F465727

General Info

Members Datasets Scaffolds Average Seq Length
578 303 578 223

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10562475|Ga0157378_105624752
Length 257
Sequence MARLAPVARPGCIFGSYPLTGRTLRIAGINCKERFVARYTLVVGTRNWSSWSLRPFVALKATAAPHEIIDIRLRQTESPTTREQILKHSPAGKVPVLKIAEGDSTLTVWDSLAICETLAERHPEAGLWPRDAGARAIARSYACEMHSGFPDLRQQLSMNFARKREMPELREETKAQVARILEAWEWALVTYKGEYLFGNLSVADCMYAPVVSRFFTYGVETSERVGDYMDRVMALPAMQEWLSAAEAEVAAGLSETY

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 4.67
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10034217 3300001989 Bacteria 1733
2 JGI24738J21930_10008485 3300002075 Bacteria 2336
3 Ga0070658_10048858 3300005327 Bacteria 3426
4 Ga0070658_10079785 3300005327 Unclassified 2688
5 Ga0070658_10166052 3300005327 Bacteria 1853
6 Ga0070676_10053362 3300005328 Bacteria 2381
7 Ga0070676_10183050 3300005328 Unclassified 1363
8 Ga0070676_10435362 3300005328 Unclassified 919
9 Ga0070683_100044123 3300005329 Bacteria 4110
10 Ga0070690_100000303 3300005330 Bacteria 25376
11 Ga0070670_100027428 3300005331 Bacteria 4899
12 Ga0070670_100332435 3300005331 Unclassified 1333
13 Ga0068869_100047921 3300005334 Bacteria 3088
14 Ga0068869_100078006 3300005334 Bacteria 2466
15 Ga0070666_10002091 3300005335 Bacteria 12135
16 Ga0070666_10014297 3300005335 Bacteria 5053
17 Ga0070666_10039456 3300005335 Bacteria 3148
18 Ga0070666_10041710 3300005335 Unclassified 3068
19 Ga0070666_10143456 3300005335 Unclassified 1664
20 Ga0070680_100000248 3300005336 Bacteria 35598
21 Ga0070680_100052690 3300005336 Bacteria 3320
22 Ga0070680_100190303 3300005336 Bacteria 1729
23 Ga0070682_100081450 3300005337 Bacteria 2096
24 Ga0070682_100498037 3300005337 Unclassified 943
25 Ga0068868_100258498 3300005338 Bacteria 1468
26 Ga0070660_100044609 3300005339 Bacteria 3392
27 Ga0070660_100077666 3300005339 Unclassified 2602
28 Ga0070660_100729802 3300005339 Unclassified 831
29 Ga0070689_100021918 3300005340 Bacteria 4762
30 Ga0070691_10001279 3300005341 Bacteria 10635
31 Ga0070691_10001501 3300005341 Bacteria 10014
32 Ga0070687_100001187 3300005343 Bacteria 9018
33 Ga0070661_100003828 3300005344 Bacteria 10359
34 Ga0070661_100113578 3300005344 Bacteria 2024
35 Ga0070661_100286005 3300005344 Bacteria 1280
36 Ga0070661_100440953 3300005344 Unclassified 1035
37 Ga0070692_10002001 3300005345 Bacteria 7729
38 Ga0070668_100020364 3300005347 Bacteria 5005
39 Ga0070668_100086002 3300005347 Bacteria 2472
40 Ga0070668_100344443 3300005347 Unclassified 1260
41 Ga0070668_100566660 3300005347 Bacteria 990
42 Ga0070669_100000391 3300005353 Bacteria 33788
43 Ga0070675_100102846 3300005354 Bacteria 2407
44 Ga0070675_100235175 3300005354 Unclassified 1599
45 Ga0070671_100013327 3300005355 Bacteria 6627
46 Ga0070674_100000430 3300005356 Bacteria 21209
47 Ga0070674_100173469 3300005356 Bacteria 1646
48 Ga0070673_100005733 3300005364 Bacteria 7987
49 Ga0070673_100094029 3300005364 Bacteria 2456
50 Ga0070673_100127595 3300005364 Unclassified 2130
51 Ga0070688_100002877 3300005365 Bacteria 8781
52 Ga0070688_100156657 3300005365 Bacteria 1561
53 Ga0070659_100026803 3300005366 Bacteria 4436
54 Ga0070667_100000918 3300005367 Bacteria 27217
55 Ga0070709_10004467 3300005434 Bacteria 7548
56 Ga0070709_10079605 3300005434 Bacteria 2135
57 Ga0070709_10461642 3300005434 Unclassified 958
58 Ga0070714_100007818 3300005435 Bacteria 8330
59 Ga0070714_100052171 3300005435 Bacteria 3488
60 Ga0070714_100236514 3300005435 Bacteria 1685
61 Ga0070713_100000006 3300005436 Bacteria 190565
62 Ga0070713_100046176 3300005436 Bacteria 3573
63 Ga0070713_100334252 3300005436 Bacteria 1402
64 Ga0070710_10044685 3300005437 Bacteria 2459
65 Ga0070710_10427560 3300005437 Unclassified 893
66 Ga0070701_10084637 3300005438 Bacteria 1725
67 Ga0070711_100006358 3300005439 Bacteria 7118
68 Ga0070711_100397648 3300005439 Bacteria 1118
69 Ga0070705_100001203 3300005440 Bacteria 14092
70 Ga0070705_100099530 3300005440 Unclassified 1832
71 Ga0070700_100029758 3300005441 Bacteria 3258
72 Ga0070694_100003505 3300005444 Bacteria 9382
73 Ga0070663_100000890 3300005455 Bacteria 16233
74 Ga0070663_100104446 3300005455 Bacteria 2119
75 Ga0070678_100010621 3300005456 Bacteria 5636
76 Ga0070678_100058667 3300005456 Unclassified 2826
77 Ga0070678_100376014 3300005456 Bacteria 1228
78 Ga0070662_100019029 3300005457 Bacteria 4656
79 Ga0070662_100346012 3300005457 Bacteria 1217
80 Ga0070681_10000002 3300005458 Bacteria 821814
81 Ga0070681_10431389 3300005458 Bacteria 1230
82 Ga0070681_10475245 3300005458 Unclassified 1162
83 Ga0068867_100148322 3300005459 Bacteria 1840
84 Ga0070685_10373744 3300005466 Bacteria 980
85 Ga0070699_100058883 3300005518 Bacteria 3328
86 Ga0070679_100000035 3300005530 Bacteria 103095
87 Ga0070679_100035909 3300005530 Bacteria 4918
88 Ga0070679_100081129 3300005530 Bacteria 3233
89 Ga0070684_100046711 3300005535 Bacteria 3752
90 Ga0070684_100120725 3300005535 Bacteria 2358
91 Ga0070697_100058237 3300005536 Bacteria 3144
92 Ga0068853_100012410 3300005539 Bacteria 6931
93 Ga0070672_100020553 3300005543 Bacteria 4817
94 Ga0070672_100267994 3300005543 Bacteria 1441
95 Ga0070686_100004608 3300005544 Bacteria 7597
96 Ga0070695_100027254 3300005545 Bacteria 3538
97 Ga0070695_100244029 3300005545 Unclassified 1304
98 Ga0070696_100000728 3300005546 Bacteria 21021
99 Ga0070693_100031583 3300005547 Bacteria 2904
100 Ga0070693_100032550 3300005547 Bacteria 2868
101 Ga0070665_100003166 3300005548 Bacteria 17704
102 Ga0070665_100043851 3300005548 Bacteria 4493
103 Ga0070665_100051235 3300005548 Bacteria 4140
104 Ga0070665_100072055 3300005548 Bacteria 3463
105 Ga0070665_100078037 3300005548 Bacteria 3318
106 Ga0070704_100006503 3300005549 Bacteria 6887
107 Ga0068855_100007702 3300005563 Bacteria 13004
108 Ga0068855_100041948 3300005563 Bacteria 5422
109 Ga0068855_100047427 3300005563 Bacteria 5075
110 Ga0068855_100480985 3300005563 Bacteria 1352
111 Ga0070664_100006680 3300005564 Bacteria 9303
112 Ga0068857_100000387 3300005577 Bacteria 30877
113 Ga0068857_100050602 3300005577 Bacteria 3685
114 Ga0068857_100170514 3300005577 Bacteria 1978
115 Ga0068854_100005281 3300005578 Bacteria 8153
116 Ga0068854_100015672 3300005578 Bacteria 5031
117 Ga0068856_100000280 3300005614 Bacteria 55488
118 Ga0068856_100023115 3300005614 Bacteria 6046
119 Ga0068856_100099431 3300005614 Bacteria 2900
120 Ga0068856_100515825 3300005614 Unclassified 1216
121 Ga0070702_100000098 3300005615 Bacteria 25877
122 Ga0070702_100156848 3300005615 Bacteria 1467
123 Ga0070702_100378648 3300005615 Bacteria 1005
124 Ga0068852_100003875 3300005616 Bacteria 10509
125 Ga0068852_101039281 3300005616 Unclassified 838
126 Ga0068859_100012414 3300005617 Bacteria 8571
127 Ga0068859_100408854 3300005617 Unclassified 1453
128 Ga0068859_100448549 3300005617 Bacteria 1386
129 Ga0068864_100024278 3300005618 Bacteria 5099
130 Ga0068864_100437601 3300005618 Unclassified 1248
131 Ga0068866_10065108 3300005718 Bacteria 1906
132 Ga0068861_100021324 3300005719 Bacteria 4656
133 Ga0068861_100135574 3300005719 Bacteria 2003
134 Ga0068861_100183218 3300005719 Bacteria 1745
135 Ga0068851_10059076 3300005834 Bacteria 1961
136 Ga0068863_100005195 3300005841 Bacteria 12845
