F465743

General Info

Members Datasets Scaffolds Average Seq Length
578 333 1156 306

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10090622|Ga0307405_100906222
Length 351
Sequence LRAAVLGTPKPAGPAAPKMPVRNGQRRHMDRWTEIELFVQTAELGSLSRAAEAVGLSNAAASRHLASLEGRLGVQLVQRNTRRLALTEMGESYYVRCKAILADLRDADAIVNATALDPMGTLRVTASLSFAMQHIAPLLRAYTERYPKVTVHVEVANRYLDLIDNNIDVAIRTREYENDSGITIRSLAETRRVLAASPGYLDRRGAPRRVEELATHDLLLYTYSNKPDELAFRRGEEQRTIRVKGLLESNDGQVLRAAALDGLGILVQPKYILYEDIVAGRLVPVLDDWDLPRLRINLAFQSRRHMSAKVRTFIDFLAAHFERMDYQRKWTSFDAGAGGEPGAAQRGGAPS

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
163 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
164 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
167 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
290 2511231022 Pseudomonas sp. GM79 Isolate Nodule
291 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
292 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
293 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
294 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
295 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
296 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
297 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
298 2643221609 Acidovorax sp. Root217 Isolate Unclassified
299 2643221611 Acidovorax sp. Root219 Isolate Unclassified
300 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
301 2643221658 Variovorax sp. Root411 Isolate Unclassified
302 2643221672 Variovorax sp. Root434 Isolate Unclassified
303 2738541277 Variovorax sp. GV051 Isolate Unclassified
304 2738541307 Variovorax sp. GV008 Isolate Unclassified
305 2738543012 Acidovorax sp. CF301 Isolate Unclassified
306 2738543019 Variovorax sp. GV040 Isolate Unclassified
307 2816332133 Acidovorax radicis 2721A Isolate Unclassified
308 2818991446 Variovorax sp. 1180 Isolate Unclassified
309 2818991450 Burkholderia sp. 604 Isolate Unclassified
310 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
311 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
312 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
313 2885198086 Variovorax sp. 679 Isolate Unclassified
314 2885211737 Variovorax sp. 553 Isolate Unclassified
315 2899924645 Variovorax sp. 369 Isolate Unclassified
316 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
317 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
318 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
319 2904456579 Variovorax sp. 2002 Isolate Unclassified
320 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
321 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
322 2928037797 Variovorax sp. 1126 Isolate Unclassified
323 2928044640 Variovorax sp. 1128 Isolate Unclassified
324 2928051484 Variovorax sp. 1133 Isolate Unclassified
325 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
326 2928070936 Variovorax gossypii 1167 Isolate Unclassified
327 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
328 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
329 2929520902 Variovorax beijingensis 502 Isolate Unclassified
330 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
331 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
332 641522639 Methylobacterium sp. 4-46 Isolate Nodule
333 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.7
Metatranscriptomes 0
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.55
Nodule 0.87
Rhizoplane 2.08
Rhizosphere 62.63
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10090622 3300031731 Bacteria 2023
2 JGI24740J21852_10010609 3300001979 Bacteria 3539
3 JGI25155J39150_1000625 3300002704 Bacteria 7349
4 JGI25156J39149_1018298 3300002705 Bacteria 1298
5 JGI25154J39366_1001194 3300002738 Bacteria 9859
6 JGI25152J39213_1002509 3300002773 Bacteria 6931
7 JGI25150J39212_1001450 3300002774 Bacteria 6616
8 JGI25159J45721_1008409 3300002987 Bacteria 2835
9 JGI25159J45721_1013293 3300002987 Bacteria 1914
10 JGI25151J46595_10000319 3300003187 Bacteria 52040
11 JGI25151J46595_10000748 3300003187 Bacteria 26504
12 Ga0055535_1000422 3300003761 Bacteria 39771
13 Ga0055542_1000074 3300003762 Bacteria 141185
14 Ga0055537_1000769 3300003773 Bacteria 16259
15 Ga0055537_1001115 3300003773 Bacteria 11612
16 Ga0055536_1003824 3300003781 Bacteria 7924
17 Ga0055536_1010095 3300003781 Bacteria 3799
18 Ga0055534_1003902 3300003784 Bacteria 4521
19 Ga0055528_1001962 3300003790 Bacteria 11612
20 Ga0055528_1003567 3300003790 Bacteria 7758
21 Ga0055530_10000860 3300003791 Bacteria 25047
22 Ga0055530_10005096 3300003791 Bacteria 6434
23 Ga0055540_1001520 3300003792 Bacteria 13685
24 Ga0055540_1002037 3300003792 Bacteria 11185
25 Ga0055540_1003472 3300003792 Bacteria 7607
26 Ga0055531_10000941 3300003794 Bacteria 23494
27 Ga0055531_10001221 3300003794 Bacteria 19608
28 Ga0055531_10002104 3300003794 Bacteria 13685
29 Ga0055531_10006372 3300003794 Bacteria 6713
30 Ga0055543_1001117 3300004625 Bacteria 11537
31 Ga0065165_1003053 3300005262 Bacteria 12539
32 Ga0065165_1009839 3300005262 Bacteria 4220
33 Ga0065714_10066731 3300005288 Bacteria 6393
34 Ga0070676_10003210 3300005328 Bacteria 8475
35 Ga0070670_100076493 3300005331 Bacteria 2876
36 Ga0068868_100099710 3300005338 Bacteria 2350
37 Ga0070669_100044278 3300005353 Bacteria 3243
38 Ga0070675_100007910 3300005354 Bacteria 8240
39 Ga0070671_100071631 3300005355 Bacteria 2893
40 Ga0070673_100025508 3300005364 Bacteria 4353
41 Ga0070659_100033731 3300005366 Bacteria 3978
42 Ga0070659_100064296 3300005366 Bacteria 2904
43 Ga0070663_100206474 3300005455 Unclassified 1536
44 Ga0070678_100022140 3300005456 Bacteria 4203
45 Ga0068867_100001085 3300005459 Bacteria 18625
