
949 Ga0496115_0390914
950 Ga0496117_0091713
951 Ga0496118_0006738
952 Ga0496119_0030642
953 Ga0496119_0056162
954 Ga0496120_0027428
955 Ga0496121_0005409
956 Ga0496121_0014219
957 Ga0496121_0018372
958 Ga0496121_0026682
959 Ga0496121_0029827
960 Ga0496121_0094400
961 Ga0496124_0052593
962 Ga0496124_0181117
963 Ga0496125_0000040
964 Ga0496125_0001260
965 Ga0496125_0023458
966 Ga0496126_0005981
967 Ga0496126_0006080
968 Ga0496126_0008347
969 Ga0496126_0049358
970 Ga0496126_0083208
971 Ga0496126_0114010
972 Ga0496126_0135884
973 Ga0496126_0194465
974 Ga0496126_0354999
975 Ga0496126_0431532
976 Ga0501031_0013260
977 Ga0501031_0200539
978 Ga0501032_0000038
979 Ga0501033_0000089
980 Ga0501033_0041227
981 Ga0501033_0106426
982 Ga0501034_0000228
983 Ga0501034_0179401
984 Ga0501036_0000010
985 Ga0501036_0165755
986 Ga0501037_0000135
987 Ga0501038_0000054
988 Ga0501039_0013587
989 Ga0501039_0361440
990 Ga0501041_0052655
991 Ga0501043_0000021
992 Ga0501043_0065543
993 Ga0501043_0178711
994 Ga0501046_0000341
995 Ga0501046_0032068
996 Ga0501047_0000041
997 Ga0501047_0132080
998 Ga0501047_0135509
999 Ga0501048_0000022
1000 Ga0501067_0000206
1001 Ga0501069_0160172
1002 Ga0501070_0101273
1003 Ga0501071_0057194
1004 Ga0501071_0250546
1005 Ga0501072_0007562
1006 Ga0501073_0000082
1007 Ga0501074_0000415
1008 Ga0501079_0006095
1009 Ga0501080_0000506
1010 Ga0501080_0384947
1011 Ga0501083_0023204
1012 Ga0501035_0000146
1013 Ga0501035_0172819
1014 Ga0501044_0001064
1015 Ga0501044_0002044
1016 Ga0501044_0111045
1017 Ga0501045_0067513
1018 nmdc:mga0yw44_20422_c1
1019 nmdc:mga0yw44_243758_c1
1020 nmdc:mga0yw44_35246_c1
1021 nmdc:mga0k408_157891_c1
1022 nmdc:mga06z11_155976_c1
1023 nmdc:mga07m45_215527_c1
1024 nmdc:mga08y16_137652_c1
1025 nmdc:mga0n895_228832_c1
1026 nmdc:mga0n895_6543_c1
1027 nmdc:mga0sz30_26893_c1
1028 Ga0495601_0186288
1029 Ga0500635_0038327
1030 Ga0495595_0074248
1031 Ga0495619_0038800
1032 Ga0500578_0142492
1033 Ga0500643_000046
1034 Ga0500644_0028886
1035 Ga0500647_0016078
1036 Ga0500647_0079381
1037 Ga0500583_0037675
1038 Ga0500651_0003779
1039 Ga0500566_0001776
1040 Ga0500641_0025728
1041 Ga0500555_012563
1042 Ga0500556_0000002
1043 Ga0500557_000020
1044 Ga0500572_000151
1045 Ga0500591_040856
1046 Ga0500595_002109
1047 Ga0500595_006280
1048 Ga0500595_015185
1049 Ga0500608_023013
1050 Ga0500608_095632
1051 Ga0500559_0001510
1052 Ga0500568_0008904
1053 Ga0500573_0122294
1054 Ga0500590_075300
1055 Ga0500590_118112
1056 Ga0500603_000816
1057 Ga0500616_0000034
1058 Ga0500619_049611
1059 Ga0500630_000657
1060 Ga0500634_0104618
1061 Ga0500638_055089
1062 Ga0500638_107593
1063 Ga0500639_000002
1064 Ga0500636_0000436
1065 Ga0500636_0163531
1066 Ga0500637_0000328
1067 Ga0500596_003112
1068 Ga0500596_008375
1069 Ga0501084_0001986
1070 Ga0501082_0016806
1071 2507507866
1072 2513653840
1073 2513677685
1074 2513695714
1075 2513856279
1076 2513891454
1077 2513918180
1078 2514009631
1079 2517103940
1080 2517891582
1081 2524463546
1082 2524538656
1083 2617372509
1084 2671118646
1085 2723846961
1086 2728749350
1087 2793064548
1088 2793066942
1089 2824608722
1090 2824613524
1091 2824622854
1092 2824631995
1093 2824638574
1094 2824647720
1095 2824659331
1096 2824675006
1097 2824681476
1098 2824693371
1099 2824716228
1100 2824726804
1101 2824777345
1102 2838122862
1103 2841944850
1104 2841950875
1105 2841959901
1106 2841973673
1107 2841978568
1108 2841988930
1109 2849078586
1110 2874611074
1111 2876817269
1112 2879114509
1113 2879148435
1114 2881364743
1115 2883577594
1116 2885381643
1117 2885409823
1118 2888425402
1119 2889038228
1120 2903755238
1121 2903772889
1122 2904694433
1123 2904704699
1124 2906616756
1125 2906640165
1126 2906646931
1127 2906667085
1128 2908741929
1129 2908759622
1130 2922362653
1131 2922387533
1132 2922397272
1133 2922431184
1134 2929620450
1135 2929626343
1136 2933582368
1137 2935633812
1138 2941510885
1139 2941518269
1140 2941526860
1141 3005481001
1142 3005587255
1143 3005600041
1144 3005722964
1145 8006939703
1146 8006968467
1147 8006979452
1148 8006987402
1149 8006994905
1150 8019565598
1151 8019575692
1152 8019661399
1153 8055745312
1154 8056679475
1155 8056684995
1156 8056693457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

177

308

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

350

0.85

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

136

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9096 2 324
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9042 2 324
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8984 1 323
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.8922 2 323
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8911 1 324
ID Description Score Start End Superfamily
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 128 237 3.40.50.720
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9135 1 324 3.90.180.10
af_A0A1D6HNQ2_3_340_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9108 1 324 3.90.180.10
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9092 1 323 3.90.180.10
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.904 126 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9365 121 235 GO:0016491
AF-A0A4U9HK34-F1-model_v4 Quinone oxidoreductase 1 (EC 1.6.5.5) 0.9287 67 235 GO:0003960
GO:0070402
AF-A0A522TED3-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9214 1 324 GO:0016651
GO:0070402
AF-A0A355F2Z3-F1-model_v4 NAD(P)H quinone oxidoreductase, PIG3 family protein 0.9197 16 324 GO:0016651
GO:0070402
AF-A0A0A0BYB4-F1-model_v4 NADPH:quinone oxidoreductase 0.9195 137 324 GO:0016651
GO:0070402

Map