137 Ga0068863_100012930 3300005841 Bacteria 8050
138 Ga0068858_100020434 3300005842 Bacteria 6191
139 Ga0068858_100059040 3300005842 Bacteria 3545
140 Ga0068858_100247542 3300005842 Bacteria 1693
141 Ga0068860_100006370 3300005843 Bacteria 11848
142 Ga0068860_100136296 3300005843 Bacteria 2357
143 Ga0068862_100624367 3300005844 Bacteria 1037
144 Ga0068862_101225313 3300005844 Bacteria 750
145 Ga0081455_10017063 3300005937 Bacteria 6978
146 Ga0075365_10011457 3300006038 Bacteria 5214
147 Ga0075368_10004349 3300006042 Bacteria 4792
148 Ga0075363_100012071 3300006048 Bacteria 4154
149 Ga0075364_10001704 3300006051 Bacteria 12083
150 Ga0075432_10056968 3300006058 Bacteria 1386
151 Ga0070716_100171947 3300006173 Unclassified 1414
152 Ga0070712_100000184 3300006175 Bacteria 34651
153 Ga0070712_100001132 3300006175 Bacteria 16067
154 Ga0075367_10022463 3300006178 Bacteria 3538
155 Ga0075367_10070785 3300006178 Bacteria 2097
156 Ga0097621_100000267 3300006237 Bacteria 35345
157 Ga0097621_100052369 3300006237 Bacteria 3325
158 Ga0097621_100101455 3300006237 Bacteria 2421
159 Ga0097621_100105690 3300006237 Bacteria 2374
160 Ga0097621_100173868 3300006237 Unclassified 1858
161 Ga0097621_100174686 3300006237 Bacteria 1854
162 Ga0068871_100001741 3300006358 Bacteria 14665
163 Ga0068871_100228595 3300006358 Unclassified 1614
164 Ga0075428_100620035 3300006844 Unclassified 1155
165 Ga0075430_100236159 3300006846 Bacteria 1515
166 Ga0075431_100024570 3300006847 Bacteria 6176
167 Ga0075431_100574997 3300006847 Bacteria 1113
168 Ga0075433_10139544 3300006852 Bacteria 2154
169 Ga0075434_100069525 3300006871 Bacteria 3510
170 Ga0075429_100207694 3300006880 Bacteria 1716
171 Ga0075429_100499174 3300006880 Bacteria 1066
172 Ga0068865_100024141 3300006881 Bacteria 3986
173 Ga0068865_100224322 3300006881 Unclassified 1471
174 Ga0075436_100001960 3300006914 Bacteria 14189
175 Ga0075436_100054680 3300006914 Bacteria 2756
176 Ga0075436_100061914 3300006914 Bacteria 2586
177 Ga0097620_100012416 3300006931 Bacteria 8571
178 Ga0097620_100408867 3300006931 Unclassified 1453
179 Ga0097620_100448533 3300006931 Bacteria 1386
180 Ga0075435_100162931 3300007076 Bacteria 1879
181 Ga0105251_10033581 3300009011 Bacteria 2545
182 Ga0105250_10104762 3300009092 Unclassified 1156
183 Ga0105240_10003264 3300009093 Bacteria 25361
184 Ga0105240_10054893 3300009093 Bacteria 4990
185 Ga0105240_10078368 3300009093 Bacteria 4069
186 Ga0105240_10123169 3300009093 Bacteria 3120
187 Ga0105240_10320643 3300009093 Bacteria 1766
188 Ga0105240_10763421 3300009093 Unclassified 1050
189 Ga0111539_10560083 3300009094 Bacteria 1331
190 Ga0111539_11595329 3300009094 Bacteria 757
191 Ga0105245_10019574 3300009098 Bacteria 5929
192 Ga0105245_10019845 3300009098 Bacteria 5891
193 Ga0105245_10044899 3300009098 Unclassified 3945
194 Ga0105245_10125755 3300009098 Bacteria 2400
195 Ga0105245_10611383 3300009098 Bacteria 1117
196 Ga0105247_10012277 3300009101 Bacteria 5146
197 Ga0114129_10038332 3300009147 Bacteria 6762
198 Ga0105243_10006802 3300009148 Bacteria 8818
199 Ga0105243_10028300 3300009148 Bacteria 4301
200 Ga0105243_10519514 3300009148 Bacteria 1132
201 Ga0105241_10002894 3300009174 Bacteria 12839
202 Ga0105241_10003267 3300009174 Bacteria 12064
203 Ga0105241_10058685 3300009174 Bacteria 2956
204 Ga0105241_10061391 3300009174 Bacteria 2894
205 Ga0105241_10062657 3300009174 Bacteria 2867
206 Ga0105241_10110217 3300009174 Unclassified 2202
207 Ga0105242_10005740 3300009176 Bacteria 9567
208 Ga0105248_10011402 3300009177 Bacteria 9799
209 Ga0105248_10019596 3300009177 Bacteria 7488
210 Ga0105248_10250001 3300009177 Bacteria 1996
211 Ga0105237_10004528 3300009545 Bacteria 16061
212 Ga0105237_10005625 3300009545 Bacteria 14119
213 Ga0105237_10024196 3300009545 Bacteria 6214
214 Ga0105237_10065074 3300009545 Bacteria 3642
215 Ga0105237_10195748 3300009545 Bacteria 2021
216 Ga0105238_10028649 3300009551 Bacteria 5673
217 Ga0105238_10355952 3300009551 Bacteria 1453
218 Ga0105249_10006469 3300009553 Bacteria 10189
219 Ga0105249_10060208 3300009553 Bacteria 3483
220 Ga0105239_10000540 3300010375 Bacteria 54714
221 Ga0105239_10014435 3300010375 Bacteria 8767
222 Ga0105239_10040642 3300010375 Bacteria 5096
223 Ga0105239_10061226 3300010375 Bacteria 4131
224 Ga0105239_10296970 3300010375 Bacteria 1819
225 Ga0105239_10745316 3300010375 Bacteria 1121
226 Ga0105246_10006915 3300011119 Bacteria 6942
227 Ga0105246_10039845 3300011119 Bacteria 3168
228 Ga0105246_10047597 3300011119 Unclassified 2929
229 Ga0157323_1001688 3300012495 Bacteria 1142
230 Ga0157373_10001321 3300013100 Bacteria 18966
231 Ga0157373_10407621 3300013100 Unclassified 975
232 Ga0157371_10192116 3300013102 Unclassified 1462
233 Ga0157370_10000438 3300013104 Bacteria 51999
234 Ga0157370_10086430 3300013104 Bacteria 2946
235 Ga0157370_10120500 3300013104 Bacteria 2450
236 Ga0157369_10003719 3300013105 Bacteria 18134
237 Ga0157369_10020645 3300013105 Bacteria 7366
238 Ga0157369_10062984 3300013105 Bacteria 3996
239 Ga0157369_10245378 3300013105 Unclassified 1870
240 Ga0157369_10393644 3300013105 Unclassified 1437
241 Ga0157374_10052051 3300013296 Bacteria 3812
242 Ga0157374_10054370 3300013296 Bacteria 3735
243 Ga0157374_10317600 3300013296 Bacteria 1543
244 Ga0157378_10017766 3300013297 Bacteria 6244
245 Ga0157378_10127937 3300013297 Bacteria 2348
246 Ga0157378_10344892 3300013297 Bacteria 1453
247 Ga0157378_10562475 3300013297 Unclassified 1147
248 Ga0163162_10002450 3300013306 Bacteria 17500
249 Ga0163162_10027271 3300013306 Bacteria 5647
250 Ga0163162_10099333 3300013306 Bacteria 3001
251 Ga0163162_10722906 3300013306 Unclassified 1116
252 Ga0157372_10000133 3300013307 Bacteria 81875
253 Ga0157372_10036446 3300013307 Bacteria 5420
254 Ga0157372_10097370 3300013307 Bacteria 3355
255 Ga0157375_10185254 3300013308 Bacteria 2235
256 Ga0157375_10594043 3300013308 Bacteria 1267
257 Ga0163163_10183792 3300014325 Bacteria 2138
258 Ga0163163_10250185 3300014325 Bacteria 1823
259 Ga0163163_10445931 3300014325 Unclassified 1354
260 Ga0163163_10653341 3300014325 Unclassified 1115
261 Ga0157380_10001318 3300014326 Bacteria 16106
262 Ga0157380_10093665 3300014326 Unclassified 2484
263 Ga0157377_10004069 3300014745 Bacteria 6673
264 Ga0157379_10002828 3300014968 Bacteria 14629
265 Ga0157379_10026293 3300014968 Bacteria 5181
266 Ga0157379_11005923 3300014968 Unclassified 795
267 Ga0182007_10036081 3300015262 Bacteria 1664
268 Ga0163161_10001599 3300017792 Bacteria 16703
269 Ga0163161_10005012 3300017792 Bacteria 9215
270 Ga0163161_10080282 3300017792 Bacteria 2400
271 Ga0213874_10002204 3300021377 Bacteria 4141
272 Ga0209233_1000006 3300025261 Bacteria 1473685
273 Ga0209233_1001131 3300025261 Bacteria 10884
274 Ga0207692_10018036 3300025898 Bacteria 3160
275 Ga0207642_10021956 3300025899 Bacteria 2523
276 Ga0207710_10002160 3300025900 Bacteria 9241
277 Ga0207710_10019905 3300025900 Bacteria 2865
278 Ga0207688_10002567 3300025901 Bacteria 9826
279 Ga0207680_10040977 3300025903 Bacteria 2699
280 Ga0207680_10083358 3300025903 Bacteria 2015
281 Ga0207685_10001101 3300025905 Bacteria 5355
282 Ga0207699_10001108 3300025906 Bacteria 12731