46 Ga0070698_100202952 3300005471 Bacteria 1918
47 Ga0068853_100002357 3300005539 Bacteria 14135
48 Ga0068853_100193237 3300005539 Bacteria 1850
49 Ga0070672_100001313 3300005543 Bacteria 15322
50 Ga0070665_100206007 3300005548 Bacteria 1967
51 Ga0068855_100108408 3300005563 Bacteria 3190
52 Ga0070664_100122172 3300005564 Bacteria 2281
53 Ga0070664_100129733 3300005564 Bacteria 2214
54 Ga0068857_100105824 3300005577 Bacteria 2526
55 Ga0068854_100247983 3300005578 Bacteria 1421
56 Ga0068852_100045747 3300005616 Bacteria 3725
57 Ga0068851_10004140 3300005834 Bacteria 6528
58 Ga0068851_10009751 3300005834 Bacteria 4472
59 Ga0068870_10023339 3300005840 Bacteria 3049
60 Ga0068862_100022808 3300005844 Bacteria 5238
61 Ga0075365_10000475 3300006038 Bacteria 15140
62 Ga0075365_10001106 3300006038 Bacteria 11756
63 Ga0075365_10068915 3300006038 Bacteria 2377
64 Ga0075363_100056622 3300006048 Bacteria 2102
65 Ga0075432_10018132 3300006058 Bacteria 2400
66 Ga0075432_10037719 3300006058 Bacteria 1683
67 Ga0075362_10022570 3300006177 Bacteria 2653
68 Ga0075367_10097831 3300006178 Bacteria 1791
69 Ga0075366_10024357 3300006195 Bacteria 3530
70 Ga0097621_100209974 3300006237 Bacteria 1694
71 Ga0075370_10002231 3300006353 Bacteria 8910
72 Ga0075370_10008143 3300006353 Bacteria 5380
73 Ga0075370_10064162 3300006353 Bacteria 2094
74 Ga0068871_100103223 3300006358 Bacteria 2390
75 Ga0105251_10000044 3300009011 Bacteria 113730
76 Ga0105244_10005708 3300009036 Bacteria 8214
77 Ga0105244_10008568 3300009036 Bacteria 6377
78 Ga0105244_10014006 3300009036 Bacteria 4655
79 Ga0105244_10095277 3300009036 Bacteria 1461
80 Ga0105250_10009376 3300009092 Bacteria 4125
81 Ga0105250_10036987 3300009092 Bacteria 1959
82 Ga0105240_10076623 3300009093 Bacteria 4122
83 Ga0105240_10105838 3300009093 Bacteria 3414
84 Ga0105245_10153704 3300009098 Bacteria 2178
85 Ga0105245_10200274 3300009098 Bacteria 1917
86 Ga0105243_10002680 3300009148 Bacteria 14793
87 Ga0105243_10404212 3300009148 Bacteria 1269
88 Ga0105241_10101770 3300009174 Bacteria 2285
89 Ga0105242_10396528 3300009176 Bacteria 1287
90 Ga0105237_10116320 3300009545 Bacteria 2667
91 Ga0105237_10172918 3300009545 Bacteria 2160
92 Ga0105246_10008048 3300011119 Bacteria 6471
93 Ga0105246_10090628 3300011119 Bacteria 2202
94 Ga0157371_10013731 3300013102 Bacteria 6141
95 Ga0157371_10128646 3300013102 Bacteria 1801
96 Ga0157370_10007277 3300013104 Bacteria 12079
97 Ga0157369_10004076 3300013105 Bacteria 17299
98 Ga0163162_10392457 3300013306 Unclassified 1520
99 Ga0157372_10014374 3300013307 Bacteria 8465
100 Ga0157375_10219159 3300013308 Bacteria 2061
101 Ga0182008_10000038 3300014497 Bacteria 129386
102 Ga0182008_10000137 3300014497 Bacteria 55850
103 Ga0182008_10008156 3300014497 Bacteria 5734
104 Ga0182008_10009725 3300014497 Bacteria 5178
105 Ga0157376_10356535 3300014969 Bacteria 1401
106 Ga0182006_1000779 3300015261 Bacteria 21592
107 Ga0182006_1053835 3300015261 Unclassified 1541
108 Ga0182007_10000246 3300015262 Bacteria 36410
109 Ga0182007_10006053 3300015262 Bacteria 5230
110 Ga0182007_10039158 3300015262 Bacteria 1587
111 Ga0182005_1041329 3300015265 Bacteria 1254
112 Ga0163161_10000521 3300017792 Bacteria 31378
113 Ga0163161_10004883 3300017792 Bacteria 9341
114 Ga0213872_10059674 3300021361 Bacteria 1726
115 Ga0209435_100096 3300025206 Bacteria 38561
116 Ga0209672_102024 3300025228 Bacteria 5566
117 Ga0209147_100419 3300025229 Bacteria 27989
118 Ga0209258_100176 3300025242 Bacteria 141261
119 Ga0207425_1000133 3300025245 Bacteria 67802
120 Ga0209646_1000093 3300025246 Bacteria 183840
121 Ga0209026_1006454 3300025250 Bacteria 2859
122 Ga0209148_1000033 3300025254 Bacteria 555508
123 Ga0209759_1000248 3300025256 Bacteria 80537
124 Ga0209129_1000186 3300025258 Bacteria 85793
125 Ga0209129_1000700 3300025258 Bacteria 21883
126 Ga0209129_1002228 3300025258 Bacteria 9711
127 Ga0209565_1000190 3300025263 Bacteria 75207
128 Ga0209673_1000209 3300025273 Bacteria 117670
129 Ga0209673_1000393 3300025273 Bacteria 78531
130 Ga0209673_1002517 3300025273 Bacteria 12573
131 Ga0209673_1053782 3300025273 Bacteria 1047
132 Ga0209130_1000335 3300025284 Bacteria 53993
133 Ga0209130_1000433 3300025284 Bacteria 44915
134 Ga0209675_1000300 3300025291 Bacteria 45407
135 Ga0209675_1000330 3300025291 Bacteria 41678
136 Ga0209675_1008403 3300025291 Bacteria 3800
137 Ga0209676_1000048 3300025292 Bacteria 403716
138 Ga0209676_1000618 3300025292 Bacteria 51827
139 Ga0209676_1002336 3300025292 Bacteria 13712
140 Ga0209676_1008753 3300025292 Bacteria 4461
141 Ga0209025_1000324 3300025294 Bacteria 106257
142 Ga0209025_1000597 3300025294 Bacteria 65153
143 Ga0209025_1000947 3300025294 Bacteria 44024
144 Ga0209025_1058059 3300025294 Bacteria 1473
145 Ga0209564_1000417 3300025295 Bacteria 74808
146 Ga0209564_1000423 3300025295 Bacteria 74528
147 Ga0209758_1000092 3300025297 Bacteria 241910
148 Ga0209758_1002789 3300025297 Bacteria 17080
149 Ga0209050_1000012 3300025298 Bacteria 813717
150 Ga0209050_1002843 3300025298 Bacteria 13737
151 Ga0209050_1010544 3300025298 Bacteria 4536
152 Ga0209256_1000094 3300025299 Bacteria 208177
153 Ga0209256_1000095 3300025299 Bacteria 206120
154 Ga0207426_1000084 3300025302 Bacteria 298123
155 Ga0207426_1000161 3300025302 Bacteria 172765
156 Ga0209051_1000019 3300025303 Bacteria 511268
157 Ga0209051_1000207 3300025303 Bacteria 103683
158 Ga0209051_1000456 3300025303 Bacteria 54000
159 Ga0209051_1005182 3300025303 Bacteria 7718
160 Ga0209257_1000015 3300025304 Bacteria 908141
161 Ga0209257_1000024 3300025304 Bacteria 726068
162 Ga0209257_1000258 3300025304 Bacteria 122220
163 Ga0209257_1002906 3300025304 Bacteria 15829
164 Ga0207656_10002163 3300025321 Bacteria 6569
