F465727
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 303 | 578 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10562475|Ga0157378_105624752 |
| Length | 257 |
| Sequence | MARLAPVARPGCIFGSYPLTGRTLRIAGINCKERFVARYTLVVGTRNWSSWSLRPFVALKATAAPHEIIDIRLRQTESPTTREQILKHSPAGKVPVLKIAEGDSTLTVWDSLAICETLAERHPEAGLWPRDAGARAIARSYACEMHSGFPDLRQQLSMNFARKREMPELREETKAQVARILEAWEWALVTYKGEYLFGNLSVADCMYAPVVSRFFTYGVETSERVGDYMDRVMALPAMQEWLSAAEAEVAAGLSETY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0 |
| Rhizoplane | 4.67 |
| Rhizosphere | 91.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10034217 | 3300001989 | Bacteria | 1733 |
| 2 | JGI24738J21930_10008485 | 3300002075 | Bacteria | 2336 |
| 3 | Ga0070658_10048858 | 3300005327 | Bacteria | 3426 |
| 4 | Ga0070658_10079785 | 3300005327 | Unclassified | 2688 |
| 5 | Ga0070658_10166052 | 3300005327 | Bacteria | 1853 |
| 6 | Ga0070676_10053362 | 3300005328 | Bacteria | 2381 |
| 7 | Ga0070676_10183050 | 3300005328 | Unclassified | 1363 |
| 8 | Ga0070676_10435362 | 3300005328 | Unclassified | 919 |
| 9 | Ga0070683_100044123 | 3300005329 | Bacteria | 4110 |
| 10 | Ga0070690_100000303 | 3300005330 | Bacteria | 25376 |
| 11 | Ga0070670_100027428 | 3300005331 | Bacteria | 4899 |
| 12 | Ga0070670_100332435 | 3300005331 | Unclassified | 1333 |
| 13 | Ga0068869_100047921 | 3300005334 | Bacteria | 3088 |
| 14 | Ga0068869_100078006 | 3300005334 | Bacteria | 2466 |
| 15 | Ga0070666_10002091 | 3300005335 | Bacteria | 12135 |
| 16 | Ga0070666_10014297 | 3300005335 | Bacteria | 5053 |
| 17 | Ga0070666_10039456 | 3300005335 | Bacteria | 3148 |
| 18 | Ga0070666_10041710 | 3300005335 | Unclassified | 3068 |
| 19 | Ga0070666_10143456 | 3300005335 | Unclassified | 1664 |
| 20 | Ga0070680_100000248 | 3300005336 | Bacteria | 35598 |
| 21 | Ga0070680_100052690 | 3300005336 | Bacteria | 3320 |
| 22 | Ga0070680_100190303 | 3300005336 | Bacteria | 1729 |
| 23 | Ga0070682_100081450 | 3300005337 | Bacteria | 2096 |
| 24 | Ga0070682_100498037 | 3300005337 | Unclassified | 943 |
| 25 | Ga0068868_100258498 | 3300005338 | Bacteria | 1468 |
| 26 | Ga0070660_100044609 | 3300005339 | Bacteria | 3392 |
| 27 | Ga0070660_100077666 | 3300005339 | Unclassified | 2602 |
| 28 | Ga0070660_100729802 | 3300005339 | Unclassified | 831 |
| 29 | Ga0070689_100021918 | 3300005340 | Bacteria | 4762 |
| 30 | Ga0070691_10001279 | 3300005341 | Bacteria | 10635 |
| 31 | Ga0070691_10001501 | 3300005341 | Bacteria | 10014 |
| 32 | Ga0070687_100001187 | 3300005343 | Bacteria | 9018 |
| 33 | Ga0070661_100003828 | 3300005344 | Bacteria | 10359 |
| 34 | Ga0070661_100113578 | 3300005344 | Bacteria | 2024 |
| 35 | Ga0070661_100286005 | 3300005344 | Bacteria | 1280 |
| 36 | Ga0070661_100440953 | 3300005344 | Unclassified | 1035 |
| 37 | Ga0070692_10002001 | 3300005345 | Bacteria | 7729 |
| 38 | Ga0070668_100020364 | 3300005347 | Bacteria | 5005 |
| 39 | Ga0070668_100086002 | 3300005347 | Bacteria | 2472 |
| 40 | Ga0070668_100344443 | 3300005347 | Unclassified | 1260 |
| 41 | Ga0070668_100566660 | 3300005347 | Bacteria | 990 |
| 42 | Ga0070669_100000391 | 3300005353 | Bacteria | 33788 |
| 43 | Ga0070675_100102846 | 3300005354 | Bacteria | 2407 |
| 44 | Ga0070675_100235175 | 3300005354 | Unclassified | 1599 |
| 45 | Ga0070671_100013327 | 3300005355 | Bacteria | 6627 |
| 46 | Ga0070674_100000430 | 3300005356 | Bacteria | 21209 |
| 47 | Ga0070674_100173469 | 3300005356 | Bacteria | 1646 |
| 48 | Ga0070673_100005733 | 3300005364 | Bacteria | 7987 |
| 49 | Ga0070673_100094029 | 3300005364 | Bacteria | 2456 |
| 50 | Ga0070673_100127595 | 3300005364 | Unclassified | 2130 |
| 51 | Ga0070688_100002877 | 3300005365 | Bacteria | 8781 |
| 52 | Ga0070688_100156657 | 3300005365 | Bacteria | 1561 |
| 53 | Ga0070659_100026803 | 3300005366 | Bacteria | 4436 |
| 54 | Ga0070667_100000918 | 3300005367 | Bacteria | 27217 |
| 55 | Ga0070709_10004467 | 3300005434 | Bacteria | 7548 |
| 56 | Ga0070709_10079605 | 3300005434 | Bacteria | 2135 |
| 57 | Ga0070709_10461642 | 3300005434 | Unclassified | 958 |
| 58 | Ga0070714_100007818 | 3300005435 | Bacteria | 8330 |
| 59 | Ga0070714_100052171 | 3300005435 | Bacteria | 3488 |
| 60 | Ga0070714_100236514 | 3300005435 | Bacteria | 1685 |
| 61 | Ga0070713_100000006 | 3300005436 | Bacteria | 190565 |
| 62 | Ga0070713_100046176 | 3300005436 | Bacteria | 3573 |
| 63 | Ga0070713_100334252 | 3300005436 | Bacteria | 1402 |
| 64 | Ga0070710_10044685 | 3300005437 | Bacteria | 2459 |
| 65 | Ga0070710_10427560 | 3300005437 | Unclassified | 893 |
| 66 | Ga0070701_10084637 | 3300005438 | Bacteria | 1725 |
| 67 | Ga0070711_100006358 | 3300005439 | Bacteria | 7118 |
| 68 | Ga0070711_100397648 | 3300005439 | Bacteria | 1118 |
| 69 | Ga0070705_100001203 | 3300005440 | Bacteria | 14092 |
| 70 | Ga0070705_100099530 | 3300005440 | Unclassified | 1832 |
| 71 | Ga0070700_100029758 | 3300005441 | Bacteria | 3258 |
| 72 | Ga0070694_100003505 | 3300005444 | Bacteria | 9382 |
| 73 | Ga0070663_100000890 | 3300005455 | Bacteria | 16233 |
| 74 | Ga0070663_100104446 | 3300005455 | Bacteria | 2119 |
| 75 | Ga0070678_100010621 | 3300005456 | Bacteria | 5636 |
| 76 | Ga0070678_100058667 | 3300005456 | Unclassified | 2826 |
| 77 | Ga0070678_100376014 | 3300005456 | Bacteria | 1228 |
| 78 | Ga0070662_100019029 | 3300005457 | Bacteria | 4656 |
| 79 | Ga0070662_100346012 | 3300005457 | Bacteria | 1217 |
| 80 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 81 | Ga0070681_10431389 | 3300005458 | Bacteria | 1230 |
| 82 | Ga0070681_10475245 | 3300005458 | Unclassified | 1162 |
| 83 | Ga0068867_100148322 | 3300005459 | Bacteria | 1840 |
| 84 | Ga0070685_10373744 | 3300005466 | Bacteria | 980 |
| 85 | Ga0070699_100058883 | 3300005518 | Bacteria | 3328 |
| 86 | Ga0070679_100000035 | 3300005530 | Bacteria | 103095 |
| 87 | Ga0070679_100035909 | 3300005530 | Bacteria | 4918 |
| 88 | Ga0070679_100081129 | 3300005530 | Bacteria | 3233 |
| 89 | Ga0070684_100046711 | 3300005535 | Bacteria | 3752 |
| 90 | Ga0070684_100120725 | 3300005535 | Bacteria | 2358 |
| 91 | Ga0070697_100058237 | 3300005536 | Bacteria | 3144 |
| 92 | Ga0068853_100012410 | 3300005539 | Bacteria | 6931 |
| 93 | Ga0070672_100020553 | 3300005543 | Bacteria | 4817 |
| 94 | Ga0070672_100267994 | 3300005543 | Bacteria | 1441 |
| 95 | Ga0070686_100004608 | 3300005544 | Bacteria | 7597 |
| 96 | Ga0070695_100027254 | 3300005545 | Bacteria | 3538 |
| 97 | Ga0070695_100244029 | 3300005545 | Unclassified | 1304 |
| 98 | Ga0070696_100000728 | 3300005546 | Bacteria | 21021 |
| 99 | Ga0070693_100031583 | 3300005547 | Bacteria | 2904 |
| 100 | Ga0070693_100032550 | 3300005547 | Bacteria | 2868 |
| 101 | Ga0070665_100003166 | 3300005548 | Bacteria | 17704 |
| 102 | Ga0070665_100043851 | 3300005548 | Bacteria | 4493 |
| 103 | Ga0070665_100051235 | 3300005548 | Bacteria | 4140 |
| 104 | Ga0070665_100072055 | 3300005548 | Bacteria | 3463 |
| 105 | Ga0070665_100078037 | 3300005548 | Bacteria | 3318 |
| 106 | Ga0070704_100006503 | 3300005549 | Bacteria | 6887 |
| 107 | Ga0068855_100007702 | 3300005563 | Bacteria | 13004 |
| 108 | Ga0068855_100041948 | 3300005563 | Bacteria | 5422 |
| 109 | Ga0068855_100047427 | 3300005563 | Bacteria | 5075 |
| 110 | Ga0068855_100480985 | 3300005563 | Bacteria | 1352 |
| 111 | Ga0070664_100006680 | 3300005564 | Bacteria | 9303 |
| 112 | Ga0068857_100000387 | 3300005577 | Bacteria | 30877 |
| 113 | Ga0068857_100050602 | 3300005577 | Bacteria | 3685 |
| 114 | Ga0068857_100170514 | 3300005577 | Bacteria | 1978 |
| 115 | Ga0068854_100005281 | 3300005578 | Bacteria | 8153 |
| 116 | Ga0068854_100015672 | 3300005578 | Bacteria | 5031 |
| 117 | Ga0068856_100000280 | 3300005614 | Bacteria | 55488 |
| 118 | Ga0068856_100023115 | 3300005614 | Bacteria | 6046 |
| 119 | Ga0068856_100099431 | 3300005614 | Bacteria | 2900 |
| 120 | Ga0068856_100515825 | 3300005614 | Unclassified | 1216 |
| 121 | Ga0070702_100000098 | 3300005615 | Bacteria | 25877 |
| 122 | Ga0070702_100156848 | 3300005615 | Bacteria | 1467 |
| 123 | Ga0070702_100378648 | 3300005615 | Bacteria | 1005 |
| 124 | Ga0068852_100003875 | 3300005616 | Bacteria | 10509 |
| 125 | Ga0068852_101039281 | 3300005616 | Unclassified | 838 |
| 126 | Ga0068859_100012414 | 3300005617 | Bacteria | 8571 |
| 127 | Ga0068859_100408854 | 3300005617 | Unclassified | 1453 |
| 128 | Ga0068859_100448549 | 3300005617 | Bacteria | 1386 |
| 129 | Ga0068864_100024278 | 3300005618 | Bacteria | 5099 |
| 130 | Ga0068864_100437601 | 3300005618 | Unclassified | 1248 |
| 131 | Ga0068866_10065108 | 3300005718 | Bacteria | 1906 |
| 132 | Ga0068861_100021324 | 3300005719 | Bacteria | 4656 |
| 133 | Ga0068861_100135574 | 3300005719 | Bacteria | 2003 |
| 134 | Ga0068861_100183218 | 3300005719 | Bacteria | 1745 |
| 135 | Ga0068851_10059076 | 3300005834 | Bacteria | 1961 |
| 136 | Ga0068863_100005195 | 3300005841 | Bacteria | 12845 |
| 137 | Ga0068863_100012930 | 3300005841 | Bacteria | 8050 |
| 138 | Ga0068858_100020434 | 3300005842 | Bacteria | 6191 |
| 139 | Ga0068858_100059040 | 3300005842 | Bacteria | 3545 |
| 140 | Ga0068858_100247542 | 3300005842 | Bacteria | 1693 |
| 141 | Ga0068860_100006370 | 3300005843 | Bacteria | 11848 |
| 142 | Ga0068860_100136296 | 3300005843 | Bacteria | 2357 |
| 143 | Ga0068862_100624367 | 3300005844 | Bacteria | 1037 |
| 144 | Ga0068862_101225313 | 3300005844 | Bacteria | 750 |
| 145 | Ga0081455_10017063 | 3300005937 | Bacteria | 6978 |
| 146 | Ga0075365_10011457 | 3300006038 | Bacteria | 5214 |
| 147 | Ga0075368_10004349 | 3300006042 | Bacteria | 4792 |
| 148 | Ga0075363_100012071 | 3300006048 | Bacteria | 4154 |
| 149 | Ga0075364_10001704 | 3300006051 | Bacteria | 12083 |
| 150 | Ga0075432_10056968 | 3300006058 | Bacteria | 1386 |
| 151 | Ga0070716_100171947 | 3300006173 | Unclassified | 1414 |
| 152 | Ga0070712_100000184 | 3300006175 | Bacteria | 34651 |
| 153 | Ga0070712_100001132 | 3300006175 | Bacteria | 16067 |