283 Ga0207699_10002019 3300025906 Bacteria 9585
284 Ga0207699_10253057 3300025906 Bacteria 1215
285 Ga0207645_10036296 3300025907 Bacteria 3165
286 Ga0207645_10056556 3300025907 Bacteria 2504
287 Ga0207705_10020038 3300025909 Bacteria 4782
288 Ga0207705_10073109 3300025909 Bacteria 2487
289 Ga0207654_10004909 3300025911 Bacteria 6772
290 Ga0207654_10034260 3300025911 Bacteria 2820
291 Ga0207654_10038844 3300025911 Bacteria 2673
292 Ga0207654_10051134 3300025911 Bacteria 2377
293 Ga0207654_10315095 3300025911 Bacteria 1068
294 Ga0207707_10000002 3300025912 Bacteria 1142054
295 Ga0207707_10029312 3300025912 Bacteria 4811
296 Ga0207707_10090588 3300025912 Bacteria 2673
297 Ga0207707_10359464 3300025912 Unclassified 1254
298 Ga0207695_10034041 3300025913 Bacteria 5547
299 Ga0207695_10070019 3300025913 Bacteria 3588
300 Ga0207695_10070852 3300025913 Bacteria 3562
301 Ga0207695_10218241 3300025913 Bacteria 1815
302 Ga0207695_10242771 3300025913 Unclassified 1702
303 Ga0207695_10342769 3300025913 Bacteria 1382
304 Ga0207695_10545755 3300025913 Bacteria 1041
305 Ga0207671_10004743 3300025914 Bacteria 12828
306 Ga0207671_10032772 3300025914 Bacteria 3866
307 Ga0207671_10134415 3300025914 Bacteria 1901
308 Ga0207693_10000062 3300025915 Bacteria 92689
309 Ga0207693_10000733 3300025915 Bacteria 29584
310 Ga0207663_10000652 3300025916 Bacteria 15374
311 Ga0207660_10000240 3300025917 Bacteria 35551
312 Ga0207660_10151309 3300025917 Bacteria 1783
313 Ga0207660_10428927 3300025917 Unclassified 1067
314 Ga0207660_10711211 3300025917 Bacteria 819
315 Ga0207662_10005248 3300025918 Bacteria 6879
316 Ga0207657_10000023 3300025919 Bacteria 152701
317 Ga0207657_10080025 3300025919 Bacteria 2748
318 Ga0207657_10204835 3300025919 Unclassified 1585
319 Ga0207649_10086074 3300025920 Bacteria 2047
320 Ga0207649_10663318 3300025920 Bacteria 807
321 Ga0207652_10000932 3300025921 Bacteria 27504
322 Ga0207652_10067029 3300025921 Bacteria 3112
323 Ga0207694_10070369 3300025924 Bacteria 2733
324 Ga0207694_10074161 3300025924 Bacteria 2663
325 Ga0207694_10239882 3300025924 Bacteria 1481
326 Ga0207694_10561868 3300025924 Unclassified 958
327 Ga0207650_10102919 3300025925 Bacteria 2201
328 Ga0207650_10129833 3300025925 Bacteria 1971
329 Ga0207659_10116423 3300025926 Bacteria 2041
330 Ga0207659_10186751 3300025926 Unclassified 1646
331 Ga0207687_10032497 3300025927 Unclassified 3534
332 Ga0207687_10580846 3300025927 Unclassified 943
333 Ga0207700_10000020 3300025928 Bacteria 176182
334 Ga0207700_10273052 3300025928 Bacteria 1452
335 Ga0207664_10044073 3300025929 Bacteria 3492
336 Ga0207664_10479792 3300025929 Unclassified 1112
337 Ga0207644_10022454 3300025931 Bacteria 4311
338 Ga0207690_10003754 3300025932 Bacteria 9005
339 Ga0207706_10000019 3300025933 Bacteria 167592
340 Ga0207706_10073444 3300025933 Bacteria 3008
341 Ga0207706_10336835 3300025933 Bacteria 1312
342 Ga0207709_10030603 3300025935 Bacteria 3133
343 Ga0207709_10057368 3300025935 Bacteria 2414
344 Ga0207670_10011387 3300025936 Bacteria 5161
345 Ga0207669_10015302 3300025937 Bacteria 3866
346 Ga0207669_10387811 3300025937 Unclassified 1090
347 Ga0207704_10075725 3300025938 Bacteria 2153
348 Ga0207704_10143532 3300025938 Bacteria 1674
349 Ga0207665_10000205 3300025939 Bacteria 39821
350 Ga0207691_10003337 3300025940 Bacteria 15626
351 Ga0207691_10135389 3300025940 Bacteria 2173
352 Ga0207711_10012312 3300025941 Bacteria 7110
353 Ga0207711_10017832 3300025941 Bacteria 5898
354 Ga0207711_10270665 3300025941 Unclassified 1563
355 Ga0207689_10069797 3300025942 Bacteria 2887
356 Ga0207689_10093276 3300025942 Bacteria 2473
357 Ga0207689_10496181 3300025942 Unclassified 1023
358 Ga0207679_10063991 3300025945 Bacteria 2747
359 Ga0207667_10029859 3300025949 Bacteria 5906
360 Ga0207667_10168195 3300025949 Bacteria 2253
361 Ga0207667_10251138 3300025949 Bacteria 1809
362 Ga0207667_10456050 3300025949 Bacteria 1299
363 Ga0207651_10002795 3300025960 Bacteria 8389
364 Ga0207651_10003035 3300025960 Bacteria 8143
365 Ga0207651_10073042 3300025960 Bacteria 2438
366 Ga0207712_10006286 3300025961 Bacteria 7493
367 Ga0207668_10172976 3300025972 Unclassified 1696
368 Ga0207668_10338369 3300025972 Bacteria 1254
369 Ga0207668_10616449 3300025972 Unclassified 946
370 Ga0207640_10020303 3300025981 Bacteria 3943
371 Ga0207658_10024089 3300025986 Bacteria 4254
372 Ga0207658_10182857 3300025986 Unclassified 1736
373 Ga0207703_10032181 3300026035 Bacteria 4150
374 Ga0207703_10094549 3300026035 Bacteria 2520
375 Ga0207639_10012778 3300026041 Bacteria 5858
376 Ga0207639_10089612 3300026041 Bacteria 2458
377 Ga0207639_10229287 3300026041 Bacteria 1609
378 Ga0207678_10000017 3300026067 Bacteria 135871
379 Ga0207678_10121592 3300026067 Bacteria 2228
380 Ga0207708_10001248 3300026075 Bacteria 19171
381 Ga0207708_10087743 3300026075 Bacteria 2396
382 Ga0207708_10265840 3300026075 Bacteria 1385
383 Ga0207702_10000030 3300026078 Bacteria 178718
384 Ga0207702_10082123 3300026078 Bacteria 2801
385 Ga0207702_10082741 3300026078 Bacteria 2791
386 Ga0207702_10206284 3300026078 Bacteria 1825
387 Ga0207702_10927241 3300026078 Unclassified 863
388 Ga0207641_10024899 3300026088 Bacteria 4934
389 Ga0207641_10065083 3300026088 Bacteria 3117
390 Ga0207648_10005670 3300026089 Bacteria 12530
391 Ga0207648_10020996 3300026089 Bacteria 5878
392 Ga0207676_10558598 3300026095 Unclassified 1094
393 Ga0207676_10798195 3300026095 Unclassified 921
394 Ga0207674_10000051 3300026116 Bacteria 116114
395 Ga0207674_10000437 3300026116 Bacteria 53986
396 Ga0207674_10586746 3300026116 Bacteria 1077
397 Ga0207674_10610376 3300026116 Bacteria 1054
398 Ga0207675_100000771 3300026118 Bacteria 31947
399 Ga0207675_100047992 3300026118 Bacteria 3985
400 Ga0207675_100434024 3300026118 Bacteria 1299
401 Ga0207683_10000030 3300026121 Bacteria 109087
402 Ga0207683_10080314 3300026121 Unclassified 2893
403 Ga0207683_10093555 3300026121 Bacteria 2679
404 Ga0207698_10017660 3300026142 Bacteria 4847
405 Ga0207698_10758090 3300026142 Bacteria 970
406 Ga0207698_11114775 3300026142 Unclassified 802
407 Ga0209971_1071306 3300027682 Bacteria 843
408 Ga0268266_10000510 3300028379 Bacteria 54868
409 Ga0268266_10006504 3300028379 Bacteria 10691
410 Ga0268266_10024833 3300028379 Bacteria 5100
411 Ga0268266_10134166 3300028379 Bacteria 2216
412 Ga0268266_10353521 3300028379 Bacteria 1381
413 Ga0268265_10026606 3300028380 Bacteria 4118
414 Ga0268265_10327024 3300028380 Unclassified 1391
415 Ga0268265_10625678 3300028380 Bacteria 1032
416 Ga0268264_10566345 3300028381 Unclassified 1116
417 Ga0265318_10000149 3300028577 Bacteria 63245
418 Ga0307517_10289841 3300028786 Bacteria 926
419 Ga0265338_10000649 3300028800 Bacteria 60084
420 Ga0265338_10028088 3300028800 Bacteria 5622
421 Ga0265340_10057376 3300031247 Bacteria 1871
422 Ga0265331_10017810 3300031250 Bacteria 3697
423 Ga0265316_10037907 3300031344 Unclassified 3887
424 Ga0265313_10074336 3300031595 Bacteria 1558
425 Ga0265314_10010341 3300031711 Bacteria 7792
426 Ga0265314_10044216 3300031711 Unclassified 3159
427 Ga0265342_10008930 3300031712 Bacteria 7121
428 Ga0373930_0026235 3300034816 Unclassified 1174
429 Ga0373948_0065358 3300034817 Unclassified 806