165 Ga0207655_1000845 3300025728 Bacteria 32859
166 Ga0207655_1001510 3300025728 Bacteria 21219
167 Ga0207655_1029780 3300025728 Bacteria 2549
168 Ga0207713_1000113 3300025735 Bacteria 132424
169 Ga0207647_10037287 3300025904 Bacteria 3083
170 Ga0207647_10086263 3300025904 Bacteria 1876
171 Ga0207645_10008543 3300025907 Bacteria 7136
172 Ga0207643_10036671 3300025908 Bacteria 2750
173 Ga0207705_10263901 3300025909 Bacteria 1315
174 Ga0207695_10078337 3300025913 Bacteria 3353
175 Ga0207695_10104095 3300025913 Bacteria 2828
176 Ga0207695_10196979 3300025913 Bacteria 1930
177 Ga0207657_10113380 3300025919 Bacteria 2237
178 Ga0207694_10049719 3300025924 Bacteria 3245
179 Ga0207650_10341764 3300025925 Bacteria 1229
180 Ga0207659_10099786 3300025926 Bacteria 2186
181 Ga0207687_10037687 3300025927 Bacteria 3300
182 Ga0207644_10043195 3300025931 Bacteria 3198
183 Ga0207690_10036876 3300025932 Bacteria 3170
184 Ga0207706_10002677 3300025933 Bacteria 17361
185 Ga0207709_10000669 3300025935 Bacteria 27749
186 Ga0207709_10003070 3300025935 Bacteria 10085
187 Ga0207709_10004163 3300025935 Bacteria 8417
188 Ga0207669_10016776 3300025937 Bacteria 3735
189 Ga0207691_10015569 3300025940 Bacteria 7230
190 Ga0207679_10074384 3300025945 Bacteria 2574
191 Ga0207679_10145466 3300025945 Bacteria 1922
192 Ga0207667_10035396 3300025949 Bacteria 5356
193 Ga0207667_10052383 3300025949 Bacteria 4298
194 Ga0207667_10100144 3300025949 Bacteria 2989
195 Ga0207651_10038120 3300025960 Bacteria 3155
196 Ga0207658_10010616 3300025986 Bacteria 6259
197 Ga0207677_10010160 3300026023 Bacteria 5318
198 Ga0207639_10006236 3300026041 Bacteria 8101
199 Ga0207639_10008790 3300026041 Bacteria 6941
200 Ga0207639_10208950 3300026041 Bacteria 1679
201 Ga0207678_10124960 3300026067 Bacteria 2195
202 Ga0207678_10236285 3300026067 Unclassified 1565
203 Ga0207702_10204558 3300026078 Bacteria 1832
204 Ga0207648_10002091 3300026089 Bacteria 21749
205 Ga0207674_10015495 3300026116 Bacteria 8372
206 Ga0207674_10071378 3300026116 Bacteria 3489
207 Ga0207683_10023474 3300026121 Bacteria 5307
208 Ga0207683_10036799 3300026121 Bacteria 4262
209 Ga0209813_10083236 3300027866 Bacteria 1062
210 Ga0209974_10028423 3300027876 Bacteria 1852
211 Ga0268265_10024312 3300028380 Bacteria 4285
212 Ga0307515_10000195 3300028794 Bacteria 148138
213 Ga0307515_10351932 3300028794 Bacteria 1119
214 Ga0307513_10000104 3300031456 Bacteria 119239
215 Ga0307513_10007645 3300031456 Bacteria 13968
216 Ga0307513_10140448 3300031456 Bacteria 2343
217 Ga0307509_10001087 3300031507 Bacteria 46534
218 Ga0307408_100002368 3300031548 Bacteria 13310
219 Ga0307408_100004935 3300031548 Bacteria 8973
220 Ga0307408_100007142 3300031548 Bacteria 7393
221 Ga0307408_100230941 3300031548 Bacteria 1515
222 Ga0307508_10000155 3300031616 Bacteria 82771
223 Ga0307508_10000278 3300031616 Bacteria 62985
224 Ga0307514_10001288 3300031649 Bacteria 32569
225 Ga0307514_10009962 3300031649 Bacteria 7965
226 Ga0307410_10197783 3300031852 Bacteria 1533
227 Ga0307406_10006354 3300031901 Bacteria 6518
228 Ga0307407_10113972 3300031903 Bacteria 1702
229 Ga0307412_10014289 3300031911 Bacteria 4678
230 Ga0307412_10028388 3300031911 Bacteria 3499
231 Ga0307412_10050360 3300031911 Bacteria 2748
232 Ga0307412_10056914 3300031911 Bacteria 2608
233 Ga0307416_100005714 3300032002 Bacteria 7694
234 Ga0307416_100058233 3300032002 Bacteria 3131
235 Ga0307416_100502277 3300032002 Bacteria 1277
236 Ga0307414_10008504 3300032004 Bacteria 5825
237 Ga0307411_10000361 3300032005 Bacteria 15415
238 Ga0307411_10031826 3300032005 Bacteria 3251
239 Ga0395900_0014904 3300037418 Bacteria 7921
240 Ga0395905_0030746 3300037471 Bacteria 5057
241 Ga0395905_0055186 3300037471 Bacteria 3718
242 Ga0436361_1130701 3300039447 Bacteria 2723
243 Ga0439436_0000374 3300041404 Bacteria 11163
244 Ga0439439_0000021 3300041406 Bacteria 22666
245 Ga0439447_005582 3300041407 Bacteria 4165
246 Ga0439447_015870 3300041407 Bacteria 2080
247 Ga0439461_0005344 3300041410 Bacteria 2184
248 Ga0439466_0046632 3300041411 Bacteria 1430
249 Ga0439433_0049989 3300041999 Bacteria 985
250 Ga0439441_032416 3300042001 Bacteria 1018
251 Ga0439442_009025 3300042002 Bacteria 2016
252 Ga0439442_012341 3300042002 Bacteria 1746
253 Ga0439445_0020918 3300042004 Bacteria 1641
254 Ga0439445_0029533 3300042004 Bacteria 1417
255 Ga0439432_002487 3300042006 Bacteria 6942
256 Ga0439449_0000003 3300042007 Bacteria 94735
257 Ga0439452_001327 3300042010 Bacteria 10357
258 Ga0439452_029495 3300042010 Bacteria 1361
259 Ga0439462_0000090 3300042015 Bacteria 14033
260 Ga0439462_0001359 3300042015 Bacteria 5404
261 Ga0450911_000517 3300042115 Bacteria 12187
262 Ga0450898_010326 3300042134 Bacteria 1509
263 Ga0450906_004482 3300042145 Bacteria 2925
264 Ga0439446_0000737 3300042156 Bacteria 6864
265 Ga0439446_0031357 3300042156 Bacteria 1538
266 Ga0439446_0041666 3300042156 Bacteria 1354
267 Ga0450908_000504 3300042184 Bacteria 7529
268 Ga0450908_009529 3300042184 Bacteria 1803
269 Ga0450909_007353 3300042185 Bacteria 1593
270 Ga0439434_0001484 3300042435 Bacteria 6744
271 Ga0439434_0044535 3300042435 Bacteria 1367
272 Ga0439464_0001746 3300042439 Bacteria 5222
273 Ga0450918_000094 3300042531 Bacteria 18922
274 Ga0450893_0002044 3300042532 Bacteria 3141
275 Ga0451577_0057675 3300042876 Bacteria 3461
276 Ga0466965_0013703 3300044683 Bacteria 3828
277 Ga0466966_0119764 3300044684 Bacteria 1618
278 Ga0466957_0135931 3300044842 Bacteria 1580
279 Ga0466957_0243813 3300044842 Bacteria 1193
280 Ga0451576_0016907 3300045051 Bacteria 8034
281 Ga0495627_007646 3300046453 Bacteria 4126
282 Ga0495603_0035087 3300046455 Bacteria 3014