| 154 | Ga0075367_10022463 | 3300006178 | Bacteria | 3538 |
| 155 | Ga0075367_10070785 | 3300006178 | Bacteria | 2097 |
| 156 | Ga0097621_100000267 | 3300006237 | Bacteria | 35345 |
| 157 | Ga0097621_100052369 | 3300006237 | Bacteria | 3325 |
| 158 | Ga0097621_100101455 | 3300006237 | Bacteria | 2421 |
| 159 | Ga0097621_100105690 | 3300006237 | Bacteria | 2374 |
| 160 | Ga0097621_100173868 | 3300006237 | Unclassified | 1858 |
| 161 | Ga0097621_100174686 | 3300006237 | Bacteria | 1854 |
| 162 | Ga0068871_100001741 | 3300006358 | Bacteria | 14665 |
| 163 | Ga0068871_100228595 | 3300006358 | Unclassified | 1614 |
| 164 | Ga0075428_100620035 | 3300006844 | Unclassified | 1155 |
| 165 | Ga0075430_100236159 | 3300006846 | Bacteria | 1515 |
| 166 | Ga0075431_100024570 | 3300006847 | Bacteria | 6176 |
| 167 | Ga0075431_100574997 | 3300006847 | Bacteria | 1113 |
| 168 | Ga0075433_10139544 | 3300006852 | Bacteria | 2154 |
| 169 | Ga0075434_100069525 | 3300006871 | Bacteria | 3510 |
| 170 | Ga0075429_100207694 | 3300006880 | Bacteria | 1716 |
| 171 | Ga0075429_100499174 | 3300006880 | Bacteria | 1066 |
| 172 | Ga0068865_100024141 | 3300006881 | Bacteria | 3986 |
| 173 | Ga0068865_100224322 | 3300006881 | Unclassified | 1471 |
| 174 | Ga0075436_100001960 | 3300006914 | Bacteria | 14189 |
| 175 | Ga0075436_100054680 | 3300006914 | Bacteria | 2756 |
| 176 | Ga0075436_100061914 | 3300006914 | Bacteria | 2586 |
| 177 | Ga0097620_100012416 | 3300006931 | Bacteria | 8571 |
| 178 | Ga0097620_100408867 | 3300006931 | Unclassified | 1453 |
| 179 | Ga0097620_100448533 | 3300006931 | Bacteria | 1386 |
| 180 | Ga0075435_100162931 | 3300007076 | Bacteria | 1879 |
| 181 | Ga0105251_10033581 | 3300009011 | Bacteria | 2545 |
| 182 | Ga0105250_10104762 | 3300009092 | Unclassified | 1156 |
| 183 | Ga0105240_10003264 | 3300009093 | Bacteria | 25361 |
| 184 | Ga0105240_10054893 | 3300009093 | Bacteria | 4990 |
| 185 | Ga0105240_10078368 | 3300009093 | Bacteria | 4069 |
| 186 | Ga0105240_10123169 | 3300009093 | Bacteria | 3120 |
| 187 | Ga0105240_10320643 | 3300009093 | Bacteria | 1766 |
| 188 | Ga0105240_10763421 | 3300009093 | Unclassified | 1050 |
| 189 | Ga0111539_10560083 | 3300009094 | Bacteria | 1331 |
| 190 | Ga0111539_11595329 | 3300009094 | Bacteria | 757 |
| 191 | Ga0105245_10019574 | 3300009098 | Bacteria | 5929 |
| 192 | Ga0105245_10019845 | 3300009098 | Bacteria | 5891 |
| 193 | Ga0105245_10044899 | 3300009098 | Unclassified | 3945 |
| 194 | Ga0105245_10125755 | 3300009098 | Bacteria | 2400 |
| 195 | Ga0105245_10611383 | 3300009098 | Bacteria | 1117 |
| 196 | Ga0105247_10012277 | 3300009101 | Bacteria | 5146 |
| 197 | Ga0114129_10038332 | 3300009147 | Bacteria | 6762 |
| 198 | Ga0105243_10006802 | 3300009148 | Bacteria | 8818 |
| 199 | Ga0105243_10028300 | 3300009148 | Bacteria | 4301 |
| 200 | Ga0105243_10519514 | 3300009148 | Bacteria | 1132 |
| 201 | Ga0105241_10002894 | 3300009174 | Bacteria | 12839 |
| 202 | Ga0105241_10003267 | 3300009174 | Bacteria | 12064 |
| 203 | Ga0105241_10058685 | 3300009174 | Bacteria | 2956 |
| 204 | Ga0105241_10061391 | 3300009174 | Bacteria | 2894 |
| 205 | Ga0105241_10062657 | 3300009174 | Bacteria | 2867 |
| 206 | Ga0105241_10110217 | 3300009174 | Unclassified | 2202 |
| 207 | Ga0105242_10005740 | 3300009176 | Bacteria | 9567 |
| 208 | Ga0105248_10011402 | 3300009177 | Bacteria | 9799 |
| 209 | Ga0105248_10019596 | 3300009177 | Bacteria | 7488 |
| 210 | Ga0105248_10250001 | 3300009177 | Bacteria | 1996 |
| 211 | Ga0105237_10004528 | 3300009545 | Bacteria | 16061 |
| 212 | Ga0105237_10005625 | 3300009545 | Bacteria | 14119 |
| 213 | Ga0105237_10024196 | 3300009545 | Bacteria | 6214 |
| 214 | Ga0105237_10065074 | 3300009545 | Bacteria | 3642 |
| 215 | Ga0105237_10195748 | 3300009545 | Bacteria | 2021 |
| 216 | Ga0105238_10028649 | 3300009551 | Bacteria | 5673 |
| 217 | Ga0105238_10355952 | 3300009551 | Bacteria | 1453 |
| 218 | Ga0105249_10006469 | 3300009553 | Bacteria | 10189 |
| 219 | Ga0105249_10060208 | 3300009553 | Bacteria | 3483 |
| 220 | Ga0105239_10000540 | 3300010375 | Bacteria | 54714 |
| 221 | Ga0105239_10014435 | 3300010375 | Bacteria | 8767 |
| 222 | Ga0105239_10040642 | 3300010375 | Bacteria | 5096 |
| 223 | Ga0105239_10061226 | 3300010375 | Bacteria | 4131 |
| 224 | Ga0105239_10296970 | 3300010375 | Bacteria | 1819 |
| 225 | Ga0105239_10745316 | 3300010375 | Bacteria | 1121 |
| 226 | Ga0105246_10006915 | 3300011119 | Bacteria | 6942 |
| 227 | Ga0105246_10039845 | 3300011119 | Bacteria | 3168 |
| 228 | Ga0105246_10047597 | 3300011119 | Unclassified | 2929 |
| 229 | Ga0157323_1001688 | 3300012495 | Bacteria | 1142 |
| 230 | Ga0157373_10001321 | 3300013100 | Bacteria | 18966 |
| 231 | Ga0157373_10407621 | 3300013100 | Unclassified | 975 |
| 232 | Ga0157371_10192116 | 3300013102 | Unclassified | 1462 |
| 233 | Ga0157370_10000438 | 3300013104 | Bacteria | 51999 |
| 234 | Ga0157370_10086430 | 3300013104 | Bacteria | 2946 |
| 235 | Ga0157370_10120500 | 3300013104 | Bacteria | 2450 |
| 236 | Ga0157369_10003719 | 3300013105 | Bacteria | 18134 |
| 237 | Ga0157369_10020645 | 3300013105 | Bacteria | 7366 |
| 238 | Ga0157369_10062984 | 3300013105 | Bacteria | 3996 |
| 239 | Ga0157369_10245378 | 3300013105 | Unclassified | 1870 |
| 240 | Ga0157369_10393644 | 3300013105 | Unclassified | 1437 |
| 241 | Ga0157374_10052051 | 3300013296 | Bacteria | 3812 |
| 242 | Ga0157374_10054370 | 3300013296 | Bacteria | 3735 |
| 243 | Ga0157374_10317600 | 3300013296 | Bacteria | 1543 |
| 244 | Ga0157378_10017766 | 3300013297 | Bacteria | 6244 |
| 245 | Ga0157378_10127937 | 3300013297 | Bacteria | 2348 |
| 246 | Ga0157378_10344892 | 3300013297 | Bacteria | 1453 |
| 247 | Ga0157378_10562475 | 3300013297 | Unclassified | 1147 |
| 248 | Ga0163162_10002450 | 3300013306 | Bacteria | 17500 |
| 249 | Ga0163162_10027271 | 3300013306 | Bacteria | 5647 |
| 250 | Ga0163162_10099333 | 3300013306 | Bacteria | 3001 |
| 251 | Ga0163162_10722906 | 3300013306 | Unclassified | 1116 |
| 252 | Ga0157372_10000133 | 3300013307 | Bacteria | 81875 |
| 253 | Ga0157372_10036446 | 3300013307 | Bacteria | 5420 |
| 254 | Ga0157372_10097370 | 3300013307 | Bacteria | 3355 |
| 255 | Ga0157375_10185254 | 3300013308 | Bacteria | 2235 |
| 256 | Ga0157375_10594043 | 3300013308 | Bacteria | 1267 |
| 257 | Ga0163163_10183792 | 3300014325 | Bacteria | 2138 |
| 258 | Ga0163163_10250185 | 3300014325 | Bacteria | 1823 |
| 259 | Ga0163163_10445931 | 3300014325 | Unclassified | 1354 |
| 260 | Ga0163163_10653341 | 3300014325 | Unclassified | 1115 |
| 261 | Ga0157380_10001318 | 3300014326 | Bacteria | 16106 |
| 262 | Ga0157380_10093665 | 3300014326 | Unclassified | 2484 |
| 263 | Ga0157377_10004069 | 3300014745 | Bacteria | 6673 |
| 264 | Ga0157379_10002828 | 3300014968 | Bacteria | 14629 |
| 265 | Ga0157379_10026293 | 3300014968 | Bacteria | 5181 |
| 266 | Ga0157379_11005923 | 3300014968 | Unclassified | 795 |
| 267 | Ga0182007_10036081 | 3300015262 | Bacteria | 1664 |
| 268 | Ga0163161_10001599 | 3300017792 | Bacteria | 16703 |
| 269 | Ga0163161_10005012 | 3300017792 | Bacteria | 9215 |
| 270 | Ga0163161_10080282 | 3300017792 | Bacteria | 2400 |
| 271 | Ga0213874_10002204 | 3300021377 | Bacteria | 4141 |
| 272 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 273 | Ga0209233_1001131 | 3300025261 | Bacteria | 10884 |
| 274 | Ga0207692_10018036 | 3300025898 | Bacteria | 3160 |
| 275 | Ga0207642_10021956 | 3300025899 | Bacteria | 2523 |
| 276 | Ga0207710_10002160 | 3300025900 | Bacteria | 9241 |
| 277 | Ga0207710_10019905 | 3300025900 | Bacteria | 2865 |
| 278 | Ga0207688_10002567 | 3300025901 | Bacteria | 9826 |
| 279 | Ga0207680_10040977 | 3300025903 | Bacteria | 2699 |
| 280 | Ga0207680_10083358 | 3300025903 | Bacteria | 2015 |
| 281 | Ga0207685_10001101 | 3300025905 | Bacteria | 5355 |
| 282 | Ga0207699_10001108 | 3300025906 | Bacteria | 12731 |
| 283 | Ga0207699_10002019 | 3300025906 | Bacteria | 9585 |
| 284 | Ga0207699_10253057 | 3300025906 | Bacteria | 1215 |
| 285 | Ga0207645_10036296 | 3300025907 | Bacteria | 3165 |
| 286 | Ga0207645_10056556 | 3300025907 | Bacteria | 2504 |
| 287 | Ga0207705_10020038 | 3300025909 | Bacteria | 4782 |
| 288 | Ga0207705_10073109 | 3300025909 | Bacteria | 2487 |
| 289 | Ga0207654_10004909 | 3300025911 | Bacteria | 6772 |
| 290 | Ga0207654_10034260 | 3300025911 | Bacteria | 2820 |
| 291 | Ga0207654_10038844 | 3300025911 | Bacteria | 2673 |
| 292 | Ga0207654_10051134 | 3300025911 | Bacteria | 2377 |
| 293 | Ga0207654_10315095 | 3300025911 | Bacteria | 1068 |
| 294 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 295 | Ga0207707_10029312 | 3300025912 | Bacteria | 4811 |
| 296 | Ga0207707_10090588 | 3300025912 | Bacteria | 2673 |
| 297 | Ga0207707_10359464 | 3300025912 | Unclassified | 1254 |
| 298 | Ga0207695_10034041 | 3300025913 | Bacteria | 5547 |
| 299 | Ga0207695_10070019 | 3300025913 | Bacteria | 3588 |
| 300 | Ga0207695_10070852 | 3300025913 | Bacteria | 3562 |
| 301 | Ga0207695_10218241 | 3300025913 | Bacteria | 1815 |
| 302 | Ga0207695_10242771 | 3300025913 | Unclassified | 1702 |
| 303 | Ga0207695_10342769 | 3300025913 | Bacteria | 1382 |
| 304 | Ga0207695_10545755 | 3300025913 | Bacteria | 1041 |
| 305 | Ga0207671_10004743 | 3300025914 | Bacteria | 12828 |
| 306 | Ga0207671_10032772 | 3300025914 | Bacteria | 3866 |
| 307 | Ga0207671_10134415 | 3300025914 | Bacteria | 1901 |
| 308 | Ga0207693_10000062 | 3300025915 | Bacteria | 92689 |
| 309 | Ga0207693_10000733 | 3300025915 | Bacteria | 29584 |
| 310 | Ga0207663_10000652 | 3300025916 | Bacteria | 15374 |
| 311 | Ga0207660_10000240 | 3300025917 | Bacteria | 35551 |
| 312 | Ga0207660_10151309 | 3300025917 | Bacteria | 1783 |
| 313 | Ga0207660_10428927 | 3300025917 | Unclassified | 1067 |
| 314 | Ga0207660_10711211 | 3300025917 | Bacteria | 819 |
| 315 | Ga0207662_10005248 | 3300025918 | Bacteria | 6879 |
| 316 | Ga0207657_10000023 | 3300025919 | Bacteria | 152701 |