430 Ga0373928_0021642 3300035084 Bacteria 1358
431 Ga0373949_0028250 3300035090 Unclassified 1323
432 Ga0373941_0058749 3300035115 Bacteria 1245
433 Ga0373946_0062175 3300035171 Bacteria 1592
434 Ga0373931_0118574 3300035691 Bacteria 1510
435 Ga0373931_0426098 3300035691 Bacteria 844
436 Ga0373935_0029448 3300035692 Bacteria 3399
437 Ga0373927_0014041 3300035695 Bacteria 5309
438 Ga0373947_0003079 3300035725 Bacteria 9934
439 Ga0373925_0003993 3300037068 Bacteria 11228
440 Ga0395900_0010214 3300037418 Bacteria 9601
441 Ga0395898_0014512 3300037466 Bacteria 8090
442 Ga0395905_0483387 3300037471 Bacteria 1138
443 Ga0395901_0004946 3300038443 Bacteria 13449
444 Ga0242420_011176 3300038996 Unclassified 1502
445 Ga0436361_0680656 3300039447 Bacteria 1671
446 Ga0436363_0038000 3300039450 Bacteria 4223
447 Ga0466963_0667134 3300044694 Bacteria 734
448 Ga0466957_0135845 3300044842 Bacteria 1580
449 Ga0466959_0302452 3300045049 Bacteria 1095
450 Ga0495603_0000303 3300046455 Bacteria 26268
451 Ga0495629_0017757 3300046459 Bacteria 5099
452 Ga0495641_0078526 3300046461 Bacteria 1479
453 Ga0495580_0002543 3300046472 Bacteria 15890
454 Ga0495582_0004516 3300046473 Bacteria 7823
455 Ga0495639_0032262 3300046475 Bacteria 2335
456 Ga0495594_0005029 3300046499 Bacteria 6802
457 Ga0495606_0228904 3300046507 Unclassified 1043
458 Ga0495620_0167672 3300046515 Bacteria 852
459 Ga0495648_0166759 3300046524 Bacteria 1133
460 Ga0495609_0002340 3300046538 Bacteria 11698
461 Ga0495622_0002377 3300046557 Bacteria 9153
462 Ga0495668_0486776 3300046616 Unclassified 680
463 Ga0495634_0016928 3300046642 Bacteria 5207
464 Ga0495611_0046466 3300046648 Bacteria 1947
465 Ga0495635_0423406 3300046663 Bacteria 882
466 Ga0495588_0027423 3300046674 Bacteria 2846
467 Ga0495658_0005365 3300046683 Bacteria 6306
468 Ga0495613_0004315 3300046689 Bacteria 10645
469 Ga0495676_0287796 3300047321 Bacteria 1111
470 Ga0495676_0381583 3300047321 Bacteria 937
471 Ga0495680_0025863 3300047322 Bacteria 4852
472 Ga0495593_0001092 3300047673 Bacteria 15847
473 Ga0496100_0001066 3300048903 Bacteria 13204
474 Ga0496101_0042695 3300048904 Bacteria 3237
475 Ga0496101_0422920 3300048904 Bacteria 1050
476 Ga0496101_0500236 3300048904 Bacteria 960
477 Ga0496102_0008755 3300048905 Bacteria 8683
478 Ga0496103_0001043 3300048906 Bacteria 19404
479 Ga0496104_0000360 3300048907 Bacteria 40585
480 Ga0496104_0490681 3300048907 Unclassified 1139
481 Ga0496105_0026238 3300048908 Bacteria 4750
482 Ga0496105_0030762 3300048908 Bacteria 4400
483 Ga0496106_0014625 3300048909 Bacteria 5799
484 Ga0496107_0040826 3300048910 Bacteria 3331
485 Ga0496107_0045801 3300048910 Bacteria 3147
486 Ga0496108_0031629 3300048911 Bacteria 4392
487 Ga0496108_0089462 3300048911 Bacteria 2616
488 Ga0496109_0063532 3300048912 Bacteria 3377
489 Ga0496109_0289332 3300048912 Bacteria 1544
490 Ga0496110_0003669 3300048913 Bacteria 11815
491 Ga0496110_0014474 3300048913 Bacteria 6552
492 Ga0496111_0000814 3300048914 Bacteria 16735
493 Ga0496111_0024744 3300048914 Bacteria 4233
494 Ga0496112_0061288 3300048915 Bacteria 3708
495 Ga0496113_0011714 3300048916 Bacteria 5867
496 Ga0496113_0042523 3300048916 Bacteria 3358
497 Ga0496114_0002707 3300048917 Bacteria 13538
498 Ga0496115_0524006 3300048918 Unclassified 950
499 Ga0496115_0690107 3300048918 Unclassified 803
500 Ga0496126_0001104 3300048929 Bacteria 45291
501 Ga0501031_0009797 3300049568 Bacteria 6238
502 Ga0501032_0094437 3300049569 Bacteria 1983
503 Ga0501032_0156769 3300049569 Bacteria 1495
504 Ga0501033_0005487 3300049570 Bacteria 10038
505 Ga0501033_0018695 3300049570 Bacteria 5238
506 Ga0501033_0419781 3300049570 Bacteria 931
507 Ga0501033_0657110 3300049570 Bacteria 716
508 Ga0501034_0037302 3300049571 Bacteria 4921
509 Ga0501036_0270913 3300049572 Bacteria 1421
510 Ga0501038_0020260 3300049574 Bacteria 5983
511 Ga0501038_0102449 3300049574 Bacteria 2382
512 Ga0501039_0002429 3300049575 Bacteria 13867
513 Ga0501039_0150317 3300049575 Bacteria 1830
514 Ga0501040_0025589 3300049576 Bacteria 3968
515 Ga0501041_0005311 3300049577 Bacteria 7534
516 Ga0501042_0033042 3300049578 Bacteria 3666
517 Ga0501043_0067430 3300049579 Bacteria 2810
518 Ga0501043_0095086 3300049579 Bacteria 2342
519 Ga0501043_0217248 3300049579 Bacteria 1480
520 Ga0501046_0038489 3300049580 Bacteria 3838
521 Ga0501046_0178667 3300049580 Bacteria 1588
522 Ga0501046_0798506 3300049580 Bacteria 661
523 Ga0501047_0004930 3300049581 Bacteria 12538
524 Ga0501047_0032205 3300049581 Bacteria 5060
525 Ga0501047_0078011 3300049581 Bacteria 3186
526 Ga0501048_0169010 3300049582 Bacteria 1548
527 Ga0501067_0069612 3300049583 Bacteria 1948
528 Ga0501067_0161912 3300049583 Bacteria 1246
529 Ga0501068_0106878 3300049584 Bacteria 1737
530 Ga0501069_0157206 3300049585 Bacteria 1308
531 Ga0501069_0177438 3300049585 Bacteria 1231
532 Ga0501070_0011365 3300049586 Bacteria 7524
533 Ga0501070_0146498 3300049586 Bacteria 1949
534 Ga0501071_0285781 3300049587 Bacteria 1248
535 Ga0501073_0065903 3300049589 Bacteria 2525
536 Ga0501075_0099547 3300049591 Bacteria 2207
537 Ga0501077_0115874 3300049593 Bacteria 1698
538 Ga0501079_0019330 3300049741 Bacteria 5202
539 Ga0501080_0186769 3300049742 Unclassified 1906
540 Ga0501080_0240875 3300049742 Bacteria 1651
541 Ga0501080_0779494 3300049742 Bacteria 840
542 Ga0501081_0034510 3300049743 Bacteria 3442
543 Ga0501083_0005266 3300049744 Bacteria 9152
544 Ga0501035_0014258 3300049822 Bacteria 7337
545 Ga0501035_0053921 3300049822 Bacteria 3594
546 Ga0501035_0055100 3300049822 Bacteria 3551
547 Ga0501035_0209998 3300049822 Bacteria 1666
548 Ga0501035_0399976 3300049822 Unclassified 1143
549 Ga0501044_0001577 3300049823 Bacteria 26664
550 Ga0501044_0004555 3300049823 Bacteria 15501
551 Ga0501044_0488230 3300049823 Unclassified 1134
552 Ga0501045_0243179 3300049824 Bacteria 1339
553 Ga0501045_0428611 3300049824 Bacteria 984
554 nmdc:mga03n38_15866_c1 3300050490 Bacteria 2918
555 nmdc:mga00v17_246811_c1 3300050491 Bacteria 1158
556 nmdc:mga0yw44_21138_c1 3300050492 Bacteria 3625
557 nmdc:mga06z11_10675_c1 3300050494 Bacteria 3925
558 nmdc:mga06z11_29967_c1 3300050494 Bacteria 2628
559 nmdc:mga04h51_10122_c1 3300050495 Bacteria 2581
560 nmdc:mga05p37_152272_c1 3300050507 Bacteria 2828
561 nmdc:mga05p37_39808_c1 3300050507 Bacteria 5772
562 nmdc:mga06r32_13764_c1 3300050510 Bacteria 7337
563 nmdc:mga06r32_541367_c1 3300050510 Bacteria 1139
564 nmdc:mga08y16_1037771_c1 3300050511 Bacteria 798
565 nmdc:mga08y16_104157_c1 3300050511 Bacteria 2954
566 nmdc:mga0n895_380869_c1 3300050512 Bacteria 1428
567 nmdc:mga0rr50_141166_c1 3300050513 Bacteria 1938
568 nmdc:mga08x19_16357_c1 3300050514 Bacteria 4524
569 nmdc:mga08x19_460_c1 3300050514 Bacteria 27547
570 nmdc:mga0a205_7774_c1 3300050515 Bacteria 9733
571 Ga0500635_0012604 3300053080 Unclassified 2433
572 Ga0495655_0033511 3300053083 Bacteria 1264
573 Ga0495595_0155336 3300053084 Bacteria 1127
574 Ga0495619_0006693 3300053085 Bacteria 7290
575 Ga0500595_005887 3300053119 Bacteria 5281
576 Ga0500577_0157846 3300053142 Bacteria 965
577 Ga0501084_0007482 3300054114 Bacteria 9003
578 Ga0530510_0086448 3300061734 Bacteria 2284