283 Ga0495591_000625 3300046458 Bacteria 26342
284 Ga0495591_007635 3300046458 Bacteria 4565
285 Ga0495591_016741 3300046458 Bacteria 2539
286 Ga0495629_0000364 3300046459 Bacteria 38314
287 Ga0495629_0001879 3300046459 Bacteria 16395
288 Ga0495629_0031162 3300046459 Bacteria 3777
289 Ga0495629_0177567 3300046459 Bacteria 1476
290 Ga0495638_0016669 3300046460 Bacteria 4916
291 Ga0495638_0029396 3300046460 Bacteria 3543
292 Ga0495638_0092382 3300046460 Bacteria 1822
293 Ga0495651_0001862 3300046462 Bacteria 16323
294 Ga0495653_0000862 3300046463 Bacteria 23392
295 Ga0495653_0005814 3300046463 Bacteria 10094
296 Ga0495653_0006242 3300046463 Bacteria 9779
297 Ga0495653_0015833 3300046463 Bacteria 6146
298 Ga0495650_0002566 3300046471 Bacteria 14389
299 Ga0495580_0004195 3300046472 Bacteria 12122
300 Ga0495580_0025864 3300046472 Bacteria 4286
301 Ga0495580_0040467 3300046472 Bacteria 3328
302 Ga0495605_0000011 3300046474 Bacteria 314856
303 Ga0495605_0007142 3300046474 Bacteria 6356
304 Ga0495605_0057567 3300046474 Bacteria 1870
305 Ga0495664_0011155 3300046477 Bacteria 5057
306 Ga0495664_0038433 3300046477 Bacteria 2825
307 Ga0495664_0121351 3300046477 Bacteria 1581
308 Ga0495596_0000441 3300046500 Bacteria 26588
309 Ga0495607_0005658 3300046501 Bacteria 8902
310 Ga0495583_0000607 3300046506 Bacteria 48463
311 Ga0495606_0006327 3300046507 Bacteria 10962
312 Ga0495606_0020375 3300046507 Bacteria 4891
313 Ga0495606_0073050 3300046507 Bacteria 2153
314 Ga0495608_0003956 3300046511 Bacteria 10643
315 Ga0495610_0000297 3300046512 Bacteria 52357
316 Ga0495610_0004665 3300046512 Bacteria 10025
317 Ga0495610_0009665 3300046512 Bacteria 6071
318 Ga0495610_0010907 3300046512 Bacteria 5607
319 Ga0495616_0001476 3300046513 Bacteria 16324
320 Ga0495618_0030943 3300046514 Bacteria 3345
321 Ga0495618_0048672 3300046514 Bacteria 2676
322 Ga0495620_0000161 3300046515 Bacteria 53208
323 Ga0495620_0008945 3300046515 Bacteria 5350
324 Ga0495620_0012055 3300046515 Bacteria 4485
325 Ga0495628_0000464 3300046516 Bacteria 37205
326 Ga0495628_0028075 3300046516 Bacteria 4576
327 Ga0495630_0003450 3300046517 Bacteria 10989
328 Ga0495630_0011979 3300046517 Bacteria 6287
329 Ga0495630_0072413 3300046517 Bacteria 2594
330 Ga0495631_0000537 3300046518 Bacteria 25460
331 Ga0495632_0004154 3300046519 Bacteria 9930
332 Ga0495637_0000530 3300046520 Bacteria 27494
333 Ga0495637_0011274 3300046520 Bacteria 4298
334 Ga0495637_0015098 3300046520 Bacteria 3629
335 Ga0495643_0050916 3300046522 Bacteria 2229
336 Ga0495648_0007865 3300046524 Bacteria 8474
337 Ga0495648_0008198 3300046524 Bacteria 8244
338 Ga0495648_0011938 3300046524 Bacteria 6515
339 Ga0495648_0012860 3300046524 Bacteria 6216
340 Ga0495648_0056126 3300046524 Bacteria 2371
341 Ga0495648_0056171 3300046524 Bacteria 2369
342 Ga0495652_0001163 3300046529 Bacteria 29681
343 Ga0495652_0003088 3300046529 Bacteria 16663
344 Ga0495652_0021478 3300046529 Bacteria 5737
345 Ga0495652_0095051 3300046529 Bacteria 2429
346 Ga0495654_0000517 3300046530 Bacteria 31432
347 Ga0495654_0004380 3300046530 Bacteria 8400
348 Ga0495654_0004940 3300046530 Bacteria 7842
349 Ga0495665_0000748 3300046531 Bacteria 16825
350 Ga0495665_0001965 3300046531 Bacteria 11105
351 Ga0495640_0002644 3300046533 Bacteria 14381
352 Ga0495640_0007938 3300046533 Bacteria 8345
353 Ga0495586_0099651 3300046535 Bacteria 1612
354 Ga0495587_0004163 3300046536 Bacteria 9574
355 Ga0495587_0055283 3300046536 Bacteria 2338
356 Ga0495587_0101541 3300046536 Bacteria 1657
357 Ga0495621_0004093 3300046539 Bacteria 4062
358 Ga0495597_0009527 3300046542 Bacteria 4792
359 Ga0495645_0002406 3300046543 Bacteria 12699
360 Ga0495667_0061161 3300046559 Bacteria 2470
361 Ga0495656_0047847 3300046615 Bacteria 1815
362 Ga0495668_0046831 3300046616 Bacteria 2402
363 Ga0495634_0002384 3300046642 Bacteria 15661
364 Ga0495634_0017002 3300046642 Bacteria 5195
365 Ga0495625_0007663 3300046660 Bacteria 9358
366 Ga0495625_0034520 3300046660 Bacteria 3732
367 Ga0495625_0075078 3300046660 Bacteria 2366
368 Ga0495625_0169177 3300046660 Bacteria 1460
369 Ga0495635_0000939 3300046663 Bacteria 19220
370 Ga0495635_0006958 3300046663 Bacteria 7902
371 Ga0495635_0032777 3300046663 Bacteria 3604
372 Ga0495635_0326705 3300046663 Bacteria 1026
373 Ga0495661_0007874 3300046665 Bacteria 7404
374 Ga0495661_0031139 3300046665 Bacteria 3389
375 Ga0495661_0124761 3300046665 Bacteria 1418
376 Ga0495588_0026532 3300046674 Bacteria 2893
377 Ga0495588_0030883 3300046674 Bacteria 2694
378 Ga0495599_0085894 3300046678 Bacteria 1965
379 Ga0495623_0002074 3300046679 Bacteria 13428
380 Ga0495623_0003630 3300046679 Bacteria 10197
381 Ga0495646_0000186 3300046680 Bacteria 30935
382 Ga0495646_0002342 3300046680 Bacteria 11611
383 Ga0495613_0003595 3300046689 Bacteria 11617
384 Ga0495613_0014696 3300046689 Bacteria 5809
385 Ga0495624_0005675 3300046690 Bacteria 8957
386 Ga0495624_0011721 3300046690 Bacteria 6022
387 Ga0495624_0026849 3300046690 Bacteria 3772
388 Ga0495670_0012221 3300046691 Bacteria 4221
389 Ga0495671_0001625 3300046692 Bacteria 14758
390 Ga0495671_0014598 3300046692 Bacteria 4222
391 Ga0495671_0023590 3300046692 Bacteria 3213
392 Ga0495649_0001789 3300046694 Bacteria 15819
393 Ga0495649_0014453 3300046694 Bacteria 4523
394 Ga0495589_0001856 3300046794 Bacteria 11971
395 Ga0495589_0019448 3300046794 Bacteria 3481
396 Ga0495589_0020564 3300046794 Bacteria 3375
397 Ga0495589_0046740 3300046794 Bacteria 2147
398 Ga0495600_0003946 3300046809 Bacteria 8811
399 Ga0495600_0035481 3300046809 Bacteria 3239
400 Ga0495600_0108461 3300046809 Bacteria 1808
401 Ga0495660_0000172 3300046810 Bacteria 69913
402 Ga0495660_0009861 3300046810 Bacteria 5556