| 317 | Ga0207657_10080025 | 3300025919 | Bacteria | 2748 |
| 318 | Ga0207657_10204835 | 3300025919 | Unclassified | 1585 |
| 319 | Ga0207649_10086074 | 3300025920 | Bacteria | 2047 |
| 320 | Ga0207649_10663318 | 3300025920 | Bacteria | 807 |
| 321 | Ga0207652_10000932 | 3300025921 | Bacteria | 27504 |
| 322 | Ga0207652_10067029 | 3300025921 | Bacteria | 3112 |
| 323 | Ga0207694_10070369 | 3300025924 | Bacteria | 2733 |
| 324 | Ga0207694_10074161 | 3300025924 | Bacteria | 2663 |
| 325 | Ga0207694_10239882 | 3300025924 | Bacteria | 1481 |
| 326 | Ga0207694_10561868 | 3300025924 | Unclassified | 958 |
| 327 | Ga0207650_10102919 | 3300025925 | Bacteria | 2201 |
| 328 | Ga0207650_10129833 | 3300025925 | Bacteria | 1971 |
| 329 | Ga0207659_10116423 | 3300025926 | Bacteria | 2041 |
| 330 | Ga0207659_10186751 | 3300025926 | Unclassified | 1646 |
| 331 | Ga0207687_10032497 | 3300025927 | Unclassified | 3534 |
| 332 | Ga0207687_10580846 | 3300025927 | Unclassified | 943 |
| 333 | Ga0207700_10000020 | 3300025928 | Bacteria | 176182 |
| 334 | Ga0207700_10273052 | 3300025928 | Bacteria | 1452 |
| 335 | Ga0207664_10044073 | 3300025929 | Bacteria | 3492 |
| 336 | Ga0207664_10479792 | 3300025929 | Unclassified | 1112 |
| 337 | Ga0207644_10022454 | 3300025931 | Bacteria | 4311 |
| 338 | Ga0207690_10003754 | 3300025932 | Bacteria | 9005 |
| 339 | Ga0207706_10000019 | 3300025933 | Bacteria | 167592 |
| 340 | Ga0207706_10073444 | 3300025933 | Bacteria | 3008 |
| 341 | Ga0207706_10336835 | 3300025933 | Bacteria | 1312 |
| 342 | Ga0207709_10030603 | 3300025935 | Bacteria | 3133 |
| 343 | Ga0207709_10057368 | 3300025935 | Bacteria | 2414 |
| 344 | Ga0207670_10011387 | 3300025936 | Bacteria | 5161 |
| 345 | Ga0207669_10015302 | 3300025937 | Bacteria | 3866 |
| 346 | Ga0207669_10387811 | 3300025937 | Unclassified | 1090 |
| 347 | Ga0207704_10075725 | 3300025938 | Bacteria | 2153 |
| 348 | Ga0207704_10143532 | 3300025938 | Bacteria | 1674 |
| 349 | Ga0207665_10000205 | 3300025939 | Bacteria | 39821 |
| 350 | Ga0207691_10003337 | 3300025940 | Bacteria | 15626 |
| 351 | Ga0207691_10135389 | 3300025940 | Bacteria | 2173 |
| 352 | Ga0207711_10012312 | 3300025941 | Bacteria | 7110 |
| 353 | Ga0207711_10017832 | 3300025941 | Bacteria | 5898 |
| 354 | Ga0207711_10270665 | 3300025941 | Unclassified | 1563 |
| 355 | Ga0207689_10069797 | 3300025942 | Bacteria | 2887 |
| 356 | Ga0207689_10093276 | 3300025942 | Bacteria | 2473 |
| 357 | Ga0207689_10496181 | 3300025942 | Unclassified | 1023 |
| 358 | Ga0207679_10063991 | 3300025945 | Bacteria | 2747 |
| 359 | Ga0207667_10029859 | 3300025949 | Bacteria | 5906 |
| 360 | Ga0207667_10168195 | 3300025949 | Bacteria | 2253 |
| 361 | Ga0207667_10251138 | 3300025949 | Bacteria | 1809 |
| 362 | Ga0207667_10456050 | 3300025949 | Bacteria | 1299 |
| 363 | Ga0207651_10002795 | 3300025960 | Bacteria | 8389 |
| 364 | Ga0207651_10003035 | 3300025960 | Bacteria | 8143 |
| 365 | Ga0207651_10073042 | 3300025960 | Bacteria | 2438 |
| 366 | Ga0207712_10006286 | 3300025961 | Bacteria | 7493 |
| 367 | Ga0207668_10172976 | 3300025972 | Unclassified | 1696 |
| 368 | Ga0207668_10338369 | 3300025972 | Bacteria | 1254 |
| 369 | Ga0207668_10616449 | 3300025972 | Unclassified | 946 |
| 370 | Ga0207640_10020303 | 3300025981 | Bacteria | 3943 |
| 371 | Ga0207658_10024089 | 3300025986 | Bacteria | 4254 |
| 372 | Ga0207658_10182857 | 3300025986 | Unclassified | 1736 |
| 373 | Ga0207703_10032181 | 3300026035 | Bacteria | 4150 |
| 374 | Ga0207703_10094549 | 3300026035 | Bacteria | 2520 |
| 375 | Ga0207639_10012778 | 3300026041 | Bacteria | 5858 |
| 376 | Ga0207639_10089612 | 3300026041 | Bacteria | 2458 |
| 377 | Ga0207639_10229287 | 3300026041 | Bacteria | 1609 |
| 378 | Ga0207678_10000017 | 3300026067 | Bacteria | 135871 |
| 379 | Ga0207678_10121592 | 3300026067 | Bacteria | 2228 |
| 380 | Ga0207708_10001248 | 3300026075 | Bacteria | 19171 |
| 381 | Ga0207708_10087743 | 3300026075 | Bacteria | 2396 |
| 382 | Ga0207708_10265840 | 3300026075 | Bacteria | 1385 |
| 383 | Ga0207702_10000030 | 3300026078 | Bacteria | 178718 |
| 384 | Ga0207702_10082123 | 3300026078 | Bacteria | 2801 |
| 385 | Ga0207702_10082741 | 3300026078 | Bacteria | 2791 |
| 386 | Ga0207702_10206284 | 3300026078 | Bacteria | 1825 |
| 387 | Ga0207702_10927241 | 3300026078 | Unclassified | 863 |
| 388 | Ga0207641_10024899 | 3300026088 | Bacteria | 4934 |
| 389 | Ga0207641_10065083 | 3300026088 | Bacteria | 3117 |
| 390 | Ga0207648_10005670 | 3300026089 | Bacteria | 12530 |
| 391 | Ga0207648_10020996 | 3300026089 | Bacteria | 5878 |
| 392 | Ga0207676_10558598 | 3300026095 | Unclassified | 1094 |
| 393 | Ga0207676_10798195 | 3300026095 | Unclassified | 921 |
| 394 | Ga0207674_10000051 | 3300026116 | Bacteria | 116114 |
| 395 | Ga0207674_10000437 | 3300026116 | Bacteria | 53986 |
| 396 | Ga0207674_10586746 | 3300026116 | Bacteria | 1077 |
| 397 | Ga0207674_10610376 | 3300026116 | Bacteria | 1054 |
| 398 | Ga0207675_100000771 | 3300026118 | Bacteria | 31947 |
| 399 | Ga0207675_100047992 | 3300026118 | Bacteria | 3985 |
| 400 | Ga0207675_100434024 | 3300026118 | Bacteria | 1299 |
| 401 | Ga0207683_10000030 | 3300026121 | Bacteria | 109087 |
| 402 | Ga0207683_10080314 | 3300026121 | Unclassified | 2893 |
| 403 | Ga0207683_10093555 | 3300026121 | Bacteria | 2679 |
| 404 | Ga0207698_10017660 | 3300026142 | Bacteria | 4847 |
| 405 | Ga0207698_10758090 | 3300026142 | Bacteria | 970 |
| 406 | Ga0207698_11114775 | 3300026142 | Unclassified | 802 |
| 407 | Ga0209971_1071306 | 3300027682 | Bacteria | 843 |
| 408 | Ga0268266_10000510 | 3300028379 | Bacteria | 54868 |
| 409 | Ga0268266_10006504 | 3300028379 | Bacteria | 10691 |
| 410 | Ga0268266_10024833 | 3300028379 | Bacteria | 5100 |
| 411 | Ga0268266_10134166 | 3300028379 | Bacteria | 2216 |
| 412 | Ga0268266_10353521 | 3300028379 | Bacteria | 1381 |
| 413 | Ga0268265_10026606 | 3300028380 | Bacteria | 4118 |
| 414 | Ga0268265_10327024 | 3300028380 | Unclassified | 1391 |
| 415 | Ga0268265_10625678 | 3300028380 | Bacteria | 1032 |
| 416 | Ga0268264_10566345 | 3300028381 | Unclassified | 1116 |
| 417 | Ga0265318_10000149 | 3300028577 | Bacteria | 63245 |
| 418 | Ga0307517_10289841 | 3300028786 | Bacteria | 926 |
| 419 | Ga0265338_10000649 | 3300028800 | Bacteria | 60084 |
| 420 | Ga0265338_10028088 | 3300028800 | Bacteria | 5622 |
| 421 | Ga0265340_10057376 | 3300031247 | Bacteria | 1871 |
| 422 | Ga0265331_10017810 | 3300031250 | Bacteria | 3697 |
| 423 | Ga0265316_10037907 | 3300031344 | Unclassified | 3887 |
| 424 | Ga0265313_10074336 | 3300031595 | Bacteria | 1558 |
| 425 | Ga0265314_10010341 | 3300031711 | Bacteria | 7792 |
| 426 | Ga0265314_10044216 | 3300031711 | Unclassified | 3159 |
| 427 | Ga0265342_10008930 | 3300031712 | Bacteria | 7121 |
| 428 | Ga0373930_0026235 | 3300034816 | Unclassified | 1174 |
| 429 | Ga0373948_0065358 | 3300034817 | Unclassified | 806 |
| 430 | Ga0373928_0021642 | 3300035084 | Bacteria | 1358 |
| 431 | Ga0373949_0028250 | 3300035090 | Unclassified | 1323 |
| 432 | Ga0373941_0058749 | 3300035115 | Bacteria | 1245 |
| 433 | Ga0373946_0062175 | 3300035171 | Bacteria | 1592 |
| 434 | Ga0373931_0118574 | 3300035691 | Bacteria | 1510 |
| 435 | Ga0373931_0426098 | 3300035691 | Bacteria | 844 |
| 436 | Ga0373935_0029448 | 3300035692 | Bacteria | 3399 |
| 437 | Ga0373927_0014041 | 3300035695 | Bacteria | 5309 |
| 438 | Ga0373947_0003079 | 3300035725 | Bacteria | 9934 |
| 439 | Ga0373925_0003993 | 3300037068 | Bacteria | 11228 |
| 440 | Ga0395900_0010214 | 3300037418 | Bacteria | 9601 |
| 441 | Ga0395898_0014512 | 3300037466 | Bacteria | 8090 |
| 442 | Ga0395905_0483387 | 3300037471 | Bacteria | 1138 |
| 443 | Ga0395901_0004946 | 3300038443 | Bacteria | 13449 |
| 444 | Ga0242420_011176 | 3300038996 | Unclassified | 1502 |
| 445 | Ga0436361_0680656 | 3300039447 | Bacteria | 1671 |
| 446 | Ga0436363_0038000 | 3300039450 | Bacteria | 4223 |
| 447 | Ga0466963_0667134 | 3300044694 | Bacteria | 734 |
| 448 | Ga0466957_0135845 | 3300044842 | Bacteria | 1580 |
| 449 | Ga0466959_0302452 | 3300045049 | Bacteria | 1095 |
| 450 | Ga0495603_0000303 | 3300046455 | Bacteria | 26268 |
| 451 | Ga0495629_0017757 | 3300046459 | Bacteria | 5099 |
| 452 | Ga0495641_0078526 | 3300046461 | Bacteria | 1479 |
| 453 | Ga0495580_0002543 | 3300046472 | Bacteria | 15890 |
| 454 | Ga0495582_0004516 | 3300046473 | Bacteria | 7823 |
| 455 | Ga0495639_0032262 | 3300046475 | Bacteria | 2335 |
| 456 | Ga0495594_0005029 | 3300046499 | Bacteria | 6802 |
| 457 | Ga0495606_0228904 | 3300046507 | Unclassified | 1043 |
| 458 | Ga0495620_0167672 | 3300046515 | Bacteria | 852 |
| 459 | Ga0495648_0166759 | 3300046524 | Bacteria | 1133 |
| 460 | Ga0495609_0002340 | 3300046538 | Bacteria | 11698 |
| 461 | Ga0495622_0002377 | 3300046557 | Bacteria | 9153 |
| 462 | Ga0495668_0486776 | 3300046616 | Unclassified | 680 |
| 463 | Ga0495634_0016928 | 3300046642 | Bacteria | 5207 |
| 464 | Ga0495611_0046466 | 3300046648 | Bacteria | 1947 |
| 465 | Ga0495635_0423406 | 3300046663 | Bacteria | 882 |
| 466 | Ga0495588_0027423 | 3300046674 | Bacteria | 2846 |
| 467 | Ga0495658_0005365 | 3300046683 | Bacteria | 6306 |
| 468 | Ga0495613_0004315 | 3300046689 | Bacteria | 10645 |
| 469 | Ga0495676_0287796 | 3300047321 | Bacteria | 1111 |
| 470 | Ga0495676_0381583 | 3300047321 | Bacteria | 937 |
| 471 | Ga0495680_0025863 | 3300047322 | Bacteria | 4852 |
| 472 | Ga0495593_0001092 | 3300047673 | Bacteria | 15847 |
| 473 | Ga0496100_0001066 | 3300048903 | Bacteria | 13204 |
| 474 | Ga0496101_0042695 | 3300048904 | Bacteria | 3237 |
| 475 | Ga0496101_0422920 | 3300048904 | Bacteria | 1050 |
| 476 | Ga0496101_0500236 | 3300048904 | Bacteria | 960 |
| 477 | Ga0496102_0008755 | 3300048905 | Bacteria | 8683 |
| 478 | Ga0496103_0001043 | 3300048906 | Bacteria | 19404 |
| 479 | Ga0496104_0000360 | 3300048907 | Bacteria | 40585 |