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0657110 Ga0501033_0657110_15_653 180
2 3300046616 Ga0495668_0486776 Ga0495668_0486776_75_638 182
3 3300005439 Ga0070711_100006358 Ga0070711_1000063582 187
4 3300005834 Ga0068851_10059076 Ga0068851_100590762 187
5 3300006173 Ga0070716_100171947 Ga0070716_1001719472 187
6 3300049580 Ga0501046_0798506 Ga0501046_0798506_48_641 197
7 3300049569 Ga0501032_0094437 Ga0501032_0094437_740_1423 199
8 3300049570 Ga0501033_0018695 Ga0501033_0018695_2773_3456 199
9 3300049579 Ga0501043_0217248 Ga0501043_0217248_239_922 199
10 3300049581 Ga0501047_0004930 Ga0501047_0004930_4752_5435 199
11 3300049742 Ga0501080_0779494 Ga0501080_0779494_222_824 199
12 3300049822 Ga0501035_0014258 Ga0501035_0014258_4675_5358 199
13 3300049822 Ga0501035_0399976 Ga0501035_0399976_166_834 199
14 3300049823 Ga0501044_0001577 Ga0501044_0001577_19090_19773 199
15 3300049824 Ga0501045_0428611 Ga0501045_0428611_199_882 199
16 3300049580 Ga0501046_0178667 Ga0501046_0178667_828_1499 200
17 3300049581 Ga0501047_0078011 Ga0501047_0078011_2364_3035 200
18 3300049822 Ga0501035_0209998 Ga0501035_0209998_504_1175 200
19 3300005577 Ga0068857_100170514 Ga0068857_1001705142 201
20 3300026116 Ga0207674_10586746 Ga0207674_105867461 201
21 3300005364 Ga0070673_100127595 Ga0070673_1001275952 202
22 3300005456 Ga0070678_100058667 Ga0070678_1000586672 202
23 3300006358 Ga0068871_100228595 Ga0068871_1002285952 202
24 3300009098 Ga0105245_10044899 Ga0105245_100448992 202
25 3300009545 Ga0105237_10195748 Ga0105237_101957481 202
26 3300011119 Ga0105246_10039845 Ga0105246_100398453 202
27 3300025925 Ga0207650_10129833 Ga0207650_101298332 202
28 3300025927 Ga0207687_10032497 Ga0207687_100324971 202
29 3300026121 Ga0207683_10080314 Ga0207683_100803143 202
30 3300005347 Ga0070668_100344443 Ga0070668_1003444432 204
31 3300010375 Ga0105239_10745316 Ga0105239_107453162 204
32 3300025933 Ga0207706_10073444 Ga0207706_100734441 204
33 3300025972 Ga0207668_10172976 Ga0207668_101729762 204
34 3300005338 Ga0068868_100258498 Ga0068868_1002584981 208
35 3300031711 Ga0265314_10044216 Ga0265314_100442163 208
36 3300005331 Ga0070670_100332435 Ga0070670_1003324351 209
37 3300005335 Ga0070666_10143456 Ga0070666_101434562 209
38 3300005615 Ga0070702_100156848 Ga0070702_1001568482 209
39 3300005843 Ga0068860_100136296 Ga0068860_1001362962 209
40 3300006237 Ga0097621_100174686 Ga0097621_1001746862 209
41 3300009174 Ga0105241_10062657 Ga0105241_100626572 209
42 3300011119 Ga0105246_10047597 Ga0105246_100475973 209
43 3300014325 Ga0163163_10250185 Ga0163163_102501852 209
44 3300025903 Ga0207680_10083358 Ga0207680_100833582 209
45 3300025911 Ga0207654_10004909 Ga0207654_100049091 209
46 3300025942 Ga0207689_10496181 Ga0207689_104961812 209
47 3300025986 Ga0207658_10182857 Ga0207658_101828572 209
48 3300028381 Ga0268264_10566345 Ga0268264_105663451 209
49 3300014968 Ga0157379_10002828 Ga0157379_100028288 210
50 3300021377 Ga0213874_10002204 Ga0213874_100022042 211
51 3300028577 Ga0265318_10000149 Ga0265318_1000014957 211
52 3300028800 Ga0265338_10028088 Ga0265338_100280886 211
53 3300039450 Ga0436363_0038000 Ga0436363_0038000_1045_1695 211
54 3300005327 Ga0070658_10166052 Ga0070658_101660522 212
55 3300005335 Ga0070666_10014297 Ga0070666_100142975 212
56 3300005335 Ga0070666_10039456 Ga0070666_100394562 212
57 3300005336 Ga0070680_100000248 Ga0070680_10000024821 212
58 3300005339 Ga0070660_100077666 Ga0070660_1000776662 212
59 3300005344 Ga0070661_100113578 Ga0070661_1001135782 212
60 3300005455 Ga0070663_100104446 Ga0070663_1001044462 212
61 3300005456 Ga0070678_100376014 Ga0070678_1003760142 212
62 3300005458 Ga0070681_10000002 Ga0070681_10000002539 212
63 3300005530 Ga0070679_100000035 Ga0070679_10000003546 212
64 3300005548 Ga0070665_100043851 Ga0070665_1000438512 212
65 3300005548 Ga0070665_100072055 Ga0070665_1000720553 212
66 3300005548 Ga0070665_100078037 Ga0070665_1000780373 212
67 3300005841 Ga0068863_100012930 Ga0068863_1000129306 212
68 3300005842 Ga0068858_100247542 Ga0068858_1002475422 212
69 3300006237 Ga0097621_100000267 Ga0097621_1000002676 212
70 3300006237 Ga0097621_100052369 Ga0097621_1000523694 212
71 3300006237 Ga0097621_100105690 Ga0097621_1001056902 212
72 3300006358 Ga0068871_100001741 Ga0068871_1000017415 212
73 3300009093 Ga0105240_10054893 Ga0105240_100548933 212
74 3300009093 Ga0105240_10078368 Ga0105240_100783685 212
75 3300009098 Ga0105245_10125755 Ga0105245_101257552 212
76 3300009101 Ga0105247_10012277 Ga0105247_100122773 212
77 3300009148 Ga0105243_10519514 Ga0105243_105195142 212
78 3300009177 Ga0105248_10011402 Ga0105248_100114028 212
79 3300009545 Ga0105237_10024196 Ga0105237_100241965 212
80 3300009553 Ga0105249_10006469 Ga0105249_100064694 212
81 3300010375 Ga0105239_10000540 Ga0105239_100005405 212
82 3300010375 Ga0105239_10040642 Ga0105239_100406423 212
83 3300013105 Ga0157369_10062984 Ga0157369_100629842 212
84 3300013105 Ga0157369_10393644 Ga0157369_103936442 212
85 3300013306 Ga0163162_10099333 Ga0163162_100993333 212
86 3300014325 Ga0163163_10445931 Ga0163163_104459312 212
87 3300014326 Ga0157380_10093665 Ga0157380_100936653 212
88 3300014968 Ga0157379_11005923 Ga0157379_110059231 212
89 3300025900 Ga0207710_10019905 Ga0207710_100199051 212
90 3300025912 Ga0207707_10000002 Ga0207707_10000002419 212
91 3300025913 Ga0207695_10034041 Ga0207695_100340415 212
92 3300025913 Ga0207695_10218241 Ga0207695_102182412 212
93 3300025914 Ga0207671_10032772 Ga0207671_100327722 212
94 3300025917 Ga0207660_10000240 Ga0207660_1000024020 212
95 3300025919 Ga0207657_10204835 Ga0207657_102048352 212
96 3300025920 Ga0207649_10086074 Ga0207649_100860742 212
97 3300025921 Ga0207652_10000932 Ga0207652_100009325 212
98 3300025925 Ga0207650_10102919 Ga0207650_101029192 212
99 3300025941 Ga0207711_10012312 Ga0207711_100123123 212
100 3300026067 Ga0207678_10121592 Ga0207678_101215922 212
101 3300026088 Ga0207641_10065083 Ga0207641_100650833 212
102 3300028379 Ga0268266_10006504 Ga0268266_100065044 212
103 3300028379 Ga0268266_10134166 Ga0268266_101341662 212
104 3300028786 Ga0307517_10289841 Ga0307517_102898412 212
105 3300045049 Ga0466959_0302452 Ga0466959_0302452_111_770 212
106 3300046515 Ga0495620_0167672 Ga0495620_0167672_22_681 212
107 3300046524 Ga0495648_0166759 Ga0495648_0166759_148_807 212
108 3300046538 Ga0495609_0002340 Ga0495609_0002340_10282_10941 212
109 3300047321 Ga0495676_0287796 Ga0495676_0287796_125_784 212
110 3300049570 Ga0501033_0005487 Ga0501033_0005487_173_832 212
111 3300049571 Ga0501034_0037302 Ga0501034_0037302_147_806 212
112 3300049574 Ga0501038_0102449 Ga0501038_0102449_1000_1659 212
113 3300049579 Ga0501043_0095086 Ga0501043_0095086_808_1467 212
114 3300049581 Ga0501047_0032205 Ga0501047_0032205_4362_5021 212
115 3300049586 Ga0501070_0011365 Ga0501070_0011365_748_1473 212
116 3300049742 Ga0501080_0186769 Ga0501080_0186769_771_1430 212
117 3300049744 Ga0501083_0005266 Ga0501083_0005266_8153_8818 212
118 3300053080 Ga0500635_0012604 Ga0500635_0012604_1533_2192 212
119 3300053119 Ga0500595_005887 Ga0500595_005887_1113_1772 212
120 3300053142 Ga0500577_0157846 Ga0500577_0157846_122_781 212
121 3300048929 Ga0496126_0001104 Ga0496126_0001104_20207_20863 213
122 3300005327 Ga0070658_10048858 Ga0070658_100488583 214
123 3300005327 Ga0070658_10079785 Ga0070658_100797851 214
124 3300005329 Ga0070683_100044123 Ga0070683_1000441233 214
125 3300005335 Ga0070666_10041710 Ga0070666_100417103 214
126 3300005336 Ga0070680_100190303 Ga0070680_1001903032 214
127 3300005339 Ga0070660_100044609 Ga0070660_1000446093 214
128 3300005344 Ga0070661_100440953 Ga0070661_1004409531 214
129 3300005434 Ga0070709_10004467 Ga0070709_100044678 214
130 3300005435 Ga0070714_100052171 Ga0070714_1000521713 214
131 3300005436 Ga0070713_100000006 Ga0070713_100000006158 214
132 3300005437 Ga0070710_10427560 Ga0070710_104275602 214
133 3300005440 Ga0070705_100099530 Ga0070705_1000995302 214
134 3300005458 Ga0070681_10431389 Ga0070681_104313892 214
135 3300005458 Ga0070681_10475245 Ga0070681_104752452 214
136 3300005466 Ga0070685_10373744 Ga0070685_103737441 214
137 3300005530 Ga0070679_100035909 Ga0070679_1000359093 214
138 3300005535 Ga0070684_100046711 Ga0070684_1000467113 214
139 3300005548 Ga0070665_100003166 Ga0070665_1000031666 214
140 3300005563 Ga0068855_100041948 Ga0068855_1000419483 214
141 3300005563 Ga0068855_100480985 Ga0068855_1004809851 214
142 3300005614 Ga0068856_100000280 Ga0068856_10000028046 214
143 3300005614 Ga0068856_100099431 Ga0068856_1000994312 214
144 3300005618 Ga0068864_100437601 Ga0068864_1004376012 214
145 3300006175 Ga0070712_100000184 Ga0070712_10000018422 214
146 3300006914 Ga0075436_100001960 Ga0075436_1000019606 214
147 3300007076 Ga0075435_100162931 Ga0075435_1001629312 214
148 3300009093 Ga0105240_10123169 Ga0105240_101231693 214
149 3300009093 Ga0105240_10320643 Ga0105240_103206432 214
150 3300009093 Ga0105240_10763421 Ga0105240_107634211 214
151 3300009098 Ga0105245_10611383 Ga0105245_106113832 214
152 3300009174 Ga0105241_10058685 Ga0105241_100586853 214
153 3300009174 Ga0105241_10061391 Ga0105241_100613913 214
154 3300009545 Ga0105237_10065074 Ga0105237_100650743 214
155 3300009551 Ga0105238_10355952 Ga0105238_103559521 214