403 Ga0495581_0041478 3300047315 Bacteria 2663
404 Ga0495604_0001947 3300047317 Bacteria 16691
405 Ga0495604_0002252 3300047317 Bacteria 15457
406 Ga0495604_0178512 3300047317 Bacteria 1487
407 Ga0495636_0035396 3300047318 Bacteria 2056
408 Ga0495674_0003301 3300047319 Bacteria 15673
409 Ga0495674_0047611 3300047319 Bacteria 3800
410 Ga0495674_0057910 3300047319 Bacteria 3389
411 Ga0495674_0107751 3300047319 Bacteria 2364
412 Ga0495672_0005641 3300047320 Bacteria 9877
413 Ga0495672_0034098 3300047320 Bacteria 3148
414 Ga0495672_0035440 3300047320 Bacteria 3073
415 Ga0495676_0053599 3300047321 Bacteria 3213
416 Ga0495676_0064159 3300047321 Bacteria 2859
417 Ga0495676_0084129 3300047321 Bacteria 2401
418 Ga0495680_0007073 3300047322 Bacteria 10339
419 Ga0495680_0023370 3300047322 Bacteria 5141
420 Ga0495680_0041644 3300047322 Bacteria 3650
421 Ga0495683_0000031 3300047323 Bacteria 150363
422 Ga0495683_0001016 3300047323 Bacteria 19555
423 Ga0495683_0001244 3300047323 Bacteria 17281
424 Ga0495683_0065348 3300047323 Bacteria 1794
425 Ga0495675_0002504 3300047444 Bacteria 10993
426 Ga0495675_0008463 3300047444 Bacteria 6377
427 Ga0495679_000023 3300047446 Bacteria 209366
428 Ga0495679_000074 3300047446 Bacteria 95881
429 Ga0495679_000266 3300047446 Bacteria 43582
430 Ga0495679_001275 3300047446 Bacteria 14786
431 Ga0495673_0057557 3300047469 Bacteria 1678
432 Ga0495681_0000589 3300047470 Bacteria 27752
433 Ga0495681_0002085 3300047470 Bacteria 14537
434 Ga0495681_0022827 3300047470 Bacteria 3338
435 Ga0495681_0028639 3300047470 Bacteria 2862
436 Ga0495593_0000185 3300047673 Bacteria 32413
437 Ga0495593_0005329 3300047673 Bacteria 7603
438 Ga0495593_0011078 3300047673 Bacteria 5188
439 Ga0495593_0011489 3300047673 Bacteria 5083
440 Ga0495593_0019829 3300047673 Bacteria 3768
441 Ga0495602_0000877 3300048088 Bacteria 29029
442 Ga0495602_0028667 3300048088 Bacteria 5322
443 Ga0495602_0029722 3300048088 Bacteria 5195
444 Ga0495614_0000624 3300048089 Bacteria 14828
445 Ga0495626_0030598 3300048091 Bacteria 2596
446 Ga0496101_0020189 3300048904 Bacteria 4556
447 Ga0496101_0043591 3300048904 Bacteria 3207
448 Ga0496102_0036988 3300048905 Unclassified 4401
449 Ga0496102_0127702 3300048905 Bacteria 2378
450 Ga0496102_0587400 3300048905 Bacteria 1037
451 Ga0496103_0084906 3300048906 Bacteria 1995
452 Ga0496104_0093870 3300048907 Bacteria 2870
453 Ga0496105_0010008 3300048908 Bacteria 7441
454 Ga0496107_0192173 3300048910 Bacteria 1517
455 Ga0496116_0011047 3300048919 Bacteria 7510
456 Ga0496116_0024653 3300048919 Bacteria 4442
457 Ga0496116_0025679 3300048919 Bacteria 4326
458 Ga0496116_0029801 3300048919 Bacteria 3928
459 Ga0496117_0003636 3300048920 Bacteria 17755
460 Ga0496117_0008928 3300048920 Bacteria 9438
461 Ga0496117_0015076 3300048920 Bacteria 6618
462 Ga0496117_0035699 3300048920 Bacteria 3728
463 Ga0496117_0055678 3300048920 Bacteria 2761
464 Ga0496117_0065820 3300048920 Bacteria 2461
465 Ga0496118_0009638 3300048921 Bacteria 9713
466 Ga0496118_0011360 3300048921 Bacteria 8704
467 Ga0496118_0012669 3300048921 Bacteria 8067
468 Ga0496118_0020728 3300048921 Bacteria 5820
469 Ga0496118_0021995 3300048921 Bacteria 5592
470 Ga0496119_0029001 3300048922 Bacteria 3763
471 Ga0496119_0124004 3300048922 Bacteria 1416
472 Ga0496120_0023347 3300048923 Bacteria 3872
473 Ga0496120_0089793 3300048923 Bacteria 1644
474 Ga0496121_0006328 3300048924 Bacteria 14765
475 Ga0496121_0021379 3300048924 Bacteria 6340
476 Ga0496121_0024301 3300048924 Bacteria 5802
477 Ga0496121_0070912 3300048924 Bacteria 2804
478 Ga0496121_0161120 3300048924 Bacteria 1640
479 Ga0496121_0176107 3300048924 Bacteria 1548
480 Ga0496123_0012263 3300048926 Bacteria 7325
481 Ga0496123_0123930 3300048926 Bacteria 1447
482 Ga0496123_0147506 3300048926 Bacteria 1275
483 Ga0496124_0019168 3300048927 Bacteria 6381
484 Ga0496124_0021743 3300048927 Bacteria 5903
485 Ga0496124_0246483 3300048927 Bacteria 1325
486 Ga0496125_0001750 3300048928 Bacteria 30140
487 Ga0496125_0006979 3300048928 Bacteria 12086
488 Ga0496125_0081693 3300048928 Bacteria 2467
489 Ga0496125_0105691 3300048928 Bacteria 2057
490 Ga0496126_0032644 3300048929 Bacteria 4903
491 Ga0496126_0102561 3300048929 Bacteria 2501
492 Ga0496126_0105825 3300048929 Bacteria 2456
493 Ga0496126_0179913 3300048929 Bacteria 1797
494 Ga0496126_0205691 3300048929 Bacteria 1659
495 Ga0495678_005793 3300049459 Bacteria 6708
496 Ga0495678_031255 3300049459 Bacteria 2222
497 Ga0495682_0009590 3300049460 Bacteria 3775
498 Ga0495682_0012189 3300049460 Bacteria 3299
499 Ga0495682_0030933 3300049460 Bacteria 1980
500 Ga0495682_0075366 3300049460 Bacteria 1213
501 Ga0501044_0274654 3300049823 Bacteria 1620
502 nmdc:mga03683_6612_c1 3300050489 Bacteria 3980
503 nmdc:mga0yw44_18039_c1 3300050492 Bacteria 3857
504 nmdc:mga0yw44_2563_c1 3300050492 Bacteria 7800
505 nmdc:mga0yw44_646_c1 3300050492 Bacteria 12676
506 nmdc:mga0k408_98608_c1 3300050493 Bacteria 1722
507 nmdc:mga04h51_98636_c1 3300050495 Bacteria 1062
508 nmdc:mga07m45_11607_c1 3300050496 Bacteria 4632
509 Ga0500643_002217 3300053087 Bacteria 10263
510 Ga0500651_0000594 3300053093 Bacteria 18149
511 Ga0500562_007363 3300053108 Bacteria 2775
512 Ga0500571_000166 3300053110 Bacteria 23008
513 Ga0500593_000082 3300053117 Bacteria 35375
514 Ga0500594_0004485 3300053118 Bacteria 3077
515 Ga0500607_000440 3300053121 Bacteria 39828
516 Ga0500607_009571 3300053121 Bacteria 5822
517 Ga0500608_011039 3300053122 Bacteria 3905
518 Ga0500608_012939 3300053122 Bacteria 3681
519 Ga0500655_000044 3300053133 Bacteria 34085
520 Ga0500658_0000117 3300053134 Bacteria 37704
521 Ga0500658_0000582 3300053134 Bacteria 15383