| 480 | Ga0496104_0490681 | 3300048907 | Unclassified | 1139 |
| 481 | Ga0496105_0026238 | 3300048908 | Bacteria | 4750 |
| 482 | Ga0496105_0030762 | 3300048908 | Bacteria | 4400 |
| 483 | Ga0496106_0014625 | 3300048909 | Bacteria | 5799 |
| 484 | Ga0496107_0040826 | 3300048910 | Bacteria | 3331 |
| 485 | Ga0496107_0045801 | 3300048910 | Bacteria | 3147 |
| 486 | Ga0496108_0031629 | 3300048911 | Bacteria | 4392 |
| 487 | Ga0496108_0089462 | 3300048911 | Bacteria | 2616 |
| 488 | Ga0496109_0063532 | 3300048912 | Bacteria | 3377 |
| 489 | Ga0496109_0289332 | 3300048912 | Bacteria | 1544 |
| 490 | Ga0496110_0003669 | 3300048913 | Bacteria | 11815 |
| 491 | Ga0496110_0014474 | 3300048913 | Bacteria | 6552 |
| 492 | Ga0496111_0000814 | 3300048914 | Bacteria | 16735 |
| 493 | Ga0496111_0024744 | 3300048914 | Bacteria | 4233 |
| 494 | Ga0496112_0061288 | 3300048915 | Bacteria | 3708 |
| 495 | Ga0496113_0011714 | 3300048916 | Bacteria | 5867 |
| 496 | Ga0496113_0042523 | 3300048916 | Bacteria | 3358 |
| 497 | Ga0496114_0002707 | 3300048917 | Bacteria | 13538 |
| 498 | Ga0496115_0524006 | 3300048918 | Unclassified | 950 |
| 499 | Ga0496115_0690107 | 3300048918 | Unclassified | 803 |
| 500 | Ga0496126_0001104 | 3300048929 | Bacteria | 45291 |
| 501 | Ga0501031_0009797 | 3300049568 | Bacteria | 6238 |
| 502 | Ga0501032_0094437 | 3300049569 | Bacteria | 1983 |
| 503 | Ga0501032_0156769 | 3300049569 | Bacteria | 1495 |
| 504 | Ga0501033_0005487 | 3300049570 | Bacteria | 10038 |
| 505 | Ga0501033_0018695 | 3300049570 | Bacteria | 5238 |
| 506 | Ga0501033_0419781 | 3300049570 | Bacteria | 931 |
| 507 | Ga0501033_0657110 | 3300049570 | Bacteria | 716 |
| 508 | Ga0501034_0037302 | 3300049571 | Bacteria | 4921 |
| 509 | Ga0501036_0270913 | 3300049572 | Bacteria | 1421 |
| 510 | Ga0501038_0020260 | 3300049574 | Bacteria | 5983 |
| 511 | Ga0501038_0102449 | 3300049574 | Bacteria | 2382 |
| 512 | Ga0501039_0002429 | 3300049575 | Bacteria | 13867 |
| 513 | Ga0501039_0150317 | 3300049575 | Bacteria | 1830 |
| 514 | Ga0501040_0025589 | 3300049576 | Bacteria | 3968 |
| 515 | Ga0501041_0005311 | 3300049577 | Bacteria | 7534 |
| 516 | Ga0501042_0033042 | 3300049578 | Bacteria | 3666 |
| 517 | Ga0501043_0067430 | 3300049579 | Bacteria | 2810 |
| 518 | Ga0501043_0095086 | 3300049579 | Bacteria | 2342 |
| 519 | Ga0501043_0217248 | 3300049579 | Bacteria | 1480 |
| 520 | Ga0501046_0038489 | 3300049580 | Bacteria | 3838 |
| 521 | Ga0501046_0178667 | 3300049580 | Bacteria | 1588 |
| 522 | Ga0501046_0798506 | 3300049580 | Bacteria | 661 |
| 523 | Ga0501047_0004930 | 3300049581 | Bacteria | 12538 |
| 524 | Ga0501047_0032205 | 3300049581 | Bacteria | 5060 |
| 525 | Ga0501047_0078011 | 3300049581 | Bacteria | 3186 |
| 526 | Ga0501048_0169010 | 3300049582 | Bacteria | 1548 |
| 527 | Ga0501067_0069612 | 3300049583 | Bacteria | 1948 |
| 528 | Ga0501067_0161912 | 3300049583 | Bacteria | 1246 |
| 529 | Ga0501068_0106878 | 3300049584 | Bacteria | 1737 |
| 530 | Ga0501069_0157206 | 3300049585 | Bacteria | 1308 |
| 531 | Ga0501069_0177438 | 3300049585 | Bacteria | 1231 |
| 532 | Ga0501070_0011365 | 3300049586 | Bacteria | 7524 |
| 533 | Ga0501070_0146498 | 3300049586 | Bacteria | 1949 |
| 534 | Ga0501071_0285781 | 3300049587 | Bacteria | 1248 |
| 535 | Ga0501073_0065903 | 3300049589 | Bacteria | 2525 |
| 536 | Ga0501075_0099547 | 3300049591 | Bacteria | 2207 |
| 537 | Ga0501077_0115874 | 3300049593 | Bacteria | 1698 |
| 538 | Ga0501079_0019330 | 3300049741 | Bacteria | 5202 |
| 539 | Ga0501080_0186769 | 3300049742 | Unclassified | 1906 |
| 540 | Ga0501080_0240875 | 3300049742 | Bacteria | 1651 |
| 541 | Ga0501080_0779494 | 3300049742 | Bacteria | 840 |
| 542 | Ga0501081_0034510 | 3300049743 | Bacteria | 3442 |
| 543 | Ga0501083_0005266 | 3300049744 | Bacteria | 9152 |
| 544 | Ga0501035_0014258 | 3300049822 | Bacteria | 7337 |
| 545 | Ga0501035_0053921 | 3300049822 | Bacteria | 3594 |
| 546 | Ga0501035_0055100 | 3300049822 | Bacteria | 3551 |
| 547 | Ga0501035_0209998 | 3300049822 | Bacteria | 1666 |
| 548 | Ga0501035_0399976 | 3300049822 | Unclassified | 1143 |
| 549 | Ga0501044_0001577 | 3300049823 | Bacteria | 26664 |
| 550 | Ga0501044_0004555 | 3300049823 | Bacteria | 15501 |
| 551 | Ga0501044_0488230 | 3300049823 | Unclassified | 1134 |
| 552 | Ga0501045_0243179 | 3300049824 | Bacteria | 1339 |
| 553 | Ga0501045_0428611 | 3300049824 | Bacteria | 984 |
| 554 | nmdc:mga03n38_15866_c1 | 3300050490 | Bacteria | 2918 |
| 555 | nmdc:mga00v17_246811_c1 | 3300050491 | Bacteria | 1158 |
| 556 | nmdc:mga0yw44_21138_c1 | 3300050492 | Bacteria | 3625 |
| 557 | nmdc:mga06z11_10675_c1 | 3300050494 | Bacteria | 3925 |
| 558 | nmdc:mga06z11_29967_c1 | 3300050494 | Bacteria | 2628 |
| 559 | nmdc:mga04h51_10122_c1 | 3300050495 | Bacteria | 2581 |
| 560 | nmdc:mga05p37_152272_c1 | 3300050507 | Bacteria | 2828 |
| 561 | nmdc:mga05p37_39808_c1 | 3300050507 | Bacteria | 5772 |
| 562 | nmdc:mga06r32_13764_c1 | 3300050510 | Bacteria | 7337 |
| 563 | nmdc:mga06r32_541367_c1 | 3300050510 | Bacteria | 1139 |
| 564 | nmdc:mga08y16_1037771_c1 | 3300050511 | Bacteria | 798 |
| 565 | nmdc:mga08y16_104157_c1 | 3300050511 | Bacteria | 2954 |
| 566 | nmdc:mga0n895_380869_c1 | 3300050512 | Bacteria | 1428 |
| 567 | nmdc:mga0rr50_141166_c1 | 3300050513 | Bacteria | 1938 |
| 568 | nmdc:mga08x19_16357_c1 | 3300050514 | Bacteria | 4524 |
| 569 | nmdc:mga08x19_460_c1 | 3300050514 | Bacteria | 27547 |
| 570 | nmdc:mga0a205_7774_c1 | 3300050515 | Bacteria | 9733 |
| 571 | Ga0500635_0012604 | 3300053080 | Unclassified | 2433 |
| 572 | Ga0495655_0033511 | 3300053083 | Bacteria | 1264 |
| 573 | Ga0495595_0155336 | 3300053084 | Bacteria | 1127 |
| 574 | Ga0495619_0006693 | 3300053085 | Bacteria | 7290 |
| 575 | Ga0500595_005887 | 3300053119 | Bacteria | 5281 |
| 576 | Ga0500577_0157846 | 3300053142 | Bacteria | 965 |
| 577 | Ga0501084_0007482 | 3300054114 | Bacteria | 9003 |
| 578 | Ga0530510_0086448 | 3300061734 | Bacteria | 2284 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0657110 | Ga0501033_0657110_15_653 | 180 |
| 2 | 3300046616 | Ga0495668_0486776 | Ga0495668_0486776_75_638 | 182 |
| 3 | 3300005439 | Ga0070711_100006358 | Ga0070711_1000063582 | 187 |
| 4 | 3300005834 | Ga0068851_10059076 | Ga0068851_100590762 | 187 |
| 5 | 3300006173 | Ga0070716_100171947 | Ga0070716_1001719472 | 187 |
| 6 | 3300049580 | Ga0501046_0798506 | Ga0501046_0798506_48_641 | 197 |
| 7 | 3300049569 | Ga0501032_0094437 | Ga0501032_0094437_740_1423 | 199 |
| 8 | 3300049570 | Ga0501033_0018695 | Ga0501033_0018695_2773_3456 | 199 |
| 9 | 3300049579 | Ga0501043_0217248 | Ga0501043_0217248_239_922 | 199 |
| 10 | 3300049581 | Ga0501047_0004930 | Ga0501047_0004930_4752_5435 | 199 |
| 11 | 3300049742 | Ga0501080_0779494 | Ga0501080_0779494_222_824 | 199 |
| 12 | 3300049822 | Ga0501035_0014258 | Ga0501035_0014258_4675_5358 | 199 |
| 13 | 3300049822 | Ga0501035_0399976 | Ga0501035_0399976_166_834 | 199 |
| 14 | 3300049823 | Ga0501044_0001577 | Ga0501044_0001577_19090_19773 | 199 |
| 15 | 3300049824 | Ga0501045_0428611 | Ga0501045_0428611_199_882 | 199 |
| 16 | 3300049580 | Ga0501046_0178667 | Ga0501046_0178667_828_1499 | 200 |
| 17 | 3300049581 | Ga0501047_0078011 | Ga0501047_0078011_2364_3035 | 200 |
| 18 | 3300049822 | Ga0501035_0209998 | Ga0501035_0209998_504_1175 | 200 |
| 19 | 3300005577 | Ga0068857_100170514 | Ga0068857_1001705142 | 201 |
| 20 | 3300026116 | Ga0207674_10586746 | Ga0207674_105867461 | 201 |
| 21 | 3300005364 | Ga0070673_100127595 | Ga0070673_1001275952 | 202 |
| 22 | 3300005456 | Ga0070678_100058667 | Ga0070678_1000586672 | 202 |
| 23 | 3300006358 | Ga0068871_100228595 | Ga0068871_1002285952 | 202 |
| 24 | 3300009098 | Ga0105245_10044899 | Ga0105245_100448992 | 202 |
| 25 | 3300009545 | Ga0105237_10195748 | Ga0105237_101957481 | 202 |
| 26 | 3300011119 | Ga0105246_10039845 | Ga0105246_100398453 | 202 |
| 27 | 3300025925 | Ga0207650_10129833 | Ga0207650_101298332 | 202 |
| 28 | 3300025927 | Ga0207687_10032497 | Ga0207687_100324971 | 202 |
| 29 | 3300026121 | Ga0207683_10080314 | Ga0207683_100803143 | 202 |
| 30 | 3300005347 | Ga0070668_100344443 | Ga0070668_1003444432 | 204 |
| 31 | 3300010375 | Ga0105239_10745316 | Ga0105239_107453162 | 204 |
| 32 | 3300025933 | Ga0207706_10073444 | Ga0207706_100734441 | 204 |
| 33 | 3300025972 | Ga0207668_10172976 | Ga0207668_101729762 | 204 |
| 34 | 3300005338 | Ga0068868_100258498 | Ga0068868_1002584981 | 208 |
| 35 | 3300031711 | Ga0265314_10044216 | Ga0265314_100442163 | 208 |
| 36 | 3300005331 | Ga0070670_100332435 | Ga0070670_1003324351 | 209 |
| 37 | 3300005335 | Ga0070666_10143456 | Ga0070666_101434562 | 209 |
| 38 | 3300005615 | Ga0070702_100156848 | Ga0070702_1001568482 | 209 |
| 39 | 3300005843 | Ga0068860_100136296 | Ga0068860_1001362962 | 209 |
| 40 | 3300006237 | Ga0097621_100174686 | Ga0097621_1001746862 | 209 |
| 41 | 3300009174 | Ga0105241_10062657 | Ga0105241_100626572 | 209 |
| 42 | 3300011119 | Ga0105246_10047597 | Ga0105246_100475973 | 209 |
| 43 | 3300014325 | Ga0163163_10250185 | Ga0163163_102501852 | 209 |
| 44 | 3300025903 | Ga0207680_10083358 | Ga0207680_100833582 | 209 |
| 45 | 3300025911 | Ga0207654_10004909 | Ga0207654_100049091 | 209 |
| 46 | 3300025942 | Ga0207689_10496181 | Ga0207689_104961812 | 209 |
| 47 | 3300025986 | Ga0207658_10182857 | Ga0207658_101828572 | 209 |
| 48 | 3300028381 | Ga0268264_10566345 | Ga0268264_105663451 | 209 |
| 49 | 3300014968 | Ga0157379_10002828 | Ga0157379_100028288 | 210 |
| 50 | 3300021377 | Ga0213874_10002204 | Ga0213874_100022042 | 211 |
| 51 | 3300028577 | Ga0265318_10000149 | Ga0265318_1000014957 | 211 |
| 52 | 3300028800 | Ga0265338_10028088 | Ga0265338_100280886 | 211 |
| 53 | 3300039450 | Ga0436363_0038000 | Ga0436363_0038000_1045_1695 | 211 |
| 54 | 3300005327 | Ga0070658_10166052 | Ga0070658_101660522 | 212 |
| 55 | 3300005335 | Ga0070666_10014297 | Ga0070666_100142975 | 212 |