156 3300010375 Ga0105239_10296970 Ga0105239_102969702 214
157 3300013104 Ga0157370_10086430 Ga0157370_100864303 214
158 3300013105 Ga0157369_10245378 Ga0157369_102453782 214
159 3300013296 Ga0157374_10317600 Ga0157374_103176002 214
160 3300013297 Ga0157378_10344892 Ga0157378_103448921 214
161 3300013307 Ga0157372_10097370 Ga0157372_100973702 214
162 3300014325 Ga0163163_10183792 Ga0163163_101837922 214
163 3300025903 Ga0207680_10040977 Ga0207680_100409773 214
164 3300025906 Ga0207699_10001108 Ga0207699_100011087 214
165 3300025909 Ga0207705_10020038 Ga0207705_100200383 214
166 3300025909 Ga0207705_10073109 Ga0207705_100731093 214
167 3300025911 Ga0207654_10038844 Ga0207654_100388443 214
168 3300025912 Ga0207707_10359464 Ga0207707_103594642 214
169 3300025913 Ga0207695_10070019 Ga0207695_100700193 214
170 3300025913 Ga0207695_10342769 Ga0207695_103427691 214
171 3300025913 Ga0207695_10545755 Ga0207695_105457552 214
172 3300025915 Ga0207693_10000733 Ga0207693_1000073310 214
173 3300025917 Ga0207660_10151309 Ga0207660_101513092 214
174 3300025919 Ga0207657_10080025 Ga0207657_100800252 214
175 3300025921 Ga0207652_10067029 Ga0207652_100670292 214
176 3300025924 Ga0207694_10239882 Ga0207694_102398822 214
177 3300025924 Ga0207694_10561868 Ga0207694_105618681 214
178 3300025928 Ga0207700_10000020 Ga0207700_1000002014 214
179 3300025928 Ga0207700_10273052 Ga0207700_102730522 214
180 3300025929 Ga0207664_10044073 Ga0207664_100440733 214
181 3300025949 Ga0207667_10168195 Ga0207667_101681953 214
182 3300025949 Ga0207667_10251138 Ga0207667_102511382 214
183 3300025949 Ga0207667_10456050 Ga0207667_104560501 214
184 3300026035 Ga0207703_10032181 Ga0207703_100321812 214
185 3300026041 Ga0207639_10229287 Ga0207639_102292872 214
186 3300026078 Ga0207702_10000030 Ga0207702_10000030103 214
187 3300026078 Ga0207702_10082123 Ga0207702_100821232 214
188 3300026078 Ga0207702_10206284 Ga0207702_102062842 214
189 3300026118 Ga0207675_100047992 Ga0207675_1000479924 214
190 3300026142 Ga0207698_10758090 Ga0207698_107580901 214
191 3300028379 Ga0268266_10000510 Ga0268266_1000051052 214
192 3300028379 Ga0268266_10353521 Ga0268266_103535211 214
193 3300028800 Ga0265338_10000649 Ga0265338_1000064958 214
194 3300031247 Ga0265340_10057376 Ga0265340_100573762 214
195 3300031250 Ga0265331_10017810 Ga0265331_100178103 214
196 3300031344 Ga0265316_10037907 Ga0265316_100379073 214
197 3300031595 Ga0265313_10074336 Ga0265313_100743362 214
198 3300031711 Ga0265314_10010341 Ga0265314_100103416 214
199 3300031712 Ga0265342_10008930 Ga0265342_100089305 214
200 3300037418 Ga0395900_0010214 Ga0395900_0010214_421_1158 214
201 3300037466 Ga0395898_0014512 Ga0395898_0014512_1941_2678 214
202 3300037471 Ga0395905_0483387 Ga0395905_0483387_32_706 214
203 3300038443 Ga0395901_0004946 Ga0395901_0004946_6242_6979 214
204 3300044694 Ga0466963_0667134 Ga0466963_0667134_45_719 214
205 3300044842 Ga0466957_0135845 Ga0466957_0135845_560_1234 214
206 3300048904 Ga0496101_0422920 Ga0496101_0422920_164_826 214
207 3300049583 Ga0501067_0069612 Ga0501067_0069612_672_1346 214
208 3300049822 Ga0501035_0053921 Ga0501035_0053921_31_774 214
209 3300049823 Ga0501044_0004555 Ga0501044_0004555_11160_11903 214
210 3300049823 Ga0501044_0488230 Ga0501044_0488230_382_1119 214
211 3300050513 nmdc:mga0rr50_141166_c1 nmdc:mga0rr50_141166_c1_882_1544 214
212 3300050514 nmdc:mga08x19_460_c1 nmdc:mga08x19_460_c1_8951_9613 214
213 3300005328 Ga0070676_10183050 Ga0070676_101830502 215
214 3300005328 Ga0070676_10435362 Ga0070676_104353621 215
215 3300005334 Ga0068869_100078006 Ga0068869_1000780062 215
216 3300005354 Ga0070675_100102846 Ga0070675_1001028462 215
217 3300005356 Ga0070674_100173469 Ga0070674_1001734692 215
218 3300005364 Ga0070673_100094029 Ga0070673_1000940292 215
219 3300005436 Ga0070713_100334252 Ga0070713_1003342521 215
220 3300005439 Ga0070711_100397648 Ga0070711_1003976482 215
221 3300005456 Ga0070678_100010621 Ga0070678_1000106212 215
222 3300005459 Ga0068867_100148322 Ga0068867_1001483222 215
223 3300005543 Ga0070672_100267994 Ga0070672_1002679941 215
224 3300005548 Ga0070665_100051235 Ga0070665_1000512354 215
225 3300005617 Ga0068859_100408854 Ga0068859_1004088542 215
226 3300005617 Ga0068859_100448549 Ga0068859_1004485492 215
227 3300005842 Ga0068858_100059040 Ga0068858_1000590404 215
228 3300006237 Ga0097621_100101455 Ga0097621_1001014552 215
229 3300006881 Ga0068865_100224322 Ga0068865_1002243222 215
230 3300006931 Ga0097620_100408867 Ga0097620_1004088672 215
231 3300006931 Ga0097620_100448533 Ga0097620_1004485332 215
232 3300009098 Ga0105245_10019574 Ga0105245_100195742 215
233 3300009148 Ga0105243_10028300 Ga0105243_100283005 215
234 3300009174 Ga0105241_10110217 Ga0105241_101102172 215
235 3300009177 Ga0105248_10250001 Ga0105248_102500012 215
236 3300013100 Ga0157373_10407621 Ga0157373_104076211 215
237 3300013296 Ga0157374_10052051 Ga0157374_100520512 215
238 3300013297 Ga0157378_10562475 Ga0157378_105624752 215
239 3300013306 Ga0163162_10002450 Ga0163162_100024508 215
240 3300013306 Ga0163162_10722906 Ga0163162_107229062 215
241 3300013308 Ga0157375_10185254 Ga0157375_101852542 215
242 3300017792 Ga0163161_10005012 Ga0163161_100050122 215
243 3300025261 Ga0209233_1000006 Ga0209233_1000006815 215
244 3300025261 Ga0209233_1001131 Ga0209233_10011316 215
245 3300025907 Ga0207645_10036296 Ga0207645_100362963 215
246 3300025911 Ga0207654_10315095 Ga0207654_103150952 215
247 3300025913 Ga0207695_10242771 Ga0207695_102427712 215
248 3300025926 Ga0207659_10116423 Ga0207659_101164232 215
249 3300025927 Ga0207687_10580846 Ga0207687_105808462 215
250 3300025935 Ga0207709_10057368 Ga0207709_100573682 215
251 3300025937 Ga0207669_10387811 Ga0207669_103878112 215
252 3300025938 Ga0207704_10143532 Ga0207704_101435322 215
253 3300025940 Ga0207691_10135389 Ga0207691_101353892 215
254 3300025941 Ga0207711_10270665 Ga0207711_102706652 215
255 3300025942 Ga0207689_10093276 Ga0207689_100932762 215
256 3300025960 Ga0207651_10002795 Ga0207651_100027958 215
257 3300025960 Ga0207651_10073042 Ga0207651_100730423 215
258 3300026075 Ga0207708_10265840 Ga0207708_102658402 215
259 3300026089 Ga0207648_10005670 Ga0207648_100056707 215
260 3300026089 Ga0207648_10020996 Ga0207648_100209962 215
261 3300026095 Ga0207676_10798195 Ga0207676_107981951 215
262 3300026121 Ga0207683_10093555 Ga0207683_100935552 215
263 3300028379 Ga0268266_10024833 Ga0268266_100248333 215
264 3300028380 Ga0268265_10327024 Ga0268265_103270242 215
265 3300046507 Ga0495606_0228904 Ga0495606_0228904_205_876 215
266 3300046648 Ga0495611_0046466 Ga0495611_0046466_1079_1837 215
267 3300048918 Ga0496115_0524006 Ga0496115_0524006_18_698 215
268 3300005337 Ga0070682_100498037 Ga0070682_1004980371 216
269 3300005341 Ga0070691_10001501 Ga0070691_100015011 216
270 3300005344 Ga0070661_100286005 Ga0070661_1002860052 216
271 3300005434 Ga0070709_10079605 Ga0070709_100796052 216
272 3300005435 Ga0070714_100236514 Ga0070714_1002365142 216
273 3300005518 Ga0070699_100058883 Ga0070699_1000588833 216
274 3300005539 Ga0068853_100012410 Ga0068853_1000124103 216
275 3300005547 Ga0070693_100031583 Ga0070693_1000315833 216
276 3300005563 Ga0068855_100047427 Ga0068855_1000474275 216
277 3300005577 Ga0068857_100000387 Ga0068857_1000003876 216
278 3300005578 Ga0068854_100015672 Ga0068854_1000156722 216
279 3300005614 Ga0068856_100023115 Ga0068856_1000231153 216
280 3300005616 Ga0068852_100003875 Ga0068852_1000038753 216
281 3300006914 Ga0075436_100054680 Ga0075436_1000546802 216
282 3300009093 Ga0105240_10003264 Ga0105240_100032645 216
283 3300009174 Ga0105241_10002894 Ga0105241_100028946 216
284 3300009545 Ga0105237_10005625 Ga0105237_1000562512 216
285 3300009551 Ga0105238_10028649 Ga0105238_100286493 216
286 3300010375 Ga0105239_10061226 Ga0105239_100612263 216
287 3300013100 Ga0157373_10001321 Ga0157373_100013216 216
288 3300013104 Ga0157370_10000438 Ga0157370_1000043831 216
289 3300013105 Ga0157369_10003719 Ga0157369_100037192 216
290 3300013296 Ga0157374_10054370 Ga0157374_100543702 216
291 3300013307 Ga0157372_10036446 Ga0157372_100364465 216
292 3300014968 Ga0157379_10026293 Ga0157379_100262933 216
293 3300015262 Ga0182007_10036081 Ga0182007_100360812 216
294 3300025906 Ga0207699_10253057 Ga0207699_102530572 216
295 3300025911 Ga0207654_10034260 Ga0207654_100342603 216
296 3300025912 Ga0207707_10090588 Ga0207707_100905882 216
297 3300025913 Ga0207695_10070852 Ga0207695_100708521 216
298 3300025914 Ga0207671_10004743 Ga0207671_1000474310 216
299 3300025920 Ga0207649_10663318 Ga0207649_106633181 216
300 3300025924 Ga0207694_10070369 Ga0207694_100703692 216
301 3300025949 Ga0207667_10029859 Ga0207667_100298595 216
302 3300025981 Ga0207640_10020303 Ga0207640_100203032 216
303 3300026041 Ga0207639_10089612 Ga0207639_100896121 216
304 3300026078 Ga0207702_10082741 Ga0207702_100827412 216
305 3300026116 Ga0207674_10000051 Ga0207674_1000005170 216
306 3300026142 Ga0207698_10017660 Ga0207698_100176603 216
307 3300035691 Ga0373931_0118574 Ga0373931_0118574_64_732 216
308 3300005719 Ga0068861_100183218 Ga0068861_1001832182 217
309 3300026118 Ga0207675_100434024 Ga0207675_1004340242 217
310 3300039447 Ga0436361_0680656 Ga0436361_0680656_179_832 217