522 Ga0500559_0029644 3300053136 Bacteria 2344
523 Ga0500564_004195 3300053138 Bacteria 5733
524 Ga0500568_0006092 3300053139 Bacteria 6112
525 Ga0500574_001907 3300053141 Bacteria 3271
526 Ga0500616_0075040 3300053153 Bacteria 1712
527 Ga0500627_0034519 3300053158 Bacteria 2144
528 Ga0500634_0009122 3300053161 Bacteria 4999
529 Ga0500634_0065538 3300053161 Bacteria 1916
530 Ga0500638_004205 3300053162 Bacteria 5497
531 2511364499 2511231022 Bacteria 6719296
532 2511824023 2511231156 Bacteria 6845832
533 2513229106 2513020051 Bacteria 6053213
534 2545673211 2545555834 Bacteria 8130841
535 2599626358 2599185214 Bacteria 8209958
536 2599676318 2599185226 Bacteria 8233575
537 2599682060 2599185227 Bacteria 8246414
538 2599695710 2599185229 Bacteria 8216126
539 2644059179 2643221609 Bacteria 6756331
540 2644075779 2643221611 Bacteria 6820941
541 2644248112 2643221644 Bacteria 6865017
542 2644328533 2643221658 Bacteria 6064537
543 2644399771 2643221672 Bacteria 6322190
544 2738721333 2738541277 Bacteria 7458140
545 2738880677 2738541307 Bacteria 8606193
546 2739240667 2738543012 Bacteria 7115078
547 2739281002 2738543019 Bacteria 7459457
548 2816472256 2816332133 Bacteria 7249298
549 2819601641 2818991446 Bacteria 7757362
550 2819601747 2818991446 Bacteria 7757362
551 2819621087 2818991450 Bacteria 6962147
552 2831269257 2831265667 Bacteria 7184833
553 2838059234 2838054893 Bacteria 7451788
554 2881103788 2881101125 Bacteria 4590519
555 2885203033 2885198086 Bacteria 7212419
556 2885216570 2885211737 Bacteria 7212420
557 2899930704 2899924645 Bacteria 7487985
558 2899930814 2899924645 Bacteria 7487985
559 2900643002 2900634093 Bacteria 10263517
560 2901304512 2901300506 Bacteria 8463898
561 2904449983 2904449895 Bacteria 6927402
562 2904457192 2904456579 Bacteria 6819253
563 2904545326 2904541872 Bacteria 8915136
564 2919707778 2919704043 Bacteria 5560311
565 2928040974 2928037797 Bacteria 7273642
566 2928047816 2928044640 Bacteria 7271509
567 2928055597 2928051484 Bacteria 7773759
568 2928055708 2928051484 Bacteria 7773759
569 2928069694 2928064002 Bacteria 7419480
570 2928069807 2928064002 Bacteria 7419480
571 2928075328 2928070936 Bacteria 8062541
572 2928088510 2928084124 Bacteria 7159212
573 2929165515 2929160207 Bacteria 9075316
574 2929524438 2929520902 Bacteria 6765052
575 2945909812 2945909444 Bacteria 7065066
576 2945988213 2945984333 Bacteria 7358892
577 641642190 641522639 Bacteria 7737025
578 8055273527 8055266321 Bacteria 7999742
579 Ga0307405_10090622
580 JGI24740J21852_10010609
581 JGI25155J39150_1000625
582 JGI25156J39149_1018298
583 JGI25154J39366_1001194
584 JGI25152J39213_1002509
585 JGI25150J39212_1001450
586 JGI25159J45721_1008409
587 JGI25159J45721_1013293
588 JGI25151J46595_10000319
589 JGI25151J46595_10000748
590 Ga0055535_1000422
591 Ga0055542_1000074
592 Ga0055537_1000769
593 Ga0055537_1001115
594 Ga0055536_1003824
595 Ga0055536_1010095
596 Ga0055534_1003902
597 Ga0055528_1001962
598 Ga0055528_1003567
599 Ga0055530_10000860
600 Ga0055530_10005096
601 Ga0055540_1001520
602 Ga0055540_1002037
603 Ga0055540_1003472
604 Ga0055531_10000941
605 Ga0055531_10001221
606 Ga0055531_10002104
607 Ga0055531_10006372
608 Ga0055543_1001117
609 Ga0065165_1003053
610 Ga0065165_1009839
611 Ga0065714_10066731
612 Ga0070676_10003210
613 Ga0070670_100076493
614 Ga0068868_100099710
615 Ga0070669_100044278
616 Ga0070675_100007910
617 Ga0070671_100071631
618 Ga0070673_100025508
619 Ga0070659_100033731
620 Ga0070659_100064296
621 Ga0070663_100206474
622 Ga0070678_100022140
623 Ga0068867_100001085
624 Ga0070698_100202952
625 Ga0068853_100002357
626 Ga0068853_100193237
627 Ga0070672_100001313
628 Ga0070665_100206007
629 Ga0068855_100108408
630 Ga0070664_100122172
631 Ga0070664_100129733
632 Ga0068857_100105824
633 Ga0068854_100247983
634 Ga0068852_100045747
635 Ga0068851_10004140
636 Ga0068851_10009751
637 Ga0068870_10023339
638 Ga0068862_100022808
639 Ga0075365_10000475
640 Ga0075365_10001106
641 Ga0075365_10068915
642 Ga0075363_100056622
643 Ga0075432_10018132
644 Ga0075432_10037719
645 Ga0075362_10022570
646 Ga0075367_10097831
647 Ga0075366_10024357
648 Ga0097621_100209974
649 Ga0075370_10002231
650 Ga0075370_10008143
651 Ga0075370_10064162
652 Ga0068871_100103223
653 Ga0105251_10000044
654 Ga0105244_10005708
655 Ga0105244_10008568
656 Ga0105244_10014006
657 Ga0105244_10095277
658 Ga0105250_10009376
659 Ga0105250_10036987
660 Ga0105240_10076623
661 Ga0105240_10105838
662 Ga0105245_10153704
663 Ga0105245_10200274
664 Ga0105243_10002680
665 Ga0105243_10404212
666 Ga0105241_10101770
667 Ga0105242_10396528
668 Ga0105237_10116320
669 Ga0105237_10172918
670 Ga0105246_10008048
671 Ga0105246_10090628
672 Ga0157371_10013731
673 Ga0157371_10128646
674 Ga0157370_10007277
675 Ga0157369_10004076
676 Ga0163162_10392457
677 Ga0157372_10014374
678 Ga0157375_10219159
679 Ga0182008_10000038
680 Ga0182008_10000137
681 Ga0182008_10008156
682 Ga0182008_10009725
683 Ga0157376_10356535
684 Ga0182006_1000779
685 Ga0182006_1053835
686 Ga0182007_10000246
687 Ga0182007_10006053
688 Ga0182007_10039158
689 Ga0182005_1041329
690 Ga0163161_10000521
691 Ga0163161_10004883
692 Ga0213872_10059674
693 Ga0209435_100096
694 Ga0209672_102024
695 Ga0209147_100419
696 Ga0209258_100176
697 Ga0207425_1000133
698 Ga0209646_1000093
699 Ga0209026_1006454
700 Ga0209148_1000033
701 Ga0209759_1000248
702 Ga0209129_1000186
703 Ga0209129_1000700
704 Ga0209129_1002228
705 Ga0209565_1000190
706 Ga0209673_1000209
707 Ga0209673_1000393
708 Ga0209673_1002517
709 Ga0209673_1053782
710 Ga0209130_1000335
711 Ga0209130_1000433
712 Ga0209675_1000300
713 Ga0209675_1000330
714 Ga0209675_1008403
715 Ga0209676_1000048