| 56 | 3300005335 | Ga0070666_10039456 | Ga0070666_100394562 | 212 |
| 57 | 3300005336 | Ga0070680_100000248 | Ga0070680_10000024821 | 212 |
| 58 | 3300005339 | Ga0070660_100077666 | Ga0070660_1000776662 | 212 |
| 59 | 3300005344 | Ga0070661_100113578 | Ga0070661_1001135782 | 212 |
| 60 | 3300005455 | Ga0070663_100104446 | Ga0070663_1001044462 | 212 |
| 61 | 3300005456 | Ga0070678_100376014 | Ga0070678_1003760142 | 212 |
| 62 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002539 | 212 |
| 63 | 3300005530 | Ga0070679_100000035 | Ga0070679_10000003546 | 212 |
| 64 | 3300005548 | Ga0070665_100043851 | Ga0070665_1000438512 | 212 |
| 65 | 3300005548 | Ga0070665_100072055 | Ga0070665_1000720553 | 212 |
| 66 | 3300005548 | Ga0070665_100078037 | Ga0070665_1000780373 | 212 |
| 67 | 3300005841 | Ga0068863_100012930 | Ga0068863_1000129306 | 212 |
| 68 | 3300005842 | Ga0068858_100247542 | Ga0068858_1002475422 | 212 |
| 69 | 3300006237 | Ga0097621_100000267 | Ga0097621_1000002676 | 212 |
| 70 | 3300006237 | Ga0097621_100052369 | Ga0097621_1000523694 | 212 |
| 71 | 3300006237 | Ga0097621_100105690 | Ga0097621_1001056902 | 212 |
| 72 | 3300006358 | Ga0068871_100001741 | Ga0068871_1000017415 | 212 |
| 73 | 3300009093 | Ga0105240_10054893 | Ga0105240_100548933 | 212 |
| 74 | 3300009093 | Ga0105240_10078368 | Ga0105240_100783685 | 212 |
| 75 | 3300009098 | Ga0105245_10125755 | Ga0105245_101257552 | 212 |
| 76 | 3300009101 | Ga0105247_10012277 | Ga0105247_100122773 | 212 |
| 77 | 3300009148 | Ga0105243_10519514 | Ga0105243_105195142 | 212 |
| 78 | 3300009177 | Ga0105248_10011402 | Ga0105248_100114028 | 212 |
| 79 | 3300009545 | Ga0105237_10024196 | Ga0105237_100241965 | 212 |
| 80 | 3300009553 | Ga0105249_10006469 | Ga0105249_100064694 | 212 |
| 81 | 3300010375 | Ga0105239_10000540 | Ga0105239_100005405 | 212 |
| 82 | 3300010375 | Ga0105239_10040642 | Ga0105239_100406423 | 212 |
| 83 | 3300013105 | Ga0157369_10062984 | Ga0157369_100629842 | 212 |
| 84 | 3300013105 | Ga0157369_10393644 | Ga0157369_103936442 | 212 |
| 85 | 3300013306 | Ga0163162_10099333 | Ga0163162_100993333 | 212 |
| 86 | 3300014325 | Ga0163163_10445931 | Ga0163163_104459312 | 212 |
| 87 | 3300014326 | Ga0157380_10093665 | Ga0157380_100936653 | 212 |
| 88 | 3300014968 | Ga0157379_11005923 | Ga0157379_110059231 | 212 |
| 89 | 3300025900 | Ga0207710_10019905 | Ga0207710_100199051 | 212 |
| 90 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002419 | 212 |
| 91 | 3300025913 | Ga0207695_10034041 | Ga0207695_100340415 | 212 |
| 92 | 3300025913 | Ga0207695_10218241 | Ga0207695_102182412 | 212 |
| 93 | 3300025914 | Ga0207671_10032772 | Ga0207671_100327722 | 212 |
| 94 | 3300025917 | Ga0207660_10000240 | Ga0207660_1000024020 | 212 |
| 95 | 3300025919 | Ga0207657_10204835 | Ga0207657_102048352 | 212 |
| 96 | 3300025920 | Ga0207649_10086074 | Ga0207649_100860742 | 212 |
| 97 | 3300025921 | Ga0207652_10000932 | Ga0207652_100009325 | 212 |
| 98 | 3300025925 | Ga0207650_10102919 | Ga0207650_101029192 | 212 |
| 99 | 3300025941 | Ga0207711_10012312 | Ga0207711_100123123 | 212 |
| 100 | 3300026067 | Ga0207678_10121592 | Ga0207678_101215922 | 212 |
| 101 | 3300026088 | Ga0207641_10065083 | Ga0207641_100650833 | 212 |
| 102 | 3300028379 | Ga0268266_10006504 | Ga0268266_100065044 | 212 |
| 103 | 3300028379 | Ga0268266_10134166 | Ga0268266_101341662 | 212 |
| 104 | 3300028786 | Ga0307517_10289841 | Ga0307517_102898412 | 212 |
| 105 | 3300045049 | Ga0466959_0302452 | Ga0466959_0302452_111_770 | 212 |
| 106 | 3300046515 | Ga0495620_0167672 | Ga0495620_0167672_22_681 | 212 |
| 107 | 3300046524 | Ga0495648_0166759 | Ga0495648_0166759_148_807 | 212 |
| 108 | 3300046538 | Ga0495609_0002340 | Ga0495609_0002340_10282_10941 | 212 |
| 109 | 3300047321 | Ga0495676_0287796 | Ga0495676_0287796_125_784 | 212 |
| 110 | 3300049570 | Ga0501033_0005487 | Ga0501033_0005487_173_832 | 212 |
| 111 | 3300049571 | Ga0501034_0037302 | Ga0501034_0037302_147_806 | 212 |
| 112 | 3300049574 | Ga0501038_0102449 | Ga0501038_0102449_1000_1659 | 212 |
| 113 | 3300049579 | Ga0501043_0095086 | Ga0501043_0095086_808_1467 | 212 |
| 114 | 3300049581 | Ga0501047_0032205 | Ga0501047_0032205_4362_5021 | 212 |
| 115 | 3300049586 | Ga0501070_0011365 | Ga0501070_0011365_748_1473 | 212 |
| 116 | 3300049742 | Ga0501080_0186769 | Ga0501080_0186769_771_1430 | 212 |
| 117 | 3300049744 | Ga0501083_0005266 | Ga0501083_0005266_8153_8818 | 212 |
| 118 | 3300053080 | Ga0500635_0012604 | Ga0500635_0012604_1533_2192 | 212 |
| 119 | 3300053119 | Ga0500595_005887 | Ga0500595_005887_1113_1772 | 212 |
| 120 | 3300053142 | Ga0500577_0157846 | Ga0500577_0157846_122_781 | 212 |
| 121 | 3300048929 | Ga0496126_0001104 | Ga0496126_0001104_20207_20863 | 213 |
| 122 | 3300005327 | Ga0070658_10048858 | Ga0070658_100488583 | 214 |
| 123 | 3300005327 | Ga0070658_10079785 | Ga0070658_100797851 | 214 |
| 124 | 3300005329 | Ga0070683_100044123 | Ga0070683_1000441233 | 214 |
| 125 | 3300005335 | Ga0070666_10041710 | Ga0070666_100417103 | 214 |
| 126 | 3300005336 | Ga0070680_100190303 | Ga0070680_1001903032 | 214 |
| 127 | 3300005339 | Ga0070660_100044609 | Ga0070660_1000446093 | 214 |
| 128 | 3300005344 | Ga0070661_100440953 | Ga0070661_1004409531 | 214 |
| 129 | 3300005434 | Ga0070709_10004467 | Ga0070709_100044678 | 214 |
| 130 | 3300005435 | Ga0070714_100052171 | Ga0070714_1000521713 | 214 |
| 131 | 3300005436 | Ga0070713_100000006 | Ga0070713_100000006158 | 214 |
| 132 | 3300005437 | Ga0070710_10427560 | Ga0070710_104275602 | 214 |
| 133 | 3300005440 | Ga0070705_100099530 | Ga0070705_1000995302 | 214 |
| 134 | 3300005458 | Ga0070681_10431389 | Ga0070681_104313892 | 214 |
| 135 | 3300005458 | Ga0070681_10475245 | Ga0070681_104752452 | 214 |
| 136 | 3300005466 | Ga0070685_10373744 | Ga0070685_103737441 | 214 |
| 137 | 3300005530 | Ga0070679_100035909 | Ga0070679_1000359093 | 214 |
| 138 | 3300005535 | Ga0070684_100046711 | Ga0070684_1000467113 | 214 |
| 139 | 3300005548 | Ga0070665_100003166 | Ga0070665_1000031666 | 214 |
| 140 | 3300005563 | Ga0068855_100041948 | Ga0068855_1000419483 | 214 |
| 141 | 3300005563 | Ga0068855_100480985 | Ga0068855_1004809851 | 214 |
| 142 | 3300005614 | Ga0068856_100000280 | Ga0068856_10000028046 | 214 |
| 143 | 3300005614 | Ga0068856_100099431 | Ga0068856_1000994312 | 214 |
| 144 | 3300005618 | Ga0068864_100437601 | Ga0068864_1004376012 | 214 |
| 145 | 3300006175 | Ga0070712_100000184 | Ga0070712_10000018422 | 214 |
| 146 | 3300006914 | Ga0075436_100001960 | Ga0075436_1000019606 | 214 |
| 147 | 3300007076 | Ga0075435_100162931 | Ga0075435_1001629312 | 214 |
| 148 | 3300009093 | Ga0105240_10123169 | Ga0105240_101231693 | 214 |
| 149 | 3300009093 | Ga0105240_10320643 | Ga0105240_103206432 | 214 |
| 150 | 3300009093 | Ga0105240_10763421 | Ga0105240_107634211 | 214 |
| 151 | 3300009098 | Ga0105245_10611383 | Ga0105245_106113832 | 214 |
| 152 | 3300009174 | Ga0105241_10058685 | Ga0105241_100586853 | 214 |
| 153 | 3300009174 | Ga0105241_10061391 | Ga0105241_100613913 | 214 |
| 154 | 3300009545 | Ga0105237_10065074 | Ga0105237_100650743 | 214 |
| 155 | 3300009551 | Ga0105238_10355952 | Ga0105238_103559521 | 214 |
| 156 | 3300010375 | Ga0105239_10296970 | Ga0105239_102969702 | 214 |
| 157 | 3300013104 | Ga0157370_10086430 | Ga0157370_100864303 | 214 |
| 158 | 3300013105 | Ga0157369_10245378 | Ga0157369_102453782 | 214 |
| 159 | 3300013296 | Ga0157374_10317600 | Ga0157374_103176002 | 214 |
| 160 | 3300013297 | Ga0157378_10344892 | Ga0157378_103448921 | 214 |
| 161 | 3300013307 | Ga0157372_10097370 | Ga0157372_100973702 | 214 |
| 162 | 3300014325 | Ga0163163_10183792 | Ga0163163_101837922 | 214 |
| 163 | 3300025903 | Ga0207680_10040977 | Ga0207680_100409773 | 214 |
| 164 | 3300025906 | Ga0207699_10001108 | Ga0207699_100011087 | 214 |
| 165 | 3300025909 | Ga0207705_10020038 | Ga0207705_100200383 | 214 |
| 166 | 3300025909 | Ga0207705_10073109 | Ga0207705_100731093 | 214 |
| 167 | 3300025911 | Ga0207654_10038844 | Ga0207654_100388443 | 214 |
| 168 | 3300025912 | Ga0207707_10359464 | Ga0207707_103594642 | 214 |
| 169 | 3300025913 | Ga0207695_10070019 | Ga0207695_100700193 | 214 |
| 170 | 3300025913 | Ga0207695_10342769 | Ga0207695_103427691 | 214 |
| 171 | 3300025913 | Ga0207695_10545755 | Ga0207695_105457552 | 214 |
| 172 | 3300025915 | Ga0207693_10000733 | Ga0207693_1000073310 | 214 |
| 173 | 3300025917 | Ga0207660_10151309 | Ga0207660_101513092 | 214 |
| 174 | 3300025919 | Ga0207657_10080025 | Ga0207657_100800252 | 214 |
| 175 | 3300025921 | Ga0207652_10067029 | Ga0207652_100670292 | 214 |
| 176 | 3300025924 | Ga0207694_10239882 | Ga0207694_102398822 | 214 |
| 177 | 3300025924 | Ga0207694_10561868 | Ga0207694_105618681 | 214 |
| 178 | 3300025928 | Ga0207700_10000020 | Ga0207700_1000002014 | 214 |
| 179 | 3300025928 | Ga0207700_10273052 | Ga0207700_102730522 | 214 |
| 180 | 3300025929 | Ga0207664_10044073 | Ga0207664_100440733 | 214 |
| 181 | 3300025949 | Ga0207667_10168195 | Ga0207667_101681953 | 214 |
| 182 | 3300025949 | Ga0207667_10251138 | Ga0207667_102511382 | 214 |
| 183 | 3300025949 | Ga0207667_10456050 | Ga0207667_104560501 | 214 |
| 184 | 3300026035 | Ga0207703_10032181 | Ga0207703_100321812 | 214 |
| 185 | 3300026041 | Ga0207639_10229287 | Ga0207639_102292872 | 214 |
| 186 | 3300026078 | Ga0207702_10000030 | Ga0207702_10000030103 | 214 |
| 187 | 3300026078 | Ga0207702_10082123 | Ga0207702_100821232 | 214 |
| 188 | 3300026078 | Ga0207702_10206284 | Ga0207702_102062842 | 214 |
| 189 | 3300026118 | Ga0207675_100047992 | Ga0207675_1000479924 | 214 |
| 190 | 3300026142 | Ga0207698_10758090 | Ga0207698_107580901 | 214 |
| 191 | 3300028379 | Ga0268266_10000510 | Ga0268266_1000051052 | 214 |
| 192 | 3300028379 | Ga0268266_10353521 | Ga0268266_103535211 | 214 |
| 193 | 3300028800 | Ga0265338_10000649 | Ga0265338_1000064958 | 214 |
| 194 | 3300031247 | Ga0265340_10057376 | Ga0265340_100573762 | 214 |