311 3300048907 Ga0496104_0000360 Ga0496104_0000360_16057_16731 218
312 3300048908 Ga0496105_0030762 Ga0496105_0030762_2320_2994 218
313 3300048911 Ga0496108_0031629 Ga0496108_0031629_3375_4049 218
314 3300048912 Ga0496109_0289332 Ga0496109_0289332_814_1488 218
315 3300048913 Ga0496110_0003669 Ga0496110_0003669_7088_7762 218
316 3300048914 Ga0496111_0000814 Ga0496111_0000814_3370_4044 218
317 3300048915 Ga0496112_0061288 Ga0496112_0061288_2237_2911 218
318 3300048916 Ga0496113_0011714 Ga0496113_0011714_4507_5181 218
319 3300049585 Ga0501069_0177438 Ga0501069_0177438_257_931 219
320 3300005347 Ga0070668_100086002 Ga0070668_1000860022 220
321 3300005844 Ga0068862_100624367 Ga0068862_1006243672 220
322 3300006038 Ga0075365_10011457 Ga0075365_100114572 220
323 3300006042 Ga0075368_10004349 Ga0075368_100043496 220
324 3300006048 Ga0075363_100012071 Ga0075363_1000120716 220
325 3300006051 Ga0075364_10001704 Ga0075364_100017042 220
326 3300006178 Ga0075367_10022463 Ga0075367_100224632 220
327 3300006178 Ga0075367_10070785 Ga0075367_100707852 220
328 3300025972 Ga0207668_10338369 Ga0207668_103383692 220
329 3300027682 Ga0209971_1071306 Ga0209971_10713061 220
330 3300028380 Ga0268265_10625678 Ga0268265_106256781 220
331 3300050490 nmdc:mga03n38_15866_c1 nmdc:mga03n38_15866_c1_1564_2241 220
332 3300050491 nmdc:mga00v17_246811_c1 nmdc:mga00v17_246811_c1_60_737 220
333 3300050492 nmdc:mga0yw44_21138_c1 nmdc:mga0yw44_21138_c1_1803_2480 220
334 3300050494 nmdc:mga06z11_10675_c1 nmdc:mga06z11_10675_c1_2699_3376 220
335 3300050494 nmdc:mga06z11_29967_c1 nmdc:mga06z11_29967_c1_1375_2052 220
336 3300050495 nmdc:mga04h51_10122_c1 nmdc:mga04h51_10122_c1_698_1375 220
337 3300005347 Ga0070668_100566660 Ga0070668_1005666601 221
338 3300005365 Ga0070688_100156657 Ga0070688_1001566572 221
339 3300005457 Ga0070662_100346012 Ga0070662_1003460122 221
340 3300005844 Ga0068862_101225313 Ga0068862_1012253131 221
341 3300006846 Ga0075430_100236159 Ga0075430_1002361592 221
342 3300006847 Ga0075431_100574997 Ga0075431_1005749972 221
343 3300006880 Ga0075429_100499174 Ga0075429_1004991742 221
344 3300025917 Ga0207660_10711211 Ga0207660_107112111 221
345 3300025933 Ga0207706_10336835 Ga0207706_103368352 221
346 3300026075 Ga0207708_10087743 Ga0207708_100877432 221
347 3300026116 Ga0207674_10610376 Ga0207674_106103762 221
348 3300049568 Ga0501031_0009797 Ga0501031_0009797_375_1040 221
349 3300049569 Ga0501032_0156769 Ga0501032_0156769_568_1233 221
350 3300049570 Ga0501033_0419781 Ga0501033_0419781_200_865 221
351 3300049572 Ga0501036_0270913 Ga0501036_0270913_399_1064 221
352 3300049574 Ga0501038_0020260 Ga0501038_0020260_2978_3643 221
353 3300049575 Ga0501039_0002429 Ga0501039_0002429_12334_12999 221
354 3300049576 Ga0501040_0025589 Ga0501040_0025589_448_1113 221
355 3300049577 Ga0501041_0005311 Ga0501041_0005311_3094_3759 221
356 3300049578 Ga0501042_0033042 Ga0501042_0033042_2544_3209 221
357 3300049579 Ga0501043_0067430 Ga0501043_0067430_1821_2486 221
358 3300049580 Ga0501046_0038489 Ga0501046_0038489_2155_2820 221
359 3300049582 Ga0501048_0169010 Ga0501048_0169010_493_1158 221
360 3300049583 Ga0501067_0161912 Ga0501067_0161912_61_726 221
361 3300049584 Ga0501068_0106878 Ga0501068_0106878_285_950 221
362 3300049585 Ga0501069_0157206 Ga0501069_0157206_395_1060 221
363 3300049586 Ga0501070_0146498 Ga0501070_0146498_944_1609 221
364 3300049587 Ga0501071_0285781 Ga0501071_0285781_203_868 221
365 3300049589 Ga0501073_0065903 Ga0501073_0065903_823_1488 221
366 3300049591 Ga0501075_0099547 Ga0501075_0099547_637_1302 221
367 3300049593 Ga0501077_0115874 Ga0501077_0115874_286_951 221
368 3300049741 Ga0501079_0019330 Ga0501079_0019330_572_1237 221
369 3300049742 Ga0501080_0240875 Ga0501080_0240875_211_876 221
370 3300049743 Ga0501081_0034510 Ga0501081_0034510_2414_3079 221
371 3300049822 Ga0501035_0055100 Ga0501035_0055100_1098_1763 221
372 3300049824 Ga0501045_0243179 Ga0501045_0243179_243_908 221
373 3300050510 nmdc:mga06r32_541367_c1 nmdc:mga06r32_541367_c1_382_1065 221
374 3300054114 Ga0501084_0007482 Ga0501084_0007482_891_1556 221
375 3300061734 Ga0530510_0086448 Ga0530510_0086448_479_1144 221
376 3300005719 Ga0068861_100135574 Ga0068861_1001355742 222
377 3300005937 Ga0081455_10017063 Ga0081455_100170633 222
378 3300009094 Ga0111539_11595329 Ga0111539_115953291 222
379 3300012495 Ga0157323_1001688 Ga0157323_10016882 222
380 3300035115 Ga0373941_0058749 Ga0373941_0058749_422_1108 222
381 3300035171 Ga0373946_0062175 Ga0373946_0062175_726_1394 222
382 3300035691 Ga0373931_0426098 Ga0373931_0426098_36_722 222
383 3300035692 Ga0373935_0029448 Ga0373935_0029448_1644_2312 222
384 3300035695 Ga0373927_0014041 Ga0373927_0014041_2897_3565 222
385 3300035725 Ga0373947_0003079 Ga0373947_0003079_2472_3140 222
386 3300037068 Ga0373925_0003993 Ga0373925_0003993_3025_3693 222
387 3300046455 Ga0495603_0000303 Ga0495603_0000303_13736_14404 222
388 3300046459 Ga0495629_0017757 Ga0495629_0017757_236_904 222
389 3300046461 Ga0495641_0078526 Ga0495641_0078526_290_958 222
390 3300046472 Ga0495580_0002543 Ga0495580_0002543_686_1354 222
391 3300046473 Ga0495582_0004516 Ga0495582_0004516_6748_7416 222
392 3300046475 Ga0495639_0032262 Ga0495639_0032262_1093_1761 222
393 3300046499 Ga0495594_0005029 Ga0495594_0005029_5845_6513 222
394 3300046557 Ga0495622_0002377 Ga0495622_0002377_7649_8317 222
395 3300046642 Ga0495634_0016928 Ga0495634_0016928_17_685 222
396 3300046663 Ga0495635_0423406 Ga0495635_0423406_198_866 222
397 3300046674 Ga0495588_0027423 Ga0495588_0027423_2055_2723 222
398 3300046683 Ga0495658_0005365 Ga0495658_0005365_3541_4209 222
399 3300046689 Ga0495613_0004315 Ga0495613_0004315_9005_9673 222
400 3300047321 Ga0495676_0381583 Ga0495676_0381583_228_896 222
401 3300047322 Ga0495680_0025863 Ga0495680_0025863_2067_2735 222
402 3300047673 Ga0495593_0001092 Ga0495593_0001092_7714_8382 222
403 3300049575 Ga0501039_0150317 Ga0501039_0150317_289_996 222
404 3300050511 nmdc:mga08y16_1037771_c1 nmdc:mga08y16_1037771_c1_19_705 222
405 3300053083 Ga0495655_0033511 Ga0495655_0033511_454_1140 222
406 3300053084 Ga0495595_0155336 Ga0495595_0155336_233_901 222
407 3300053085 Ga0495619_0006693 Ga0495619_0006693_3595_4263 222
408 3300001989 JGI24739J22299_10034217 JGI24739J22299_100342172 224
409 3300002075 JGI24738J21930_10008485 JGI24738J21930_100084852 224
410 3300005328 Ga0070676_10053362 Ga0070676_100533621 224
411 3300005330 Ga0070690_100000303 Ga0070690_1000003038 224
412 3300005331 Ga0070670_100027428 Ga0070670_1000274281 224
413 3300005334 Ga0068869_100047921 Ga0068869_1000479212 224
414 3300005335 Ga0070666_10002091 Ga0070666_100020914 224
415 3300005336 Ga0070680_100052690 Ga0070680_1000526904 224
416 3300005337 Ga0070682_100081450 Ga0070682_1000814502 224
417 3300005339 Ga0070660_100729802 Ga0070660_1007298021 224
418 3300005340 Ga0070689_100021918 Ga0070689_1000219185 224
419 3300005341 Ga0070691_10001279 Ga0070691_100012798 224
420 3300005343 Ga0070687_100001187 Ga0070687_1000011877 224
421 3300005344 Ga0070661_100003828 Ga0070661_1000038288 224
422 3300005345 Ga0070692_10002001 Ga0070692_100020016 224
423 3300005347 Ga0070668_100020364 Ga0070668_1000203642 224
424 3300005353 Ga0070669_100000391 Ga0070669_10000039131 224
425 3300005354 Ga0070675_100235175 Ga0070675_1002351752 224
426 3300005355 Ga0070671_100013327 Ga0070671_1000133272 224
427 3300005356 Ga0070674_100000430 Ga0070674_1000004304 224
428 3300005364 Ga0070673_100005733 Ga0070673_1000057335 224
429 3300005365 Ga0070688_100002877 Ga0070688_1000028776 224
430 3300005366 Ga0070659_100026803 Ga0070659_1000268034 224
431 3300005367 Ga0070667_100000918 Ga0070667_10000091820 224
432 3300005434 Ga0070709_10461642 Ga0070709_104616422 224
433 3300005435 Ga0070714_100007818 Ga0070714_1000078186 224
434 3300005436 Ga0070713_100046176 Ga0070713_1000461762 224
435 3300005437 Ga0070710_10044685 Ga0070710_100446852 224
436 3300005438 Ga0070701_10084637 Ga0070701_100846371 224
437 3300005440 Ga0070705_100001203 Ga0070705_1000012032 224
438 3300005441 Ga0070700_100029758 Ga0070700_1000297583 224
439 3300005444 Ga0070694_100003505 Ga0070694_1000035054 224
440 3300005455 Ga0070663_100000890 Ga0070663_10000089013 224
441 3300005457 Ga0070662_100019029 Ga0070662_1000190294 224
442 3300005530 Ga0070679_100081129 Ga0070679_1000811292 224
443 3300005535 Ga0070684_100120725 Ga0070684_1001207252 224
444 3300005536 Ga0070697_100058237 Ga0070697_1000582371 224
445 3300005543 Ga0070672_100020553 Ga0070672_1000205535 224
446 3300005544 Ga0070686_100004608 Ga0070686_1000046085 224
447 3300005545 Ga0070695_100027254 Ga0070695_1000272544 224
448 3300005545 Ga0070695_100244029 Ga0070695_1002440291 224
449 3300005546 Ga0070696_100000728 Ga0070696_1000007282 224
450 3300005547 Ga0070693_100032550 Ga0070693_1000325502 224
451 3300005549 Ga0070704_100006503 Ga0070704_1000065031 224
452 3300005563 Ga0068855_100007702 Ga0068855_1000077022 224
453 3300005564 Ga0070664_100006680 Ga0070664_1000066801 224
454 3300005577 Ga0068857_100050602 Ga0068857_1000506025 224
455 3300005578 Ga0068854_100005281 Ga0068854_1000052815 224
456 3300005614 Ga0068856_100515825 Ga0068856_1005158252 224
457 3300005615 Ga0070702_100000098 Ga0070702_10000009814 224