716 Ga0209676_1000618
717 Ga0209676_1002336
718 Ga0209676_1008753
719 Ga0209025_1000324
720 Ga0209025_1000597
721 Ga0209025_1000947
722 Ga0209025_1058059
723 Ga0209564_1000417
724 Ga0209564_1000423
725 Ga0209758_1000092
726 Ga0209758_1002789
727 Ga0209050_1000012
728 Ga0209050_1002843
729 Ga0209050_1010544
730 Ga0209256_1000094
731 Ga0209256_1000095
732 Ga0207426_1000084
733 Ga0207426_1000161
734 Ga0209051_1000019
735 Ga0209051_1000207
736 Ga0209051_1000456
737 Ga0209051_1005182
738 Ga0209257_1000015
739 Ga0209257_1000024
740 Ga0209257_1000258
741 Ga0209257_1002906
742 Ga0207656_10002163
743 Ga0207655_1000845
744 Ga0207655_1001510
745 Ga0207655_1029780
746 Ga0207713_1000113
747 Ga0207647_10037287
748 Ga0207647_10086263
749 Ga0207645_10008543
750 Ga0207643_10036671
751 Ga0207705_10263901
752 Ga0207695_10078337
753 Ga0207695_10104095
754 Ga0207695_10196979
755 Ga0207657_10113380
756 Ga0207694_10049719
757 Ga0207650_10341764
758 Ga0207659_10099786
759 Ga0207687_10037687
760 Ga0207644_10043195
761 Ga0207690_10036876
762 Ga0207706_10002677
763 Ga0207709_10000669
764 Ga0207709_10003070
765 Ga0207709_10004163
766 Ga0207669_10016776
767 Ga0207691_10015569
768 Ga0207679_10074384
769 Ga0207679_10145466
770 Ga0207667_10035396
771 Ga0207667_10052383
772 Ga0207667_10100144
773 Ga0207651_10038120
774 Ga0207658_10010616
775 Ga0207677_10010160
776 Ga0207639_10006236
777 Ga0207639_10008790
778 Ga0207639_10208950
779 Ga0207678_10124960
780 Ga0207678_10236285
781 Ga0207702_10204558
782 Ga0207648_10002091
783 Ga0207674_10015495
784 Ga0207674_10071378
785 Ga0207683_10023474
786 Ga0207683_10036799
787 Ga0209813_10083236
788 Ga0209974_10028423
789 Ga0268265_10024312
790 Ga0307515_10000195
791 Ga0307515_10351932
792 Ga0307513_10000104
793 Ga0307513_10007645
794 Ga0307513_10140448
795 Ga0307509_10001087
796 Ga0307408_100002368
797 Ga0307408_100004935
798 Ga0307408_100007142
799 Ga0307408_100230941
800 Ga0307508_10000155
801 Ga0307508_10000278
802 Ga0307514_10001288
803 Ga0307514_10009962
804 Ga0307410_10197783
805 Ga0307406_10006354
806 Ga0307407_10113972
807 Ga0307412_10014289
808 Ga0307412_10028388
809 Ga0307412_10050360
810 Ga0307412_10056914
811 Ga0307416_100005714
812 Ga0307416_100058233
813 Ga0307416_100502277
814 Ga0307414_10008504
815 Ga0307411_10000361
816 Ga0307411_10031826
817 Ga0395900_0014904
818 Ga0395905_0030746
819 Ga0395905_0055186
820 Ga0436361_1130701
821 Ga0439436_0000374
822 Ga0439439_0000021
823 Ga0439447_005582
824 Ga0439447_015870
825 Ga0439461_0005344
826 Ga0439466_0046632
827 Ga0439433_0049989
828 Ga0439441_032416
829 Ga0439442_009025
830 Ga0439442_012341
831 Ga0439445_0020918
832 Ga0439445_0029533
833 Ga0439432_002487
834 Ga0439449_0000003
835 Ga0439452_001327
836 Ga0439452_029495
837 Ga0439462_0000090
838 Ga0439462_0001359
839 Ga0450911_000517
840 Ga0450898_010326
841 Ga0450906_004482
842 Ga0439446_0000737
843 Ga0439446_0031357
844 Ga0439446_0041666
845 Ga0450908_000504
846 Ga0450908_009529
847 Ga0450909_007353
848 Ga0439434_0001484
849 Ga0439434_0044535
850 Ga0439464_0001746
851 Ga0450918_000094
852 Ga0450893_0002044
853 Ga0451577_0057675
854 Ga0466965_0013703
855 Ga0466966_0119764
856 Ga0466957_0135931
857 Ga0466957_0243813
858 Ga0451576_0016907
859 Ga0495627_007646
860 Ga0495603_0035087
861 Ga0495591_000625
862 Ga0495591_007635
863 Ga0495591_016741
864 Ga0495629_0000364
865 Ga0495629_0001879
866 Ga0495629_0031162
867 Ga0495629_0177567
868 Ga0495638_0016669
869 Ga0495638_0029396
870 Ga0495638_0092382
871 Ga0495651_0001862
872 Ga0495653_0000862
873 Ga0495653_0005814
874 Ga0495653_0006242
875 Ga0495653_0015833
876 Ga0495650_0002566
877 Ga0495580_0004195
878 Ga0495580_0025864
879 Ga0495580_0040467
880 Ga0495605_0000011
881 Ga0495605_0007142
882 Ga0495605_0057567
883 Ga0495664_0011155
884 Ga0495664_0038433
885 Ga0495664_0121351
886 Ga0495596_0000441
887 Ga0495607_0005658
888 Ga0495583_0000607
889 Ga0495606_0006327
890 Ga0495606_0020375
891 Ga0495606_0073050
892 Ga0495608_0003956
893 Ga0495610_0000297
894 Ga0495610_0004665
895 Ga0495610_0009665
896 Ga0495610_0010907
897 Ga0495616_0001476
898 Ga0495618_0030943
899 Ga0495618_0048672
900 Ga0495620_0000161
901 Ga0495620_0008945
902 Ga0495620_0012055
903 Ga0495628_0000464
904 Ga0495628_0028075
905 Ga0495630_0003450
906 Ga0495630_0011979
907 Ga0495630_0072413
908 Ga0495631_0000537
909 Ga0495632_0004154
910 Ga0495637_0000530
911 Ga0495637_0011274
912 Ga0495637_0015098
913 Ga0495643_0050916
914 Ga0495648_0007865
915 Ga0495648_0008198
916 Ga0495648_0011938
917 Ga0495648_0012860
918 Ga0495648_0056126
919 Ga0495648_0056171
920 Ga0495652_0001163
921 Ga0495652_0003088
922 Ga0495652_0021478
923 Ga0495652_0095051
924 Ga0495654_0000517
925 Ga0495654_0004380
926 Ga0495654_0004940
927 Ga0495665_0000748
928 Ga0495665_0001965
929 Ga0495640_0002644
930 Ga0495640_0007938
931 Ga0495586_0099651
932 Ga0495587_0004163
933 Ga0495587_0055283
934 Ga0495587_0101541
935 Ga0495621_0004093
936 Ga0495597_0009527
937 Ga0495645_0002406
938 Ga0495667_0061161
939 Ga0495656_0047847
940 Ga0495668_0046831
941 Ga0495634_0002384
942 Ga0495634_0017002
943 Ga0495625_0007663
944 Ga0495625_0034520
945 Ga0495625_0075078
946 Ga0495625_0169177
947 Ga0495635_0000939
948 Ga0495635_0006958
949 Ga0495635_0032777
950 Ga0495635_0326705
951 Ga0495661_0007874
952 Ga0495661_0031139
953 Ga0495661_0124761
954 Ga0495588_0026532
955 Ga0495588_0030883
956 Ga0495599_0085894
957 Ga0495623_0002074
958 Ga0495623_0003630
959 Ga0495646_0000186
960 Ga0495646_0002342
961 Ga0495613_0003595
962 Ga0495613_0014696
963 Ga0495624_0005675
964 Ga0495624_0011721
965 Ga0495624_0026849
966 Ga0495670_0012221
967 Ga0495671_0001625
968 Ga0495671_0014598
969 Ga0495671_0023590
970 Ga0495649_0001789