| 195 | 3300031250 | Ga0265331_10017810 | Ga0265331_100178103 | 214 |
| 196 | 3300031344 | Ga0265316_10037907 | Ga0265316_100379073 | 214 |
| 197 | 3300031595 | Ga0265313_10074336 | Ga0265313_100743362 | 214 |
| 198 | 3300031711 | Ga0265314_10010341 | Ga0265314_100103416 | 214 |
| 199 | 3300031712 | Ga0265342_10008930 | Ga0265342_100089305 | 214 |
| 200 | 3300037418 | Ga0395900_0010214 | Ga0395900_0010214_421_1158 | 214 |
| 201 | 3300037466 | Ga0395898_0014512 | Ga0395898_0014512_1941_2678 | 214 |
| 202 | 3300037471 | Ga0395905_0483387 | Ga0395905_0483387_32_706 | 214 |
| 203 | 3300038443 | Ga0395901_0004946 | Ga0395901_0004946_6242_6979 | 214 |
| 204 | 3300044694 | Ga0466963_0667134 | Ga0466963_0667134_45_719 | 214 |
| 205 | 3300044842 | Ga0466957_0135845 | Ga0466957_0135845_560_1234 | 214 |
| 206 | 3300048904 | Ga0496101_0422920 | Ga0496101_0422920_164_826 | 214 |
| 207 | 3300049583 | Ga0501067_0069612 | Ga0501067_0069612_672_1346 | 214 |
| 208 | 3300049822 | Ga0501035_0053921 | Ga0501035_0053921_31_774 | 214 |
| 209 | 3300049823 | Ga0501044_0004555 | Ga0501044_0004555_11160_11903 | 214 |
| 210 | 3300049823 | Ga0501044_0488230 | Ga0501044_0488230_382_1119 | 214 |
| 211 | 3300050513 | nmdc:mga0rr50_141166_c1 | nmdc:mga0rr50_141166_c1_882_1544 | 214 |
| 212 | 3300050514 | nmdc:mga08x19_460_c1 | nmdc:mga08x19_460_c1_8951_9613 | 214 |
| 213 | 3300005328 | Ga0070676_10183050 | Ga0070676_101830502 | 215 |
| 214 | 3300005328 | Ga0070676_10435362 | Ga0070676_104353621 | 215 |
| 215 | 3300005334 | Ga0068869_100078006 | Ga0068869_1000780062 | 215 |
| 216 | 3300005354 | Ga0070675_100102846 | Ga0070675_1001028462 | 215 |
| 217 | 3300005356 | Ga0070674_100173469 | Ga0070674_1001734692 | 215 |
| 218 | 3300005364 | Ga0070673_100094029 | Ga0070673_1000940292 | 215 |
| 219 | 3300005436 | Ga0070713_100334252 | Ga0070713_1003342521 | 215 |
| 220 | 3300005439 | Ga0070711_100397648 | Ga0070711_1003976482 | 215 |
| 221 | 3300005456 | Ga0070678_100010621 | Ga0070678_1000106212 | 215 |
| 222 | 3300005459 | Ga0068867_100148322 | Ga0068867_1001483222 | 215 |
| 223 | 3300005543 | Ga0070672_100267994 | Ga0070672_1002679941 | 215 |
| 224 | 3300005548 | Ga0070665_100051235 | Ga0070665_1000512354 | 215 |
| 225 | 3300005617 | Ga0068859_100408854 | Ga0068859_1004088542 | 215 |
| 226 | 3300005617 | Ga0068859_100448549 | Ga0068859_1004485492 | 215 |
| 227 | 3300005842 | Ga0068858_100059040 | Ga0068858_1000590404 | 215 |
| 228 | 3300006237 | Ga0097621_100101455 | Ga0097621_1001014552 | 215 |
| 229 | 3300006881 | Ga0068865_100224322 | Ga0068865_1002243222 | 215 |
| 230 | 3300006931 | Ga0097620_100408867 | Ga0097620_1004088672 | 215 |
| 231 | 3300006931 | Ga0097620_100448533 | Ga0097620_1004485332 | 215 |
| 232 | 3300009098 | Ga0105245_10019574 | Ga0105245_100195742 | 215 |
| 233 | 3300009148 | Ga0105243_10028300 | Ga0105243_100283005 | 215 |
| 234 | 3300009174 | Ga0105241_10110217 | Ga0105241_101102172 | 215 |
| 235 | 3300009177 | Ga0105248_10250001 | Ga0105248_102500012 | 215 |
| 236 | 3300013100 | Ga0157373_10407621 | Ga0157373_104076211 | 215 |
| 237 | 3300013296 | Ga0157374_10052051 | Ga0157374_100520512 | 215 |
| 238 | 3300013297 | Ga0157378_10562475 | Ga0157378_105624752 | 215 |
| 239 | 3300013306 | Ga0163162_10002450 | Ga0163162_100024508 | 215 |
| 240 | 3300013306 | Ga0163162_10722906 | Ga0163162_107229062 | 215 |
| 241 | 3300013308 | Ga0157375_10185254 | Ga0157375_101852542 | 215 |
| 242 | 3300017792 | Ga0163161_10005012 | Ga0163161_100050122 | 215 |
| 243 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006815 | 215 |
| 244 | 3300025261 | Ga0209233_1001131 | Ga0209233_10011316 | 215 |
| 245 | 3300025907 | Ga0207645_10036296 | Ga0207645_100362963 | 215 |
| 246 | 3300025911 | Ga0207654_10315095 | Ga0207654_103150952 | 215 |
| 247 | 3300025913 | Ga0207695_10242771 | Ga0207695_102427712 | 215 |
| 248 | 3300025926 | Ga0207659_10116423 | Ga0207659_101164232 | 215 |
| 249 | 3300025927 | Ga0207687_10580846 | Ga0207687_105808462 | 215 |
| 250 | 3300025935 | Ga0207709_10057368 | Ga0207709_100573682 | 215 |
| 251 | 3300025937 | Ga0207669_10387811 | Ga0207669_103878112 | 215 |
| 252 | 3300025938 | Ga0207704_10143532 | Ga0207704_101435322 | 215 |
| 253 | 3300025940 | Ga0207691_10135389 | Ga0207691_101353892 | 215 |
| 254 | 3300025941 | Ga0207711_10270665 | Ga0207711_102706652 | 215 |
| 255 | 3300025942 | Ga0207689_10093276 | Ga0207689_100932762 | 215 |
| 256 | 3300025960 | Ga0207651_10002795 | Ga0207651_100027958 | 215 |
| 257 | 3300025960 | Ga0207651_10073042 | Ga0207651_100730423 | 215 |
| 258 | 3300026075 | Ga0207708_10265840 | Ga0207708_102658402 | 215 |
| 259 | 3300026089 | Ga0207648_10005670 | Ga0207648_100056707 | 215 |
| 260 | 3300026089 | Ga0207648_10020996 | Ga0207648_100209962 | 215 |
| 261 | 3300026095 | Ga0207676_10798195 | Ga0207676_107981951 | 215 |
| 262 | 3300026121 | Ga0207683_10093555 | Ga0207683_100935552 | 215 |
| 263 | 3300028379 | Ga0268266_10024833 | Ga0268266_100248333 | 215 |
| 264 | 3300028380 | Ga0268265_10327024 | Ga0268265_103270242 | 215 |
| 265 | 3300046507 | Ga0495606_0228904 | Ga0495606_0228904_205_876 | 215 |
| 266 | 3300046648 | Ga0495611_0046466 | Ga0495611_0046466_1079_1837 | 215 |
| 267 | 3300048918 | Ga0496115_0524006 | Ga0496115_0524006_18_698 | 215 |
| 268 | 3300005337 | Ga0070682_100498037 | Ga0070682_1004980371 | 216 |
| 269 | 3300005341 | Ga0070691_10001501 | Ga0070691_100015011 | 216 |
| 270 | 3300005344 | Ga0070661_100286005 | Ga0070661_1002860052 | 216 |
| 271 | 3300005434 | Ga0070709_10079605 | Ga0070709_100796052 | 216 |
| 272 | 3300005435 | Ga0070714_100236514 | Ga0070714_1002365142 | 216 |
| 273 | 3300005518 | Ga0070699_100058883 | Ga0070699_1000588833 | 216 |
| 274 | 3300005539 | Ga0068853_100012410 | Ga0068853_1000124103 | 216 |
| 275 | 3300005547 | Ga0070693_100031583 | Ga0070693_1000315833 | 216 |
| 276 | 3300005563 | Ga0068855_100047427 | Ga0068855_1000474275 | 216 |
| 277 | 3300005577 | Ga0068857_100000387 | Ga0068857_1000003876 | 216 |
| 278 | 3300005578 | Ga0068854_100015672 | Ga0068854_1000156722 | 216 |
| 279 | 3300005614 | Ga0068856_100023115 | Ga0068856_1000231153 | 216 |
| 280 | 3300005616 | Ga0068852_100003875 | Ga0068852_1000038753 | 216 |
| 281 | 3300006914 | Ga0075436_100054680 | Ga0075436_1000546802 | 216 |
| 282 | 3300009093 | Ga0105240_10003264 | Ga0105240_100032645 | 216 |
| 283 | 3300009174 | Ga0105241_10002894 | Ga0105241_100028946 | 216 |
| 284 | 3300009545 | Ga0105237_10005625 | Ga0105237_1000562512 | 216 |
| 285 | 3300009551 | Ga0105238_10028649 | Ga0105238_100286493 | 216 |
| 286 | 3300010375 | Ga0105239_10061226 | Ga0105239_100612263 | 216 |
| 287 | 3300013100 | Ga0157373_10001321 | Ga0157373_100013216 | 216 |
| 288 | 3300013104 | Ga0157370_10000438 | Ga0157370_1000043831 | 216 |
| 289 | 3300013105 | Ga0157369_10003719 | Ga0157369_100037192 | 216 |
| 290 | 3300013296 | Ga0157374_10054370 | Ga0157374_100543702 | 216 |
| 291 | 3300013307 | Ga0157372_10036446 | Ga0157372_100364465 | 216 |
| 292 | 3300014968 | Ga0157379_10026293 | Ga0157379_100262933 | 216 |
| 293 | 3300015262 | Ga0182007_10036081 | Ga0182007_100360812 | 216 |
| 294 | 3300025906 | Ga0207699_10253057 | Ga0207699_102530572 | 216 |
| 295 | 3300025911 | Ga0207654_10034260 | Ga0207654_100342603 | 216 |
| 296 | 3300025912 | Ga0207707_10090588 | Ga0207707_100905882 | 216 |
| 297 | 3300025913 | Ga0207695_10070852 | Ga0207695_100708521 | 216 |
| 298 | 3300025914 | Ga0207671_10004743 | Ga0207671_1000474310 | 216 |
| 299 | 3300025920 | Ga0207649_10663318 | Ga0207649_106633181 | 216 |
| 300 | 3300025924 | Ga0207694_10070369 | Ga0207694_100703692 | 216 |
| 301 | 3300025949 | Ga0207667_10029859 | Ga0207667_100298595 | 216 |
| 302 | 3300025981 | Ga0207640_10020303 | Ga0207640_100203032 | 216 |
| 303 | 3300026041 | Ga0207639_10089612 | Ga0207639_100896121 | 216 |
| 304 | 3300026078 | Ga0207702_10082741 | Ga0207702_100827412 | 216 |
| 305 | 3300026116 | Ga0207674_10000051 | Ga0207674_1000005170 | 216 |
| 306 | 3300026142 | Ga0207698_10017660 | Ga0207698_100176603 | 216 |
| 307 | 3300035691 | Ga0373931_0118574 | Ga0373931_0118574_64_732 | 216 |
| 308 | 3300005719 | Ga0068861_100183218 | Ga0068861_1001832182 | 217 |
| 309 | 3300026118 | Ga0207675_100434024 | Ga0207675_1004340242 | 217 |
| 310 | 3300039447 | Ga0436361_0680656 | Ga0436361_0680656_179_832 | 217 |
| 311 | 3300048907 | Ga0496104_0000360 | Ga0496104_0000360_16057_16731 | 218 |
| 312 | 3300048908 | Ga0496105_0030762 | Ga0496105_0030762_2320_2994 | 218 |
| 313 | 3300048911 | Ga0496108_0031629 | Ga0496108_0031629_3375_4049 | 218 |
| 314 | 3300048912 | Ga0496109_0289332 | Ga0496109_0289332_814_1488 | 218 |
| 315 | 3300048913 | Ga0496110_0003669 | Ga0496110_0003669_7088_7762 | 218 |
| 316 | 3300048914 | Ga0496111_0000814 | Ga0496111_0000814_3370_4044 | 218 |
| 317 | 3300048915 | Ga0496112_0061288 | Ga0496112_0061288_2237_2911 | 218 |
| 318 | 3300048916 | Ga0496113_0011714 | Ga0496113_0011714_4507_5181 | 218 |
| 319 | 3300049585 | Ga0501069_0177438 | Ga0501069_0177438_257_931 | 219 |
| 320 | 3300005347 | Ga0070668_100086002 | Ga0070668_1000860022 | 220 |
| 321 | 3300005844 | Ga0068862_100624367 | Ga0068862_1006243672 | 220 |
| 322 | 3300006038 | Ga0075365_10011457 | Ga0075365_100114572 | 220 |
| 323 | 3300006042 | Ga0075368_10004349 | Ga0075368_100043496 | 220 |
| 324 | 3300006048 | Ga0075363_100012071 | Ga0075363_1000120716 | 220 |
| 325 | 3300006051 | Ga0075364_10001704 | Ga0075364_100017042 | 220 |
| 326 | 3300006178 | Ga0075367_10022463 | Ga0075367_100224632 | 220 |
| 327 | 3300006178 | Ga0075367_10070785 | Ga0075367_100707852 | 220 |
| 328 | 3300025972 | Ga0207668_10338369 | Ga0207668_103383692 | 220 |
| 329 | 3300027682 | Ga0209971_1071306 | Ga0209971_10713061 | 220 |
| 330 | 3300028380 | Ga0268265_10625678 | Ga0268265_106256781 | 220 |
| 331 | 3300050490 | nmdc:mga03n38_15866_c1 | nmdc:mga03n38_15866_c1_1564_2241 | 220 |
| 332 | 3300050491 | nmdc:mga00v17_246811_c1 | nmdc:mga00v17_246811_c1_60_737 | 220 |