458 3300005615 Ga0070702_100378648 Ga0070702_1003786481 224
459 3300005616 Ga0068852_101039281 Ga0068852_1010392811 224
460 3300005617 Ga0068859_100012414 Ga0068859_1000124145 224
461 3300005618 Ga0068864_100024278 Ga0068864_1000242785 224
462 3300005718 Ga0068866_10065108 Ga0068866_100651082 224
463 3300005719 Ga0068861_100021324 Ga0068861_1000213242 224
464 3300005841 Ga0068863_100005195 Ga0068863_10000519510 224
465 3300005842 Ga0068858_100020434 Ga0068858_1000204345 224
466 3300005843 Ga0068860_100006370 Ga0068860_1000063705 224
467 3300006058 Ga0075432_10056968 Ga0075432_100569682 224
468 3300006175 Ga0070712_100001132 Ga0070712_10000113214 224
469 3300006237 Ga0097621_100173868 Ga0097621_1001738682 224
470 3300006844 Ga0075428_100620035 Ga0075428_1006200351 224
471 3300006847 Ga0075431_100024570 Ga0075431_1000245705 224
472 3300006852 Ga0075433_10139544 Ga0075433_101395442 224
473 3300006871 Ga0075434_100069525 Ga0075434_1000695252 224
474 3300006880 Ga0075429_100207694 Ga0075429_1002076942 224
475 3300006881 Ga0068865_100024141 Ga0068865_1000241413 224
476 3300006914 Ga0075436_100061914 Ga0075436_1000619142 224
477 3300006931 Ga0097620_100012416 Ga0097620_1000124165 224
478 3300009011 Ga0105251_10033581 Ga0105251_100335813 224
479 3300009092 Ga0105250_10104762 Ga0105250_101047622 224
480 3300009094 Ga0111539_10560083 Ga0111539_105600832 224
481 3300009098 Ga0105245_10019845 Ga0105245_100198452 224
482 3300009147 Ga0114129_10038332 Ga0114129_100383325 224
483 3300009148 Ga0105243_10006802 Ga0105243_100068025 224
484 3300009174 Ga0105241_10003267 Ga0105241_1000326710 224
485 3300009176 Ga0105242_10005740 Ga0105242_100057409 224
486 3300009177 Ga0105248_10019596 Ga0105248_100195967 224
487 3300009545 Ga0105237_10004528 Ga0105237_1000452811 224
488 3300009553 Ga0105249_10060208 Ga0105249_100602082 224
489 3300010375 Ga0105239_10014435 Ga0105239_100144351 224
490 3300011119 Ga0105246_10006915 Ga0105246_100069156 224
491 3300013102 Ga0157371_10192116 Ga0157371_101921162 224
492 3300013104 Ga0157370_10120500 Ga0157370_101205002 224
493 3300013105 Ga0157369_10020645 Ga0157369_100206452 224
494 3300013297 Ga0157378_10017766 Ga0157378_100177662 224
495 3300013297 Ga0157378_10127937 Ga0157378_101279372 224
496 3300013306 Ga0163162_10027271 Ga0163162_100272715 224
497 3300013307 Ga0157372_10000133 Ga0157372_100001335 224
498 3300013308 Ga0157375_10594043 Ga0157375_105940432 224
499 3300014325 Ga0163163_10653341 Ga0163163_106533412 224
500 3300014326 Ga0157380_10001318 Ga0157380_100013182 224
501 3300014745 Ga0157377_10004069 Ga0157377_100040697 224
502 3300017792 Ga0163161_10001599 Ga0163161_1000159915 224
503 3300017792 Ga0163161_10080282 Ga0163161_100802822 224
504 3300025898 Ga0207692_10018036 Ga0207692_100180362 224
505 3300025899 Ga0207642_10021956 Ga0207642_100219563 224
506 3300025900 Ga0207710_10002160 Ga0207710_100021602 224
507 3300025901 Ga0207688_10002567 Ga0207688_100025677 224
508 3300025905 Ga0207685_10001101 Ga0207685_100011012 224
509 3300025906 Ga0207699_10002019 Ga0207699_100020198 224
510 3300025907 Ga0207645_10056556 Ga0207645_100565563 224
511 3300025911 Ga0207654_10051134 Ga0207654_100511342 224
512 3300025912 Ga0207707_10029312 Ga0207707_100293125 224
513 3300025914 Ga0207671_10134415 Ga0207671_101344152 224
514 3300025915 Ga0207693_10000062 Ga0207693_100000627 224
515 3300025916 Ga0207663_10000652 Ga0207663_1000065210 224
516 3300025917 Ga0207660_10428927 Ga0207660_104289272 224
517 3300025918 Ga0207662_10005248 Ga0207662_100052485 224
518 3300025919 Ga0207657_10000023 Ga0207657_1000002375 224
519 3300025924 Ga0207694_10074161 Ga0207694_100741612 224
520 3300025926 Ga0207659_10186751 Ga0207659_101867512 224
521 3300025929 Ga0207664_10479792 Ga0207664_104797921 224
522 3300025931 Ga0207644_10022454 Ga0207644_100224542 224
523 3300025932 Ga0207690_10003754 Ga0207690_100037542 224
524 3300025933 Ga0207706_10000019 Ga0207706_1000001982 224
525 3300025935 Ga0207709_10030603 Ga0207709_100306032 224
526 3300025936 Ga0207670_10011387 Ga0207670_100113872 224
527 3300025937 Ga0207669_10015302 Ga0207669_100153025 224
528 3300025938 Ga0207704_10075725 Ga0207704_100757251 224
529 3300025939 Ga0207665_10000205 Ga0207665_1000020511 224
530 3300025940 Ga0207691_10003337 Ga0207691_1000333711 224
531 3300025941 Ga0207711_10017832 Ga0207711_100178326 224
532 3300025942 Ga0207689_10069797 Ga0207689_100697972 224
533 3300025945 Ga0207679_10063991 Ga0207679_100639913 224
534 3300025960 Ga0207651_10003035 Ga0207651_100030356 224
535 3300025961 Ga0207712_10006286 Ga0207712_100062866 224
536 3300025972 Ga0207668_10616449 Ga0207668_106164492 224
537 3300025986 Ga0207658_10024089 Ga0207658_100240892 224
538 3300026035 Ga0207703_10094549 Ga0207703_100945492 224
539 3300026041 Ga0207639_10012778 Ga0207639_100127782 224
540 3300026067 Ga0207678_10000017 Ga0207678_1000001782 224
541 3300026075 Ga0207708_10001248 Ga0207708_100012488 224
542 3300026078 Ga0207702_10927241 Ga0207702_109272412 224
543 3300026088 Ga0207641_10024899 Ga0207641_100248992 224
544 3300026095 Ga0207676_10558598 Ga0207676_105585982 224
545 3300026116 Ga0207674_10000437 Ga0207674_1000043731 224
546 3300026118 Ga0207675_100000771 Ga0207675_1000007715 224
547 3300026121 Ga0207683_10000030 Ga0207683_1000003018 224
548 3300026142 Ga0207698_11114775 Ga0207698_111147751 224
549 3300028380 Ga0268265_10026606 Ga0268265_100266063 224
550 3300034816 Ga0373930_0026235 Ga0373930_0026235_279_953 224
551 3300034817 Ga0373948_0065358 Ga0373948_0065358_118_792 224
552 3300035084 Ga0373928_0021642 Ga0373928_0021642_529_1203 224
553 3300035090 Ga0373949_0028250 Ga0373949_0028250_180_854 224
554 3300038996 Ga0242420_011176 Ga0242420_011176_482_1156 224
555 3300048903 Ga0496100_0001066 Ga0496100_0001066_3695_4369 224
556 3300048904 Ga0496101_0042695 Ga0496101_0042695_2138_2812 224
557 3300048904 Ga0496101_0500236 Ga0496101_0500236_109_819 224
558 3300048905 Ga0496102_0008755 Ga0496102_0008755_1751_2425 224
559 3300048906 Ga0496103_0001043 Ga0496103_0001043_10203_10877 224
560 3300048907 Ga0496104_0490681 Ga0496104_0490681_309_983 224
561 3300048908 Ga0496105_0026238 Ga0496105_0026238_380_1054 224
562 3300048909 Ga0496106_0014625 Ga0496106_0014625_3697_4371 224
563 3300048910 Ga0496107_0040826 Ga0496107_0040826_2629_3303 224
564 3300048910 Ga0496107_0045801 Ga0496107_0045801_1021_1731 224
565 3300048911 Ga0496108_0089462 Ga0496108_0089462_192_866 224
566 3300048912 Ga0496109_0063532 Ga0496109_0063532_1243_1917 224
567 3300048913 Ga0496110_0014474 Ga0496110_0014474_2182_2856 224
568 3300048914 Ga0496111_0024744 Ga0496111_0024744_1971_2645 224
569 3300048916 Ga0496113_0042523 Ga0496113_0042523_586_1260 224
570 3300048917 Ga0496114_0002707 Ga0496114_0002707_7957_8631 224
571 3300048918 Ga0496115_0690107 Ga0496115_0690107_93_767 224
572 3300050507 nmdc:mga05p37_152272_c1 nmdc:mga05p37_152272_c1_531_1205 224
573 3300050507 nmdc:mga05p37_39808_c1 nmdc:mga05p37_39808_c1_2372_3046 224
574 3300050510 nmdc:mga06r32_13764_c1 nmdc:mga06r32_13764_c1_746_1420 224
575 3300050511 nmdc:mga08y16_104157_c1 nmdc:mga08y16_104157_c1_2157_2831 224
576 3300050512 nmdc:mga0n895_380869_c1 nmdc:mga0n895_380869_c1_610_1284 224
577 3300050514 nmdc:mga08x19_16357_c1 nmdc:mga08x19_16357_c1_2403_3077 224
578 3300050515 nmdc:mga0a205_7774_c1 nmdc:mga0a205_7774_c1_6761_7435 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

48

121

0.9

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

150

245

0.87

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

39

120

0.82

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

46

126

0.79

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

167

244

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8635 5 210
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8625 3 213
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.858 5 215
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8542 3 213
4isd-assembly2.cif.gz_B crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione 0.8491 5 214
ID Description Score Start End Superfamily
4isdD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8934 5 83 3.40.30.10
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8779 3 81 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8738 21 83 3.40.30.10
4mp4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8698 5 86 3.40.30.10
3fhsB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8697 3 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N0DX65-F1-model_v4 Glutathione S-transferase family protein 0.9855 1 222 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A348G0D0-F1-model_v4 Glutathione S-transferase 0.9841 6 212 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A679JMZ2-F1-model_v4 Dichloromethane dehalogenase (EC 4.5.1.3) 0.9835 6 212 GO:0004364
GO:0006559
GO:0006749
GO:0016034
GO:0018834
AF-A0A522M3S8-F1-model_v4 Glutathione S-transferase family protein 0.9832 5 214 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A1Q7VK14-F1-model_v4 GST N-terminal domain-containing protein 0.9828 6 214 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
95.01 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map