971 Ga0495649_0014453
972 Ga0495589_0001856
973 Ga0495589_0019448
974 Ga0495589_0020564
975 Ga0495589_0046740
976 Ga0495600_0003946
977 Ga0495600_0035481
978 Ga0495600_0108461
979 Ga0495660_0000172
980 Ga0495660_0009861
981 Ga0495581_0041478
982 Ga0495604_0001947
983 Ga0495604_0002252
984 Ga0495604_0178512
985 Ga0495636_0035396
986 Ga0495674_0003301
987 Ga0495674_0047611
988 Ga0495674_0057910
989 Ga0495674_0107751
990 Ga0495672_0005641
991 Ga0495672_0034098
992 Ga0495672_0035440
993 Ga0495676_0053599
994 Ga0495676_0064159
995 Ga0495676_0084129
996 Ga0495680_0007073
997 Ga0495680_0023370
998 Ga0495680_0041644
999 Ga0495683_0000031
1000 Ga0495683_0001016
1001 Ga0495683_0001244
1002 Ga0495683_0065348
1003 Ga0495675_0002504
1004 Ga0495675_0008463
1005 Ga0495679_000023
1006 Ga0495679_000074
1007 Ga0495679_000266
1008 Ga0495679_001275
1009 Ga0495673_0057557
1010 Ga0495681_0000589
1011 Ga0495681_0002085
1012 Ga0495681_0022827
1013 Ga0495681_0028639
1014 Ga0495593_0000185
1015 Ga0495593_0005329
1016 Ga0495593_0011078
1017 Ga0495593_0011489
1018 Ga0495593_0019829
1019 Ga0495602_0000877
1020 Ga0495602_0028667
1021 Ga0495602_0029722
1022 Ga0495614_0000624
1023 Ga0495626_0030598
1024 Ga0496101_0020189
1025 Ga0496101_0043591
1026 Ga0496102_0036988
1027 Ga0496102_0127702
1028 Ga0496102_0587400
1029 Ga0496103_0084906
1030 Ga0496104_0093870
1031 Ga0496105_0010008
1032 Ga0496107_0192173
1033 Ga0496116_0011047
1034 Ga0496116_0024653
1035 Ga0496116_0025679
1036 Ga0496116_0029801
1037 Ga0496117_0003636
1038 Ga0496117_0008928
1039 Ga0496117_0015076
1040 Ga0496117_0035699
1041 Ga0496117_0055678
1042 Ga0496117_0065820
1043 Ga0496118_0009638
1044 Ga0496118_0011360
1045 Ga0496118_0012669
1046 Ga0496118_0020728
1047 Ga0496118_0021995
1048 Ga0496119_0029001
1049 Ga0496119_0124004
1050 Ga0496120_0023347
1051 Ga0496120_0089793
1052 Ga0496121_0006328
1053 Ga0496121_0021379
1054 Ga0496121_0024301
1055 Ga0496121_0070912
1056 Ga0496121_0161120
1057 Ga0496121_0176107
1058 Ga0496123_0012263
1059 Ga0496123_0123930
1060 Ga0496123_0147506
1061 Ga0496124_0019168
1062 Ga0496124_0021743
1063 Ga0496124_0246483
1064 Ga0496125_0001750
1065 Ga0496125_0006979
1066 Ga0496125_0081693
1067 Ga0496125_0105691
1068 Ga0496126_0032644
1069 Ga0496126_0102561
1070 Ga0496126_0105825
1071 Ga0496126_0179913
1072 Ga0496126_0205691
1073 Ga0495678_005793
1074 Ga0495678_031255
1075 Ga0495682_0009590
1076 Ga0495682_0012189
1077 Ga0495682_0030933
1078 Ga0495682_0075366
1079 Ga0501044_0274654
1080 nmdc:mga03683_6612_c1
1081 nmdc:mga0yw44_18039_c1
1082 nmdc:mga0yw44_2563_c1
1083 nmdc:mga0yw44_646_c1
1084 nmdc:mga0k408_98608_c1
1085 nmdc:mga04h51_98636_c1
1086 nmdc:mga07m45_11607_c1
1087 Ga0500643_002217
1088 Ga0500651_0000594
1089 Ga0500562_007363
1090 Ga0500571_000166
1091 Ga0500593_000082
1092 Ga0500594_0004485
1093 Ga0500607_000440
1094 Ga0500607_009571
1095 Ga0500608_011039
1096 Ga0500608_012939
1097 Ga0500655_000044
1098 Ga0500658_0000117
1099 Ga0500658_0000582
1100 Ga0500559_0029644
1101 Ga0500564_004195
1102 Ga0500568_0006092
1103 Ga0500574_001907
1104 Ga0500616_0075040
1105 Ga0500627_0034519
1106 Ga0500634_0009122
1107 Ga0500634_0065538
1108 Ga0500638_004205
1109 2511364499
1110 2511824023
1111 2513229106
1112 2545673211
1113 2599626358
1114 2599676318
1115 2599682060
1116 2599695710
1117 2644059179
1118 2644075779
1119 2644248112
1120 2644328533
1121 2644399771
1122 2738721333
1123 2738880677
1124 2739240667
1125 2739281002
1126 2816472256
1127 2819601641
1128 2819601747
1129 2819621087
1130 2831269257
1131 2838059234
1132 2881103788
1133 2885203033
1134 2885216570
1135 2899930704
1136 2899930814
1137 2900643002
1138 2901304512
1139 2904449983
1140 2904457192
1141 2904545326
1142 2919707778
1143 2928040974
1144 2928047816
1145 2928055597
1146 2928055708
1147 2928069694
1148 2928069807
1149 2928075328
1150 2928088510
1151 2929165515
1152 2929524438
1153 2945909812
1154 2945988213
1155 641642190
1156 8055273527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

32

91

0.97

PF03466

LysR_substrate

LysR substrate binding domain

116

322

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhf-assembly1.cif.gz_A structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.904 74 277
3hhf-assembly1.cif.gz_B structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8982 74 277
3hhf-assembly1.cif.gz_A structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8956 74 277
3hhf-assembly1.cif.gz_B structure of crga regulatory domain, a lysr-type transcriptional regulator from neisseria meningitidis. 0.8898 74 277
7trw-assembly1.cif.gz_A-2 crystal structure of the c-terminal ligand-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.884 74 281
ID Description Score Start End Superfamily
af_P76369_5_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9168 24 67 1.10.10.10
af_P37641_88_293_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9161 75 275 3.40.190.290
5mmhB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9015 76 143 3.40.190.10
af_P76250_91_296_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8958 74 277 3.40.190.290
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8917 4 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5F0LPX3-F1-model_v4 LysR family transcriptional regulator 0.9415 146 278
AF-A0A1G8S0J2-F1-model_v4 LysR substrate binding domain-containing protein 0.9382 74 287 GO:0003700
GO:0006351
GO:0043565
AF-U6ZXM9-F1-model_v4 deleted 0.9379 106 277
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9372 93 285 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Z2VCT1-F1-model_v4 LysR family transcriptional regulator 0.931 161 276 GO:0003700
GO:0006351
GO:0043565

Map