| 333 | 3300050492 | nmdc:mga0yw44_21138_c1 | nmdc:mga0yw44_21138_c1_1803_2480 | 220 |
| 334 | 3300050494 | nmdc:mga06z11_10675_c1 | nmdc:mga06z11_10675_c1_2699_3376 | 220 |
| 335 | 3300050494 | nmdc:mga06z11_29967_c1 | nmdc:mga06z11_29967_c1_1375_2052 | 220 |
| 336 | 3300050495 | nmdc:mga04h51_10122_c1 | nmdc:mga04h51_10122_c1_698_1375 | 220 |
| 337 | 3300005347 | Ga0070668_100566660 | Ga0070668_1005666601 | 221 |
| 338 | 3300005365 | Ga0070688_100156657 | Ga0070688_1001566572 | 221 |
| 339 | 3300005457 | Ga0070662_100346012 | Ga0070662_1003460122 | 221 |
| 340 | 3300005844 | Ga0068862_101225313 | Ga0068862_1012253131 | 221 |
| 341 | 3300006846 | Ga0075430_100236159 | Ga0075430_1002361592 | 221 |
| 342 | 3300006847 | Ga0075431_100574997 | Ga0075431_1005749972 | 221 |
| 343 | 3300006880 | Ga0075429_100499174 | Ga0075429_1004991742 | 221 |
| 344 | 3300025917 | Ga0207660_10711211 | Ga0207660_107112111 | 221 |
| 345 | 3300025933 | Ga0207706_10336835 | Ga0207706_103368352 | 221 |
| 346 | 3300026075 | Ga0207708_10087743 | Ga0207708_100877432 | 221 |
| 347 | 3300026116 | Ga0207674_10610376 | Ga0207674_106103762 | 221 |
| 348 | 3300049568 | Ga0501031_0009797 | Ga0501031_0009797_375_1040 | 221 |
| 349 | 3300049569 | Ga0501032_0156769 | Ga0501032_0156769_568_1233 | 221 |
| 350 | 3300049570 | Ga0501033_0419781 | Ga0501033_0419781_200_865 | 221 |
| 351 | 3300049572 | Ga0501036_0270913 | Ga0501036_0270913_399_1064 | 221 |
| 352 | 3300049574 | Ga0501038_0020260 | Ga0501038_0020260_2978_3643 | 221 |
| 353 | 3300049575 | Ga0501039_0002429 | Ga0501039_0002429_12334_12999 | 221 |
| 354 | 3300049576 | Ga0501040_0025589 | Ga0501040_0025589_448_1113 | 221 |
| 355 | 3300049577 | Ga0501041_0005311 | Ga0501041_0005311_3094_3759 | 221 |
| 356 | 3300049578 | Ga0501042_0033042 | Ga0501042_0033042_2544_3209 | 221 |
| 357 | 3300049579 | Ga0501043_0067430 | Ga0501043_0067430_1821_2486 | 221 |
| 358 | 3300049580 | Ga0501046_0038489 | Ga0501046_0038489_2155_2820 | 221 |
| 359 | 3300049582 | Ga0501048_0169010 | Ga0501048_0169010_493_1158 | 221 |
| 360 | 3300049583 | Ga0501067_0161912 | Ga0501067_0161912_61_726 | 221 |
| 361 | 3300049584 | Ga0501068_0106878 | Ga0501068_0106878_285_950 | 221 |
| 362 | 3300049585 | Ga0501069_0157206 | Ga0501069_0157206_395_1060 | 221 |
| 363 | 3300049586 | Ga0501070_0146498 | Ga0501070_0146498_944_1609 | 221 |
| 364 | 3300049587 | Ga0501071_0285781 | Ga0501071_0285781_203_868 | 221 |
| 365 | 3300049589 | Ga0501073_0065903 | Ga0501073_0065903_823_1488 | 221 |
| 366 | 3300049591 | Ga0501075_0099547 | Ga0501075_0099547_637_1302 | 221 |
| 367 | 3300049593 | Ga0501077_0115874 | Ga0501077_0115874_286_951 | 221 |
| 368 | 3300049741 | Ga0501079_0019330 | Ga0501079_0019330_572_1237 | 221 |
| 369 | 3300049742 | Ga0501080_0240875 | Ga0501080_0240875_211_876 | 221 |
| 370 | 3300049743 | Ga0501081_0034510 | Ga0501081_0034510_2414_3079 | 221 |
| 371 | 3300049822 | Ga0501035_0055100 | Ga0501035_0055100_1098_1763 | 221 |
| 372 | 3300049824 | Ga0501045_0243179 | Ga0501045_0243179_243_908 | 221 |
| 373 | 3300050510 | nmdc:mga06r32_541367_c1 | nmdc:mga06r32_541367_c1_382_1065 | 221 |
| 374 | 3300054114 | Ga0501084_0007482 | Ga0501084_0007482_891_1556 | 221 |
| 375 | 3300061734 | Ga0530510_0086448 | Ga0530510_0086448_479_1144 | 221 |
| 376 | 3300005719 | Ga0068861_100135574 | Ga0068861_1001355742 | 222 |
| 377 | 3300005937 | Ga0081455_10017063 | Ga0081455_100170633 | 222 |
| 378 | 3300009094 | Ga0111539_11595329 | Ga0111539_115953291 | 222 |
| 379 | 3300012495 | Ga0157323_1001688 | Ga0157323_10016882 | 222 |
| 380 | 3300035115 | Ga0373941_0058749 | Ga0373941_0058749_422_1108 | 222 |
| 381 | 3300035171 | Ga0373946_0062175 | Ga0373946_0062175_726_1394 | 222 |
| 382 | 3300035691 | Ga0373931_0426098 | Ga0373931_0426098_36_722 | 222 |
| 383 | 3300035692 | Ga0373935_0029448 | Ga0373935_0029448_1644_2312 | 222 |
| 384 | 3300035695 | Ga0373927_0014041 | Ga0373927_0014041_2897_3565 | 222 |
| 385 | 3300035725 | Ga0373947_0003079 | Ga0373947_0003079_2472_3140 | 222 |
| 386 | 3300037068 | Ga0373925_0003993 | Ga0373925_0003993_3025_3693 | 222 |
| 387 | 3300046455 | Ga0495603_0000303 | Ga0495603_0000303_13736_14404 | 222 |
| 388 | 3300046459 | Ga0495629_0017757 | Ga0495629_0017757_236_904 | 222 |
| 389 | 3300046461 | Ga0495641_0078526 | Ga0495641_0078526_290_958 | 222 |
| 390 | 3300046472 | Ga0495580_0002543 | Ga0495580_0002543_686_1354 | 222 |
| 391 | 3300046473 | Ga0495582_0004516 | Ga0495582_0004516_6748_7416 | 222 |
| 392 | 3300046475 | Ga0495639_0032262 | Ga0495639_0032262_1093_1761 | 222 |
| 393 | 3300046499 | Ga0495594_0005029 | Ga0495594_0005029_5845_6513 | 222 |
| 394 | 3300046557 | Ga0495622_0002377 | Ga0495622_0002377_7649_8317 | 222 |
| 395 | 3300046642 | Ga0495634_0016928 | Ga0495634_0016928_17_685 | 222 |
| 396 | 3300046663 | Ga0495635_0423406 | Ga0495635_0423406_198_866 | 222 |
| 397 | 3300046674 | Ga0495588_0027423 | Ga0495588_0027423_2055_2723 | 222 |
| 398 | 3300046683 | Ga0495658_0005365 | Ga0495658_0005365_3541_4209 | 222 |
| 399 | 3300046689 | Ga0495613_0004315 | Ga0495613_0004315_9005_9673 | 222 |
| 400 | 3300047321 | Ga0495676_0381583 | Ga0495676_0381583_228_896 | 222 |
| 401 | 3300047322 | Ga0495680_0025863 | Ga0495680_0025863_2067_2735 | 222 |
| 402 | 3300047673 | Ga0495593_0001092 | Ga0495593_0001092_7714_8382 | 222 |
| 403 | 3300049575 | Ga0501039_0150317 | Ga0501039_0150317_289_996 | 222 |
| 404 | 3300050511 | nmdc:mga08y16_1037771_c1 | nmdc:mga08y16_1037771_c1_19_705 | 222 |
| 405 | 3300053083 | Ga0495655_0033511 | Ga0495655_0033511_454_1140 | 222 |
| 406 | 3300053084 | Ga0495595_0155336 | Ga0495595_0155336_233_901 | 222 |
| 407 | 3300053085 | Ga0495619_0006693 | Ga0495619_0006693_3595_4263 | 222 |
| 408 | 3300001989 | JGI24739J22299_10034217 | JGI24739J22299_100342172 | 224 |
| 409 | 3300002075 | JGI24738J21930_10008485 | JGI24738J21930_100084852 | 224 |
| 410 | 3300005328 | Ga0070676_10053362 | Ga0070676_100533621 | 224 |
| 411 | 3300005330 | Ga0070690_100000303 | Ga0070690_1000003038 | 224 |
| 412 | 3300005331 | Ga0070670_100027428 | Ga0070670_1000274281 | 224 |
| 413 | 3300005334 | Ga0068869_100047921 | Ga0068869_1000479212 | 224 |
| 414 | 3300005335 | Ga0070666_10002091 | Ga0070666_100020914 | 224 |
| 415 | 3300005336 | Ga0070680_100052690 | Ga0070680_1000526904 | 224 |
| 416 | 3300005337 | Ga0070682_100081450 | Ga0070682_1000814502 | 224 |
| 417 | 3300005339 | Ga0070660_100729802 | Ga0070660_1007298021 | 224 |
| 418 | 3300005340 | Ga0070689_100021918 | Ga0070689_1000219185 | 224 |
| 419 | 3300005341 | Ga0070691_10001279 | Ga0070691_100012798 | 224 |
| 420 | 3300005343 | Ga0070687_100001187 | Ga0070687_1000011877 | 224 |
| 421 | 3300005344 | Ga0070661_100003828 | Ga0070661_1000038288 | 224 |
| 422 | 3300005345 | Ga0070692_10002001 | Ga0070692_100020016 | 224 |
| 423 | 3300005347 | Ga0070668_100020364 | Ga0070668_1000203642 | 224 |
| 424 | 3300005353 | Ga0070669_100000391 | Ga0070669_10000039131 | 224 |
| 425 | 3300005354 | Ga0070675_100235175 | Ga0070675_1002351752 | 224 |
| 426 | 3300005355 | Ga0070671_100013327 | Ga0070671_1000133272 | 224 |
| 427 | 3300005356 | Ga0070674_100000430 | Ga0070674_1000004304 | 224 |
| 428 | 3300005364 | Ga0070673_100005733 | Ga0070673_1000057335 | 224 |
| 429 | 3300005365 | Ga0070688_100002877 | Ga0070688_1000028776 | 224 |
| 430 | 3300005366 | Ga0070659_100026803 | Ga0070659_1000268034 | 224 |
| 431 | 3300005367 | Ga0070667_100000918 | Ga0070667_10000091820 | 224 |
| 432 | 3300005434 | Ga0070709_10461642 | Ga0070709_104616422 | 224 |
| 433 | 3300005435 | Ga0070714_100007818 | Ga0070714_1000078186 | 224 |
| 434 | 3300005436 | Ga0070713_100046176 | Ga0070713_1000461762 | 224 |
| 435 | 3300005437 | Ga0070710_10044685 | Ga0070710_100446852 | 224 |
| 436 | 3300005438 | Ga0070701_10084637 | Ga0070701_100846371 | 224 |
| 437 | 3300005440 | Ga0070705_100001203 | Ga0070705_1000012032 | 224 |
| 438 | 3300005441 | Ga0070700_100029758 | Ga0070700_1000297583 | 224 |
| 439 | 3300005444 | Ga0070694_100003505 | Ga0070694_1000035054 | 224 |
| 440 | 3300005455 | Ga0070663_100000890 | Ga0070663_10000089013 | 224 |
| 441 | 3300005457 | Ga0070662_100019029 | Ga0070662_1000190294 | 224 |
| 442 | 3300005530 | Ga0070679_100081129 | Ga0070679_1000811292 | 224 |
| 443 | 3300005535 | Ga0070684_100120725 | Ga0070684_1001207252 | 224 |
| 444 | 3300005536 | Ga0070697_100058237 | Ga0070697_1000582371 | 224 |
| 445 | 3300005543 | Ga0070672_100020553 | Ga0070672_1000205535 | 224 |
| 446 | 3300005544 | Ga0070686_100004608 | Ga0070686_1000046085 | 224 |
| 447 | 3300005545 | Ga0070695_100027254 | Ga0070695_1000272544 | 224 |
| 448 | 3300005545 | Ga0070695_100244029 | Ga0070695_1002440291 | 224 |
| 449 | 3300005546 | Ga0070696_100000728 | Ga0070696_1000007282 | 224 |
| 450 | 3300005547 | Ga0070693_100032550 | Ga0070693_1000325502 | 224 |
| 451 | 3300005549 | Ga0070704_100006503 | Ga0070704_1000065031 | 224 |
| 452 | 3300005563 | Ga0068855_100007702 | Ga0068855_1000077022 | 224 |
| 453 | 3300005564 | Ga0070664_100006680 | Ga0070664_1000066801 | 224 |
| 454 | 3300005577 | Ga0068857_100050602 | Ga0068857_1000506025 | 224 |
| 455 | 3300005578 | Ga0068854_100005281 | Ga0068854_1000052815 | 224 |
| 456 | 3300005614 | Ga0068856_100515825 | Ga0068856_1005158252 | 224 |
| 457 | 3300005615 | Ga0070702_100000098 | Ga0070702_10000009814 | 224 |
| 458 | 3300005615 | Ga0070702_100378648 | Ga0070702_1003786481 | 224 |
| 459 | 3300005616 | Ga0068852_101039281 | Ga0068852_1010392811 | 224 |
| 460 | 3300005617 | Ga0068859_100012414 | Ga0068859_1000124145 | 224 |
| 461 | 3300005618 | Ga0068864_100024278 | Ga0068864_1000242785 | 224 |
| 462 | 3300005718 | Ga0068866_10065108 | Ga0068866_100651082 | 224 |
| 463 | 3300005719 | Ga0068861_100021324 | Ga0068861_1000213242 | 224 |
| 464 | 3300005841 | Ga0068863_100005195 | Ga0068863_10000519510 | 224 |
| 465 | 3300005842 | Ga0068858_100020434 | Ga0068858_1000204345 | 224 |
| 466 | 3300005843 | Ga0068860_100006370 | Ga0068860_1000063705 | 224 |
| 467 | 3300006058 | Ga0075432_10056968 | Ga0075432_100569682 | 224 |
| 468 | 3300006175 | Ga0070712_100001132 | Ga0070712_10000113214 | 224 |
| 469 | 3300006237 | Ga0097621_100173868 | Ga0097621_1001738682 | 224 |
| 470 | 3300006844 | Ga0075428_100620035 | Ga0075428_1006200351 | 224 |
| 471 | 3300006847 | Ga0075431_100024570 | Ga0075431_1000245705 | 224 |
| 472 | 3300006852 | Ga0075433_10139544 | Ga0075433_101395442 | 224 |
| 473 | 3300006871 | Ga0075434_100069525 | Ga0075434_1000695252 | 224 |
| 474 | 3300006880 | Ga0075429_100207694 | Ga0075429_1002076942 | 224 |
| 475 | 3300006881 | Ga0068865_100024141 | Ga0068865_1000241413 | 224 |
| 476 | 3300006914 | Ga0075436_100061914 | Ga0075436_1000619142 | 224 |
| 477 | 3300006931 | Ga0097620_100012416 | Ga0097620_1000124165 | 224 |
| 478 | 3300009011 | Ga0105251_10033581 | Ga0105251_100335813 | 224 |
| 479 | 3300009092 | Ga0105250_10104762 | Ga0105250_101047622 | 224 |
| 480 | 3300009094 | Ga0111539_10560083 | Ga0111539_105600832 | 224 |
| 481 | 3300009098 | Ga0105245_10019845 | Ga0105245_100198452 | 224 |
| 482 | 3300009147 | Ga0114129_10038332 | Ga0114129_100383325 | 224 |
| 483 | 3300009148 | Ga0105243_10006802 | Ga0105243_100068025 | 224 |
| 484 | 3300009174 | Ga0105241_10003267 | Ga0105241_1000326710 | 224 |
| 485 | 3300009176 | Ga0105242_10005740 | Ga0105242_100057409 | 224 |
| 486 | 3300009177 | Ga0105248_10019596 | Ga0105248_100195967 | 224 |
| 487 | 3300009545 | Ga0105237_10004528 | Ga0105237_1000452811 | 224 |
| 488 | 3300009553 | Ga0105249_10060208 | Ga0105249_100602082 | 224 |
| 489 | 3300010375 | Ga0105239_10014435 | Ga0105239_100144351 | 224 |
| 490 | 3300011119 | Ga0105246_10006915 | Ga0105246_100069156 | 224 |
| 491 | 3300013102 | Ga0157371_10192116 | Ga0157371_101921162 | 224 |
| 492 | 3300013104 | Ga0157370_10120500 | Ga0157370_101205002 | 224 |
| 493 | 3300013105 | Ga0157369_10020645 | Ga0157369_100206452 | 224 |
| 494 | 3300013297 | Ga0157378_10017766 | Ga0157378_100177662 | 224 |
| 495 | 3300013297 | Ga0157378_10127937 | Ga0157378_101279372 | 224 |
| 496 | 3300013306 | Ga0163162_10027271 | Ga0163162_100272715 | 224 |
| 497 | 3300013307 | Ga0157372_10000133 | Ga0157372_100001335 | 224 |
| 498 | 3300013308 | Ga0157375_10594043 | Ga0157375_105940432 | 224 |
| 499 | 3300014325 | Ga0163163_10653341 | Ga0163163_106533412 | 224 |
| 500 | 3300014326 | Ga0157380_10001318 | Ga0157380_100013182 | 224 |
| 501 | 3300014745 | Ga0157377_10004069 | Ga0157377_100040697 | 224 |
| 502 | 3300017792 | Ga0163161_10001599 | Ga0163161_1000159915 | 224 |
| 503 | 3300017792 | Ga0163161_10080282 | Ga0163161_100802822 | 224 |
| 504 | 3300025898 | Ga0207692_10018036 | Ga0207692_100180362 | 224 |
| 505 | 3300025899 | Ga0207642_10021956 | Ga0207642_100219563 | 224 |
| 506 | 3300025900 | Ga0207710_10002160 | Ga0207710_100021602 | 224 |
| 507 | 3300025901 | Ga0207688_10002567 | Ga0207688_100025677 | 224 |
| 508 | 3300025905 | Ga0207685_10001101 | Ga0207685_100011012 | 224 |
| 509 | 3300025906 | Ga0207699_10002019 | Ga0207699_100020198 | 224 |
| 510 | 3300025907 | Ga0207645_10056556 | Ga0207645_100565563 | 224 |
| 511 | 3300025911 | Ga0207654_10051134 | Ga0207654_100511342 | 224 |
| 512 | 3300025912 | Ga0207707_10029312 | Ga0207707_100293125 | 224 |
| 513 | 3300025914 | Ga0207671_10134415 | Ga0207671_101344152 | 224 |
| 514 | 3300025915 | Ga0207693_10000062 | Ga0207693_100000627 | 224 |
| 515 | 3300025916 | Ga0207663_10000652 | Ga0207663_1000065210 | 224 |
| 516 | 3300025917 | Ga0207660_10428927 | Ga0207660_104289272 | 224 |
| 517 | 3300025918 | Ga0207662_10005248 | Ga0207662_100052485 | 224 |
| 518 | 3300025919 | Ga0207657_10000023 | Ga0207657_1000002375 | 224 |
| 519 | 3300025924 | Ga0207694_10074161 | Ga0207694_100741612 | 224 |
| 520 | 3300025926 | Ga0207659_10186751 | Ga0207659_101867512 | 224 |
| 521 | 3300025929 | Ga0207664_10479792 | Ga0207664_104797921 | 224 |
| 522 | 3300025931 | Ga0207644_10022454 | Ga0207644_100224542 | 224 |
| 523 | 3300025932 | Ga0207690_10003754 | Ga0207690_100037542 | 224 |
| 524 | 3300025933 | Ga0207706_10000019 | Ga0207706_1000001982 | 224 |
| 525 | 3300025935 | Ga0207709_10030603 | Ga0207709_100306032 | 224 |
| 526 | 3300025936 | Ga0207670_10011387 | Ga0207670_100113872 | 224 |
| 527 | 3300025937 | Ga0207669_10015302 | Ga0207669_100153025 | 224 |
| 528 | 3300025938 | Ga0207704_10075725 | Ga0207704_100757251 | 224 |
| 529 | 3300025939 | Ga0207665_10000205 | Ga0207665_1000020511 | 224 |
| 530 | 3300025940 | Ga0207691_10003337 | Ga0207691_1000333711 | 224 |
| 531 | 3300025941 | Ga0207711_10017832 | Ga0207711_100178326 | 224 |
| 532 | 3300025942 | Ga0207689_10069797 | Ga0207689_100697972 | 224 |
| 533 | 3300025945 | Ga0207679_10063991 | Ga0207679_100639913 | 224 |
| 534 | 3300025960 | Ga0207651_10003035 | Ga0207651_100030356 | 224 |
| 535 | 3300025961 | Ga0207712_10006286 | Ga0207712_100062866 | 224 |
| 536 | 3300025972 | Ga0207668_10616449 | Ga0207668_106164492 | 224 |
| 537 | 3300025986 | Ga0207658_10024089 | Ga0207658_100240892 | 224 |
| 538 | 3300026035 | Ga0207703_10094549 | Ga0207703_100945492 | 224 |
| 539 | 3300026041 | Ga0207639_10012778 | Ga0207639_100127782 | 224 |
| 540 | 3300026067 | Ga0207678_10000017 | Ga0207678_1000001782 | 224 |
| 541 | 3300026075 | Ga0207708_10001248 | Ga0207708_100012488 | 224 |
| 542 | 3300026078 | Ga0207702_10927241 | Ga0207702_109272412 | 224 |
| 543 | 3300026088 | Ga0207641_10024899 | Ga0207641_100248992 | 224 |
| 544 | 3300026095 | Ga0207676_10558598 | Ga0207676_105585982 | 224 |
| 545 | 3300026116 | Ga0207674_10000437 | Ga0207674_1000043731 | 224 |
| 546 | 3300026118 | Ga0207675_100000771 | Ga0207675_1000007715 | 224 |
| 547 | 3300026121 | Ga0207683_10000030 | Ga0207683_1000003018 | 224 |
| 548 | 3300026142 | Ga0207698_11114775 | Ga0207698_111147751 | 224 |
| 549 | 3300028380 | Ga0268265_10026606 | Ga0268265_100266063 | 224 |
| 550 | 3300034816 | Ga0373930_0026235 | Ga0373930_0026235_279_953 | 224 |
| 551 | 3300034817 | Ga0373948_0065358 | Ga0373948_0065358_118_792 | 224 |
| 552 | 3300035084 | Ga0373928_0021642 | Ga0373928_0021642_529_1203 | 224 |
| 553 | 3300035090 | Ga0373949_0028250 | Ga0373949_0028250_180_854 | 224 |
| 554 | 3300038996 | Ga0242420_011176 | Ga0242420_011176_482_1156 | 224 |
| 555 | 3300048903 | Ga0496100_0001066 | Ga0496100_0001066_3695_4369 | 224 |
| 556 | 3300048904 | Ga0496101_0042695 | Ga0496101_0042695_2138_2812 | 224 |
| 557 | 3300048904 | Ga0496101_0500236 | Ga0496101_0500236_109_819 | 224 |
| 558 | 3300048905 | Ga0496102_0008755 | Ga0496102_0008755_1751_2425 | 224 |
| 559 | 3300048906 | Ga0496103_0001043 | Ga0496103_0001043_10203_10877 | 224 |
| 560 | 3300048907 | Ga0496104_0490681 | Ga0496104_0490681_309_983 | 224 |
| 561 | 3300048908 | Ga0496105_0026238 | Ga0496105_0026238_380_1054 | 224 |
| 562 | 3300048909 | Ga0496106_0014625 | Ga0496106_0014625_3697_4371 | 224 |
| 563 | 3300048910 | Ga0496107_0040826 | Ga0496107_0040826_2629_3303 | 224 |
| 564 | 3300048910 | Ga0496107_0045801 | Ga0496107_0045801_1021_1731 | 224 |
| 565 | 3300048911 | Ga0496108_0089462 | Ga0496108_0089462_192_866 | 224 |
| 566 | 3300048912 | Ga0496109_0063532 | Ga0496109_0063532_1243_1917 | 224 |
| 567 | 3300048913 | Ga0496110_0014474 | Ga0496110_0014474_2182_2856 | 224 |
| 568 | 3300048914 | Ga0496111_0024744 | Ga0496111_0024744_1971_2645 | 224 |
| 569 | 3300048916 | Ga0496113_0042523 | Ga0496113_0042523_586_1260 | 224 |
| 570 | 3300048917 | Ga0496114_0002707 | Ga0496114_0002707_7957_8631 | 224 |
| 571 | 3300048918 | Ga0496115_0690107 | Ga0496115_0690107_93_767 | 224 |
| 572 | 3300050507 | nmdc:mga05p37_152272_c1 | nmdc:mga05p37_152272_c1_531_1205 | 224 |
| 573 | 3300050507 | nmdc:mga05p37_39808_c1 | nmdc:mga05p37_39808_c1_2372_3046 | 224 |
| 574 | 3300050510 | nmdc:mga06r32_13764_c1 | nmdc:mga06r32_13764_c1_746_1420 | 224 |
| 575 | 3300050511 | nmdc:mga08y16_104157_c1 | nmdc:mga08y16_104157_c1_2157_2831 | 224 |
| 576 | 3300050512 | nmdc:mga0n895_380869_c1 | nmdc:mga0n895_380869_c1_610_1284 | 224 |
| 577 | 3300050514 | nmdc:mga08x19_16357_c1 | nmdc:mga08x19_16357_c1_2403_3077 | 224 |
| 578 | 3300050515 | nmdc:mga0a205_7774_c1 | nmdc:mga0a205_7774_c1_6761_7435 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8635 | 5 | 210 |
| 3bby-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution | 0.8625 | 3 | 213 |
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.858 | 5 | 215 |
| 3bby-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution | 0.8542 | 3 | 213 |
| 4isd-assembly2.cif.gz_B | crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione | 0.8491 | 5 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4isdD01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8934 | 5 | 83 | 3.40.30.10 |
| 3bbyA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8779 | 3 | 81 | 3.40.30.10 |
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8738 | 21 | 83 | 3.40.30.10 |
| 4mp4A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8698 | 5 | 86 | 3.40.30.10 |
| 3fhsB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8697 | 3 | 84 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N0DX65-F1-model_v4 | Glutathione S-transferase family protein | 0.9855 | 1 | 222 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A348G0D0-F1-model_v4 | Glutathione S-transferase | 0.9841 | 6 | 212 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A679JMZ2-F1-model_v4 | Dichloromethane dehalogenase (EC 4.5.1.3) | 0.9835 | 6 | 212 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 GO:0018834 |
| AF-A0A522M3S8-F1-model_v4 | Glutathione S-transferase family protein | 0.9832 | 5 | 214 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A1Q7VK14-F1-model_v4 | GST N-terminal domain-containing protein | 0.9828 | 6 | 214 |
GO:0004364
GO:0006559 GO:0006749 GO:0016034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar