F465769

General Info

Members Datasets Scaffolds Average Seq Length
578 407 1156 239

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0085461|Ga0496116_0085461_1116_1883
Length 255
Sequence MTLDDILGSLFADSQGLVRENGLLWGRARLADDGQDRMPTVIGVEGRAFVGVDDAIVLARVVLQTIAQGAAQGSQEPILVLIDSSSQRMSKRDELLGLNEFLAHLAKSLIYAHARGHATVGLXXXXTAAGAFIATALATSTLLALPGAHPAVMDLPSMARVTKLPLTVLEEKAKSTPVFAPGLDNLAQTGGVAQVLNPDQPLSAQVRDVLATLTTGLTPRERAQDHRDRLGKTRGGRPVAADIADQVYALARAAI

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
235 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
243 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
249 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
250 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
251 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
252 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
253 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
254 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
255 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
256 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
257 2519103095 Burkholderia sp. KJ006 Isolate Nodule
258 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
259 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
260 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
261 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
262 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
263 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
264 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
265 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
266 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
267 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
268 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
269 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
270 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
271 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
272 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
273 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
274 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
275 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
276 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
277 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
278 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
279 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
280 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
281 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
282 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
283 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
284 2818991452 Burkholderia cepacia 561 Isolate Unclassified
285 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
286 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
287 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
288 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
289 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
290 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
291 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
292 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
293 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
294 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
295 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
296 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
297 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
298 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
299 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
300 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
301 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
302 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
303 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
304 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
305 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
306 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
307 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
308 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
309 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
310 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
311 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
312 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
313 2904699407
314 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
315 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
316 2922368715
317 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
318 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
319 2928163908 Burkholderia sp. 567 Isolate Unclassified
320 2928170801 Burkholderia sp. 572 Isolate Unclassified
321 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
322 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
323 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
324 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
325 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
326 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
327 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
328 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
329 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
330 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
331 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
332 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
333 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
334 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
335 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
336 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
337 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
338 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
339 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
340 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
341 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
342 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
343 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
344 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
345 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
346 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
347 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
348 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
349 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
350 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
351 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
352 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
353 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
354 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
355 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
356 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
357 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
358 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
359 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
360 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
361 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
362 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
363 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
364 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
365 641522639 Methylobacterium sp. 4-46 Isolate Nodule
366 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
367 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
368 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
369 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
370 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
371 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
374 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
375 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
376 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
377 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
378 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
379 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
380 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
381 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
382 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
383 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
384 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
385 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
386 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
387 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
388 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
389 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
390 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
391 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
392 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
393 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
394 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
395 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
396 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
397 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
398 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
399 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
400 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
401 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
402 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
403 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
404 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
405 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
406 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
407 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.01
Metatranscriptomes 0
Isolates 28.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.96
Nodule 19.38
Rhizoplane 4.5
Rhizosphere 45.85
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0085461 3300048919 Bacteria 1939
2 JGI25158J39367_1000838 3300002739 Bacteria 5867
3 JGI25152J39213_1007085 3300002773 Bacteria 2947
4 JGI25159J45721_1000678 3300002987 Bacteria 15023
5 JGI25159J45721_1002059 3300002987 Bacteria 7951
6 JGI25153J46596_10000288 3300003215 Bacteria 38391
7 JGI25153J46596_10001586 3300003215 Bacteria 13473
8 JGI25153J46596_10018033 3300003215 Bacteria 2756
9 JGI25153J46596_10041756 3300003215 Bacteria 1407
10 rootH2_10005012 3300003320 Bacteria 11801
11 rootL2_10006749 3300003322 Bacteria 38317
12 rootL2_10077760 3300003322 Bacteria 1960
13 rootH1_10109858 3300003323 Bacteria 4716
14 rootH1_10164832 3300003323 Bacteria 1379
15 rootH1_10164833 3300003323 Bacteria 1377
16 JGI25160J50197_1000413 3300003354 Bacteria 27195
17 JGI25160J50197_1001701 3300003354 Bacteria 10676
18 JGI25160J50197_1022434 3300003354 Bacteria 1850
19 JGI25161J50226_1000567 3300003374 Bacteria 15685
20 JGI25161J50226_1000572 3300003374 Bacteria 15570
21 JGI25161J50226_1000905 3300003374 Bacteria 10676
22 Ga0055532_1000954 3300003758 Bacteria 9294
23 Ga0055527_1000519 3300003760 Bacteria 13244
24 Ga0055535_1001606 3300003761 Bacteria 10646
25 Ga0055535_1001639 3300003761 Bacteria 10456
26 Ga0055542_1001602 3300003762 Bacteria 10456
27 Ga0055542_1004740 3300003762 Bacteria 3208
28 Ga0055529_1001193 3300003763 Bacteria 10456
29 Ga0055524_1007133 3300003775 Bacteria 4785
30 Ga0055528_1001484 3300003790 Bacteria 14245
31 Ga0055528_1005415 3300003790 Bacteria 5950
32 Ga0055540_1002714 3300003792 Bacteria 9116
33 Ga0058692_1016950 3300003856 Bacteria 1607
34 Ga0055543_1000079 3300004625 Bacteria 84916
35 Ga0055543_1000116 3300004625 Bacteria 67872
36 Ga0055543_1002291 3300004625 Bacteria 6462
37 Ga0065165_1002903 3300005262 Bacteria 13143
38 Ga0065165_1036443 3300005262 Bacteria 1500
39 Ga0070670_100009469 3300005331 Bacteria 8317
40 Ga0070670_100318602 3300005331 Bacteria 1362
41 Ga0070666_10033261 3300005335 Bacteria 3411
42 Ga0070666_10112887 3300005335 Bacteria 1880
43 Ga0070660_100000028 3300005339 Bacteria 88388
44 Ga0070661_100042078 3300005344 Bacteria 3334
45 Ga0070661_100070332 3300005344 Bacteria 2573
46 Ga0070668_100015221 3300005347 Bacteria 5747
47 Ga0070668_100179605 3300005347 Bacteria 1728
48 Ga0070668_100746361 3300005347 Bacteria 866
49 Ga0070659_100000230 3300005366 Bacteria 43454
50 Ga0070709_10001293 3300005434 Bacteria 13650
51 Ga0070709_10026169 3300005434 Bacteria 3454
52 Ga0070714_100045562 3300005435 Bacteria 3717
53 Ga0070713_100009193 3300005436 Bacteria 7055
54 Ga0070710_10000282 3300005437 Bacteria 24043
55 Ga0070710_10231800 3300005437 Bacteria 1179
56 Ga0070711_100014925 3300005439 Bacteria 4907
57 Ga0070711_100134613 3300005439 Bacteria 1845
58 Ga0070708_100284339 3300005445 Bacteria 1557
59 Ga0070663_100003063 3300005455 Bacteria 9558
60 Ga0070663_100023282 3300005455 Bacteria 4150
61 Ga0070662_100007492 3300005457 Bacteria 7077
62 Ga0070662_100058201 3300005457 Bacteria 2812
63 Ga0070665_100000465 3300005548 Bacteria 58821
64 Ga0070665_100003470 3300005548 Bacteria 16799
65 Ga0070665_100097993 3300005548 Bacteria 2937
66 Ga0068855_100177750 3300005563 Bacteria 2407
67 Ga0068855_100310437 3300005563 Bacteria 1745
68 Ga0070664_100141871 3300005564 Bacteria 2116
69 Ga0068856_100327522 3300005614 Bacteria 1549
70 Ga0068856_101010871 3300005614 Bacteria 850
71 Ga0068852_100029923 3300005616 Bacteria 4477
72 Ga0068859_100318350 3300005617 Bacteria 1650
73 Ga0068851_10002327 3300005834 Bacteria 8366
74 Ga0068863_100299783 3300005841 Bacteria 1559
75 Ga0068858_100013390 3300005842 Bacteria 7741
76 Ga0068858_100319541 3300005842 Bacteria 1483
77 Ga0068860_100243394 3300005843 Bacteria 1750
78 Ga0068862_100107747 3300005844 Bacteria 2443
79 Ga0081540_1009036 3300005983 Bacteria 6887
80 Ga0081540_1018480 3300005983 Bacteria 4274
81 Ga0070717_10271883 3300006028 Bacteria 1501
82 Ga0075363_100063664 3300006048 Bacteria 1991
83 Ga0075364_10020082 3300006051 Bacteria 4201
84 Ga0070712_100005683 3300006175 Bacteria 7713
85 Ga0075362_10129195 3300006177 Bacteria 1200
86 Ga0075367_10185266 3300006178 Bacteria 1298
87 Ga0075366_10021738 3300006195 Bacteria 3730
88 Ga0075370_10006671 3300006353 Bacteria 5823
89 Ga0068865_100311329 3300006881 Bacteria 1263
90 Ga0097620_100318339 3300006931 Bacteria 1650
91 Ga0099794_10013003 3300007265 Bacteria 3611
92 Ga0105250_10092105 3300009092 Unclassified 1233
93 Ga0105250_10200063 3300009092 Bacteria 842
94 Ga0105240_10001146 3300009093 Bacteria 46418
95 Ga0105240_10014261 3300009093 Bacteria 10855
96 Ga0105240_10042503 3300009093 Bacteria 5791
97 Ga0105240_10070943 3300009093 Bacteria 4309
98 Ga0105240_10457071 3300009093 Bacteria 1428
99 Ga0111539_10000323 3300009094 Bacteria 58458
100 Ga0105247_10014641 3300009101 Bacteria 4702
101 Ga0105243_10164959 3300009148 Bacteria 1913
102 Ga0105241_10065423 3300009174 Bacteria 2809
103 Ga0105241_10074884 3300009174 Bacteria 2637
104 Ga0105241_10087414 3300009174 Bacteria 2454
105 Ga0105242_10975339 3300009176 Bacteria 853
106 Ga0105248_10079304 3300009177 Bacteria 3690
107 Ga0105237_10001621 3300009545 Bacteria 29218
108 Ga0105237_10004870 3300009545 Bacteria 15385
109 Ga0105237_10016195 3300009545 Bacteria 7753
110 Ga0105237_10018112 3300009545 Bacteria 7291
111 Ga0105237_10115232 3300009545 Bacteria 2681
112 Ga0105237_10213030 3300009545 Bacteria 1931
113 Ga0105237_10395808 3300009545 Bacteria 1386
114 Ga0105237_10530513 3300009545 Bacteria 1184
115 Ga0105238_10025999 3300009551 Bacteria 5966
116 Ga0105238_10075985 3300009551 Bacteria 3351
117 Ga0105238_10503897 3300009551 Bacteria 1212
118 Ga0105249_10007619 3300009553 Bacteria 9444
119 Ga0099796_10000384 3300010159 Bacteria 7229
120 Ga0105239_10045380 3300010375 Bacteria 4816
121 Ga0105239_10078794 3300010375 Bacteria 3626
122 Ga0105239_10129037 3300010375 Bacteria 2811
123 Ga0105239_10174566 3300010375 Bacteria 2404
124 Ga0105239_10500869 3300010375 Bacteria 1381
125 Ga0105239_11372141 3300010375 Bacteria 816
126 Ga0105246_10072109 3300011119 Bacteria 2434
127 Ga0157378_10807274 3300013297 Bacteria 964
128 Ga0163162_10010810 3300013306 Bacteria 8878
129 Ga0157375_10416230 3300013308 Bacteria 1510
130 Ga0163163_10956599 3300014325 Bacteria 920
131 Ga0182008_10000113 3300014497 Bacteria 61507
132 Ga0182007_10000213 3300015262 Bacteria 38873
133 Ga0213873_10002417 3300021358 Bacteria 3234
134 Ga0213872_10003532 3300021361 Bacteria 8629
135 Ga0213872_10018759 3300021361 Bacteria 3188
136 Ga0213872_10020568 3300021361 Bacteria 3043
137 Ga0213872_10024949 3300021361 Bacteria 2749
138 Ga0213872_10025083 3300021361 Bacteria 2741
139 Ga0213872_10057011 3300021361 Bacteria 1769
140 Ga0213876_10150635 3300021384 Bacteria 1237
141 Ga0209436_100066 3300025208 Bacteria 54510
142 Ga0209566_100904 3300025225 Bacteria 14153
143 Ga0209672_100019 3300025228 Bacteria 432215
144 Ga0209672_100069 3300025228 Bacteria 174956
145 Ga0209147_100026 3300025229 Bacteria 421622
146 Ga0209147_100044 3300025229 Bacteria 300330
147 Ga0209147_100128 3300025229 Bacteria 122259
148 Ga0209258_100031 3300025242 Bacteria 463572
149 Ga0209258_100079 3300025242 Bacteria 263132
150 Ga0209148_1000027 3300025254 Bacteria 616374
151 Ga0209148_1000474 3300025254 Bacteria 42596
152 Ga0209148_1000501 3300025254 Bacteria 39942
153 Ga0209148_1001447 3300025254 Bacteria 12057
154 Ga0209129_1006000 3300025258 Bacteria 4079
155 Ga0209233_1008059 3300025261 Bacteria 3289
156 Ga0209565_1018425 3300025263 Bacteria 1510
157 Ga0209455_1000058 3300025272 Bacteria 342028
158 Ga0209455_1001131 3300025272 Bacteria 12961
159 Ga0209455_1011491 3300025272 Bacteria 2176
160 Ga0209673_1000059 3300025273 Bacteria 268892
161 Ga0209673_1001545 3300025273 Bacteria 20787
162 Ga0209130_1000022 3300025284 Bacteria 361244
163 Ga0209130_1000219 3300025284 Bacteria 74906
164 Ga0209564_1000475 3300025295 Bacteria 67102
165 Ga0209758_1000993 3300025297 Bacteria 37839
166 Ga0209758_1007575 3300025297 Bacteria 7335
167 Ga0209256_1037569 3300025299 Bacteria 1260
168 Ga0209256_1044624 3300025299 Bacteria 1106
169 Ga0207426_1000005 3300025302 Bacteria 1037188
170 Ga0207426_1000075 3300025302 Bacteria 321337
171 Ga0209051_1061830 3300025303 Bacteria 1174
172 Ga0209257_1051176 3300025304 Bacteria 1165
173 Ga0207656_10005520 3300025321 Bacteria 4476
174 Ga0207692_10120291 3300025898 Bacteria 1469
175 Ga0207710_10036840 3300025900 Bacteria 2158
176 Ga0207680_10023242 3300025903 Bacteria 3382
177 Ga0207647_10002100 3300025904 Bacteria 15252
178 Ga0207647_10051781 3300025904 Bacteria 2536
179 Ga0207647_10080733 3300025904 Bacteria 1950
180 Ga0207705_10078506 3300025909 Bacteria 2403
181 Ga0207684_10322804 3300025910 Bacteria 1331
182 Ga0207654_10067821 3300025911 Bacteria 2109
183 Ga0207654_10119718 3300025911 Bacteria 1651
184 Ga0207654_10177692 3300025911 Bacteria 1387
185 Ga0207695_10000006 3300025913 Bacteria 1135309
186 Ga0207695_10003507 3300025913 Bacteria 21992
187 Ga0207695_10023432 3300025913 Bacteria 6976
188 Ga0207695_10071449 3300025913 Bacteria 3545
189 Ga0207695_10089774 3300025913 Bacteria 3089
190 Ga0207671_10013654 3300025914 Bacteria 6456
191 Ga0207671_10020670 3300025914 Bacteria 5008
192 Ga0207671_10022161 3300025914 Bacteria 4806
193 Ga0207671_10141456 3300025914 Bacteria 1854
194 Ga0207671_10270888 3300025914 Bacteria 1338
195 Ga0207693_10008068 3300025915 Bacteria 8634
196 Ga0207693_10036970 3300025915 Bacteria 3849
197 Ga0207663_10116032 3300025916 Bacteria 1825
198 Ga0207657_10000001 3300025919 Bacteria 458536
199 Ga0207694_10080842 3300025924 Bacteria 2551
200 Ga0207694_10097732 3300025924 Bacteria 2323
201 Ga0207650_10298737 3300025925 Bacteria 1315
202 Ga0207700_10005940 3300025928 Bacteria 7345
203 Ga0207664_10008161 3300025929 Bacteria 7289
204 Ga0207644_10040268 3300025931 Bacteria 3302
205 Ga0207690_10000072 3300025932 Bacteria 88241
206 Ga0207706_10001636 3300025933 Bacteria 22180
207 Ga0207706_10141303 3300025933 Bacteria 2118
208 Ga0207665_10024914 3300025939 Bacteria 3947
209 Ga0207711_10145182 3300025941 Bacteria 2137
210 Ga0207667_10673808 3300025949 Bacteria 1038
211 Ga0207712_10001146 3300025961 Bacteria 18465
212 Ga0207668_10009192 3300025972 Bacteria 5912
213 Ga0207668_10280590 3300025972 Bacteria 1366
214 Ga0207640_10729532 3300025981 Bacteria 852
215 Ga0207658_10017385 3300025986 Bacteria 4954
216 Ga0207658_10468596 3300025986 Bacteria 1118
217 Ga0207677_10132213 3300026023 Bacteria 1897
218 Ga0207703_10011514 3300026035 Bacteria 6880
219 Ga0207703_10056162 3300026035 Bacteria 3205
220 Ga0207639_10004652 3300026041 Bacteria 9240
221 Ga0207639_10058139 3300026041 Bacteria 2973
222 Ga0207639_10326389 3300026041 Bacteria 1364
223 Ga0207678_10001112 3300026067 Bacteria 24644
224 Ga0207678_10012138 3300026067 Bacteria 7566
225 Ga0207678_10026489 3300026067 Bacteria 5057
226 Ga0207678_10030234 3300026067 Bacteria 4728
227 Ga0207702_10130697 3300026078 Bacteria 2259
228 Ga0207702_10979875 3300026078 Bacteria 838
229 Ga0207641_10252675 3300026088 Bacteria 1647
230 Ga0207648_10331910 3300026089 Bacteria 1368
231 Ga0207674_10046570 3300026116 Bacteria 4452
232 Ga0207674_10267551 3300026116 Bacteria 1657
233 Ga0207675_100292014 3300026118 Bacteria 1586
234 Ga0207698_10187980 3300026142 Bacteria 1836
235 Ga0209371_1000243 3300027312 Bacteria 67855
236 Ga0209371_1002714 3300027312 Bacteria 9553
237 Ga0207428_10000129 3300027907 Bacteria 104467
238 Ga0268266_10000006 3300028379 Bacteria 1410021
239 Ga0268266_10252816 3300028379 Bacteria 1631
240 Ga0268256_1000311 3300030500 Bacteria 48691
241 Ga0265331_10178578 3300031250 Bacteria 959
242 Ga0307516_10000173 3300031730 Bacteria 82288
243 Ga0307410_10138330 3300031852 Bacteria 1798
244 Ga0307409_100042599 3300031995 Bacteria 3401
245 Ga0307414_10515187 3300032004 Bacteria 1061
246 Ga0373947_0298456 3300035725 Unclassified 1074
247 Ga0436365_0265027 3300039437 Bacteria 2672
248 Ga0436365_1822309 3300039437 Bacteria 1165
249 Ga0436360_0537233 3300039438 Bacteria 1466
250 Ga0436360_0695279 3300039438 Bacteria 4157
251 Ga0436360_0722236 3300039438 Plasmid 2700
252 Ga0436360_1172287 3300039438 Bacteria 1605
253 Ga0436361_0087656 3300039447 Bacteria 876
254 Ga0436361_0091426 3300039447 Bacteria 2870
255 Ga0436361_0176654 3300039447 Bacteria 6986
256 Ga0436361_0267995 3300039447 Bacteria 7047
257 Ga0436361_0357323 3300039447 Bacteria 1540
258 Ga0436361_0362812 3300039447 Bacteria 2565
259 Ga0436361_0372030 3300039447 Bacteria 9128
260 Ga0436361_0472884 3300039447 Bacteria 1090
261 Ga0436361_0993041 3300039447 Bacteria 1043
262 Ga0436361_1192548 3300039447 Bacteria 1870
263 Ga0436362_0775664 3300039453 Bacteria 3592
264 Ga0436362_1289511 3300039453 Unclassified 1718
265 Ga0439465_0016516 3300041413 Bacteria 2302
266 Ga0451793_0280828 3300041452 Bacteria 2838
267 Ga0451795_0231223 3300041456 Bacteria 1058
268 Ga0451837_0701287 3300041494 Bacteria 1002
269 Ga0439431_0010234 3300041997 Bacteria 2126
270 Ga0439431_0044809 3300041997 Bacteria 1135
271 Ga0466972_0014613 3300044658 Bacteria 3930
272 Ga0466972_0016624 3300044658 Bacteria 3678
273 Ga0466961_0122803 3300044693 Bacteria 1630
274 Ga0466968_0002924 3300044735 Bacteria 6310
275 Ga0466968_0217313 3300044735 Bacteria 899
276 Ga0466970_0169722 3300044765 Bacteria 1209
277 Ga0466960_0000523 3300044901 Bacteria 13157
278 Ga0466959_0059664 3300045049 Bacteria 2778
279 Ga0466967_0306456 3300045976 Bacteria 1529
280 Ga0495590_0049862 3300046457 Bacteria 1461
281 Ga0495629_0030964 3300046459 Bacteria 3790
282 Ga0495638_0000019 3300046460 Bacteria 384671
283 Ga0495605_0081139 3300046474 Bacteria 1517
284 Ga0495584_0316806 3300046491 Bacteria 792
285 Ga0495596_0164548 3300046500 Bacteria 862
286 Ga0495606_0017751 3300046507 Bacteria 5366
287 Ga0495606_0055014 3300046507 Bacteria 2575
288 Ga0495606_0097475 3300046507 Bacteria 1796
289 Ga0495610_0002011 3300046512 Bacteria 17382
290 Ga0495610_0068283 3300046512 Bacteria 1666
291 Ga0495616_0102608 3300046513 Bacteria 1340
292 Ga0495628_0189255 3300046516 Bacteria 1554
293 Ga0495628_0267754 3300046516 Bacteria 1272
294 Ga0495643_0015969 3300046522 Bacteria 4420
295 Ga0495643_0053328 3300046522 Bacteria 2168
296 Ga0495643_0057175 3300046522 Bacteria 2079
297 Ga0495648_0162125 3300046524 Bacteria 1155
298 Ga0495648_0288065 3300046524 Bacteria 775
299 Ga0495640_0100321 3300046533 Bacteria 1901
300 Ga0495622_0078556 3300046557 Bacteria 1519
301 Ga0495667_0547230 3300046559 Bacteria 723
302 Ga0495668_0128870 3300046616 Bacteria 1385
303 Ga0495634_0064965 3300046642 Bacteria 2419
304 Ga0495611_0019278 3300046648 Bacteria 2929
305 Ga0495625_0389870 3300046660 Bacteria 872
306 Ga0495635_0003891 3300046663 Bacteria 10376
307 Ga0495657_0012111 3300046675 Bacteria 6418
308 Ga0495624_0043274 3300046690 Bacteria 2873
309 Ga0495671_0309577 3300046692 Bacteria 759
310 Ga0495589_0210396 3300046794 Bacteria 916
311 Ga0495600_0006748 3300046809 Bacteria 6996
312 Ga0495604_0062128 3300047317 Bacteria 2855
313 Ga0495676_0076376 3300047321 Bacteria 2558
314 Ga0495683_0057977 3300047323 Bacteria 1924
315 Ga0495683_0115991 3300047323 Bacteria 1275
316 Ga0495687_041587 3300047443 Bacteria 2015
317 Ga0495673_0030030 3300047469 Bacteria 2559
318 Ga0495686_0000082 3300047472 Bacteria 200115
319 Ga0495686_0000115 3300047472 Bacteria 166876
320 Ga0495626_0043928 3300048091 Bacteria 2095
321 Ga0496100_0381723 3300048903 Bacteria 1070
322 Ga0496101_0012616 3300048904 Bacteria 5643
323 Ga0496101_0159645 3300048904 Bacteria 1729
324 Ga0496102_0153244 3300048905 Bacteria 2166
325 Ga0496102_0195918 3300048905 Bacteria 1904
326 Ga0496104_0140344 3300048907 Bacteria 2321
327 Ga0496104_0195289 3300048907 Bacteria 1936
328 Ga0496104_0372072 3300048907 Bacteria 1341
329 Ga0496105_0001350 3300048908 Bacteria 17227
330 Ga0496105_0136364 3300048908 Bacteria 2022
331 Ga0496106_0015492 3300048909 Bacteria 5641
332 Ga0496106_0023403 3300048909 Bacteria 4589
333 Ga0496109_0396488 3300048912 Bacteria 1304
334 Ga0496111_0166994 3300048914 Bacteria 1635
335 Ga0496111_0243304 3300048914 Bacteria 1336
336 Ga0496111_0427029 3300048914 Bacteria 979
337 Ga0496112_0165784 3300048915 Bacteria 2175
338 Ga0496113_0149569 3300048916 Bacteria 1841
339 Ga0496116_0070663 3300048919 Bacteria 2214
340 Ga0496116_0102306 3300048919 Bacteria 1708
341 Ga0496116_0109707 3300048919 Bacteria 1626
342 Ga0496117_0007273 3300048920 Bacteria 10879
343 Ga0496117_0130036 3300048920 Bacteria 1528
344 Ga0496118_0008990 3300048921 Bacteria 10191
345 Ga0496118_0010965 3300048921 Bacteria 8906
346 Ga0496118_0168112 3300048921 Bacteria 1344
347 Ga0496119_0004102 3300048922 Bacteria 14685
348 Ga0496119_0018244 3300048922 Bacteria 5238
349 Ga0496119_0039200 3300048922 Bacteria 3047
350 Ga0496119_0046340 3300048922 Bacteria 2716
351 Ga0496119_0057536 3300048922 Bacteria 2349
352 Ga0496120_0014557 3300048923 Bacteria 5236
353 Ga0496120_0056098 3300048923 Bacteria 2225
354 Ga0496121_0000022 3300048924 Bacteria 472849
355 Ga0496121_0000523 3300048924 Bacteria 73281
356 Ga0496121_0021639 3300048924 Bacteria 6288
357 Ga0496121_0027976 3300048924 Bacteria 5263
358 Ga0496121_0037444 3300048924 Bacteria 4308
359 Ga0496121_0049552 3300048924 Bacteria 3560
360 Ga0496121_0059791 3300048924 Bacteria 3140
361 Ga0496121_0095254 3300048924 Bacteria 2314
362 Ga0496121_0156446 3300048924 Bacteria 1672
363 Ga0496122_0004397 3300048925 Bacteria 17546
364 Ga0496123_0004520 3300048926 Bacteria 14540
365 Ga0496124_0076382 3300048927 Bacteria 2765
366 Ga0496125_0006913 3300048928 Bacteria 12147
367 Ga0496125_0199253 3300048928 Bacteria 1313
368 Ga0496126_0006108 3300048929 Bacteria 13507
369 Ga0496126_0073507 3300048929 Bacteria 3039
370 Ga0496126_0230731 3300048929 Bacteria 1551
371 Ga0496126_0374000 3300048929 Bacteria 1161
372 Ga0501036_0180150 3300049572 Bacteria 1779
373 Ga0501043_0003245 3300049579 Bacteria 13416
374 Ga0501047_0000197 3300049581 Bacteria 72751
375 Ga0501048_0106838 3300049582 Bacteria 1976
376 Ga0501035_0069454 3300049822 Bacteria 3123
377 Ga0501044_0090088 3300049823 Bacteria 3095
378 nmdc:mga03n38_207978_c1 3300050490 Bacteria 1016
379 nmdc:mga00v17_64043_c1 3300050491 Bacteria 2265
380 nmdc:mga0yw44_150308_c1 3300050492 Bacteria 1519
381 nmdc:mga0yw44_5700_c1 3300050492 Bacteria 5929
382 nmdc:mga0k408_42731_c1 3300050493 Bacteria 2610
383 nmdc:mga06z11_510122_c1 3300050494 Bacteria 729
384 nmdc:mga07m45_91103_c1 3300050496 Bacteria 1747
385 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
386 nmdc:mga0sz30_179745_c1 3300050516 Bacteria 939
387 Ga0500635_0011635 3300053080 Bacteria 2507
388 Ga0495655_0031192 3300053083 Bacteria 1295
389 Ga0500566_0000029 3300053094 Bacteria 75384
390 Ga0500566_0090729 3300053094 Bacteria 1689
391 Ga0500640_045153 3300053095 Bacteria 1933
392 Ga0500650_0132226 3300053098 Bacteria 1160
393 Ga0500569_003041 3300053109 Bacteria 3377
394 Ga0500572_002243 3300053111 Bacteria 4717
395 Ga0500595_018539 3300053119 Bacteria 2543
396 Ga0500608_250672 3300053122 Bacteria 691
397 Ga0500655_018796 3300053133 Bacteria 1284
398 Ga0500559_0027379 3300053136 Bacteria 2433
399 Ga0500564_016690 3300053138 Bacteria 3328
400 Ga0500568_0045969 3300053139 Bacteria 1735
401 Ga0500590_215444 3300053148 Bacteria 797
402 Ga0500620_006890 3300053155 Bacteria 2765
403 Ga0500622_0002004 3300053156 Bacteria 15220
404 Ga0500638_027971 3300053162 Bacteria 2708
405 Ga0500636_0000420 3300053177 Bacteria 23339
406 Ga0500645_000065 3300053730 Bacteria 82414
407 Ga0500601_000525 3300053737 Bacteria 5772
408 Ga0500661_003363 3300055283 Bacteria 3009
409 Ga0500661_010036 3300055283 Bacteria 1726
410 2508693071 2508501042 Bacteria 8719808
411 2509149467 2508501128 Bacteria 8613869
412 2513649324 2513237095 Bacteria 8976980
413 2513702772 2513237102 Bacteria 7703324
414 2513721373 2513237104 Bacteria 10034502
415 2515630076 2515154112 Bacteria 8294334
416 2517101011 2517093001 Bacteria 9002274
417 2519458398 2519103095 Bacteria 6629912
418 2524441256 2524023205 Bacteria 8918781
419 2524464657 2524023210 Bacteria 9029266
420 2524539455 2524023228 Bacteria 10118060
421 2528851738 2528768022 Bacteria 10457665
422 2545672620 2545555834 Bacteria 8130841
423 2585292781 2582581311 Bacteria 6763856
424 2599738274 2599185239 Bacteria 8686614
425 2599742366 2599185240 Bacteria 7968121
426 2600204484 2599185355 Bacteria 7968906
427 2616555366 2615840698 Bacteria 7319877
428 2617382440 2617270742 Bacteria 6808054
429 2643983745 2643221595 Bacteria 6565519
430 2644155878 2643221627 Bacteria 6761570
431 2644238046 2643221643 Bacteria 5749658
432 2671118198 2667528175 Bacteria 7532676
433 2676741469 2675903129 Bacteria 7964495
434 2745082190 2744054633 Bacteria 8678936
435 2765469231 2765235802 Bacteria 5618596
436 2808970253 2808606384 Bacteria 8474373
437 2809004901 2808606390 Bacteria 8476311
438 2809011959 2808606391 Bacteria 8308166
439 2817260593 2816332253 Bacteria 6764532
440 2817278234 2816332256 Bacteria 6891714
441 2817452531 2816332286 Bacteria 6853759
442 2818239176 2816332527 Bacteria 8933356
443 2818240714 2816332527 Bacteria 8933356
444 2819608139 2818991448 Bacteria 6772224
445 2819633098 2818991452 Bacteria 8442785
446 2821447278 2821443989 Bacteria 7658172
447 2824620244 2824617872 Bacteria 8814715
448 2824629509 2824626560 Bacteria 8813858
449 2824635829 2824635225 Bacteria 8785348
450 2824646131 2824644064 Bacteria 8743947
451 2824668184 2824661429 Bacteria 9877870
452 2824716671 2824714736 Bacteria 8717648
453 2824726628 2824723954 Bacteria 8758240
454 2824777822 2824773399 Bacteria 8360218
455 2841954920 2841949485 Bacteria 8680857
456 2841980358 2841974524 Bacteria 8931498
457 2841988524 2841983080 Bacteria 8395090
458 2842211411 2842205361 Bacteria 6340321
459 2842284866 2842278818 Bacteria 6340002
460 2842700627 2842698319 Bacteria 5190321
461 2844533325 2844533157 Bacteria 7517899
462 2861693026 2861691609 Bacteria 5628931
463 2863422111 2863421361 Bacteria 7300805
464 2874106565 2874102143 Bacteria 6342645
465 2874594163 2874590934 Bacteria 8299676
466 2874617378 2874612657 Bacteria 8252029
467 2874651935 2874645413 Bacteria 8214782
468 2876773609 2876771140 Bacteria 8287509
469 2876824763 2876818435 Bacteria 8274608
470 2879081490 2879074833 Bacteria 8279565
471 2879105198 2879099564 Bacteria 10442239
472 2881167253 2881161766 Bacteria 7127907
473 2888379191 2888378607 Bacteria 9652610
474 2888380318 2888378607 Bacteria 9652610
475 2904707000
476 2919077109 2919073203 Bacteria 6531949
477 2919102418 2919100787 Bacteria 7710546
478 2922371705
479 2923559078 2923556063 Bacteria 6793593
480 2928159320 2928157003 Bacteria 7522202
481 2928164620 2928163908 Bacteria 7561269
482 2928176553 2928170801 Bacteria 8785406
483 2932790662 2932784394 Bacteria 9704911
484 2932811859 2932809354 Bacteria 9135765
485 2932822655 2932818245 Bacteria 9955613
486 2932835559 2932828146 Bacteria 9745859
487 2935624713 2935616580 Bacteria 9032984
488 2935646156 2935638405 Bacteria 10015038
489 2935650315 2935648319 Bacteria 8801166
490 2935658462 2935656913 Bacteria 8965014
491 2935670725 2935665750 Bacteria 9571747
492 2935679536 2935675223 Bacteria 9928132
493 2935683579 2935675223 Bacteria 9928132
494 2935691448 2935684952 Bacteria 9590419
495 2935693456 2935684952 Bacteria 9590419
496 2935701905 2935694250 Bacteria 9291695
497 2935704520 2935703347 Bacteria 10242284
498 2935719282 2935713505 Bacteria 9608509
499 2935721646 2935713505 Bacteria 9608509
500 2935729118 2935722832 Bacteria 9608746
501 2935731024 2935722832 Bacteria 9608746
502 2935737641 2935732158 Bacteria 9706831
503 2935740785 2935732158 Bacteria 9706831
504 2935747017 2935741537 Bacteria 9707219
505 2935750049 2935741537 Bacteria 9707219
506 2935758183 2935750917 Bacteria 9590372
507 2935759439 2935750917 Bacteria 9590372
508 2935768860 2935760218 Bacteria 9817913
509 2935769223 2935760218 Bacteria 9817913
510 2935776873 2935769743 Bacteria 7878163
511 2935778335 2935777560 Bacteria 8077691
512 2935792869 2935785616 Bacteria 7962367
513 2935800989 2935793552 Bacteria 8012592
514 2935809152 2935801545 Bacteria 9301974
515 2935816494 2935810662 Bacteria 9401221
516 2935835466 2935827899 Bacteria 10038562
517 2935845770 2935837841 Bacteria 9454360
518 2935863374 2935855204 Bacteria 9035059
519 2935871452 2935864058 Bacteria 9784707
520 2935881701 2935873716 Bacteria 9632195
521 2935981820 2935975950 Bacteria 8347125
522 2935993879 2935992306 Bacteria 9802711
523 2936009695 2936002035 Bacteria 9362176
524 2936013126 2936011229 Bacteria 8801034
525 2936021787 2936019824 Bacteria 8804134
526 2936030419 2936028420 Bacteria 8965941
527 2936042554 2936037263 Bacteria 9446081
528 2936047981 2936046547 Bacteria 8903709
529 2940563906 2940556831 Bacteria 9590747
530 2940565343 2940556831 Bacteria 9590747
531 2941545944 2941538514 Bacteria 9402094
532 2958094601 2958092219 Bacteria 6861151
533 2981993743 2981990288 Bacteria 7590678
534 3005420926 3005416602 Bacteria 7064308
535 3005595762 3005594810 Bacteria 8716512
536 641646936 641522639 Bacteria 7737025
537 643600842 643348564 Bacteria 8839022
538 8005319339 8005314921 Bacteria 7072929
539 8005487797 8005484373 Bacteria 6297373
540 8005650283 8005645114 Bacteria 6950293
541 8005685753 8005682033 Bacteria 6726518
542 8006934782 8006933436 Bacteria 10410654
543 8006974750 8006973647 Bacteria 10679141
544 8016516051 8016511872 Bacteria 9921665
545 8016529829 8016522445 Bacteria 8156687
546 8016535063 8016530956 Bacteria 8155261
547 8016548269 8016539877 Bacteria 8155419
548 8016553856 8016548790 Bacteria 8155074
549 8016562231 8016557553 Bacteria 8154380
550 8016573406 8016566248 Bacteria 8158151
551 8016577538 8016575299 Bacteria 8154085
552 8016600047 8016595262 Bacteria 8149947
553 8016610715 8016603502 Bacteria 8731218
554 8016614215 8016613128 Bacteria 8794220
555 8016626769 8016622563 Bacteria 7999408
556 8017060465 8017057580 Bacteria 10023680
557 8018850586 8018845410 Bacteria 8933938
558 8019534818 8019530166 Bacteria 8155624
559 8019544657 8019538911 Bacteria 7872763
560 8019553880 8019547302 Bacteria 7996444
561 8019579941 8019576017 Bacteria 10049540
562 8019587653 8019586578 Bacteria 10212056
563 8019603675 8019597564 Bacteria 10041141
564 8019614852 8019608314 Bacteria 10042931
565 8019620985 8019619141 Bacteria 9218857
566 8019629576 8019629233 Bacteria 8687553
567 8019648778 8019638758 Bacteria 9062356
568 8019659784 8019659431 Bacteria 8577854
569 8019669164 8019668869 Bacteria 8791617
570 8019678236 8019678201 Bacteria 8863603
571 8020808319 8020807995 Bacteria 6801506
572 8020944496 8020938398 Bacteria 7472757
573 8020947036 8020945358 Bacteria 8467355
574 8020960065 8020953355 Bacteria 7439080
575 8021122999 8021120328 Bacteria 8782274
576 8039104180 8039098773 Bacteria 6602928
577 8040172603 8040167225 Bacteria 6542727
578 8040175170 8040173305 Bacteria 6827067
579 Ga0496116_0085461
580 JGI25158J39367_1000838
581 JGI25152J39213_1007085
582 JGI25159J45721_1000678
583 JGI25159J45721_1002059
584 JGI25153J46596_10000288
585 JGI25153J46596_10001586
586 JGI25153J46596_10018033
587 JGI25153J46596_10041756
588 rootH2_10005012
589 rootL2_10006749
590 rootL2_10077760
591 rootH1_10109858
592 rootH1_10164832
593 rootH1_10164833
594 JGI25160J50197_1000413
595 JGI25160J50197_1001701
596 JGI25160J50197_1022434
597 JGI25161J50226_1000567
598 JGI25161J50226_1000572
599 JGI25161J50226_1000905
600 Ga0055532_1000954
601 Ga0055527_1000519
602 Ga0055535_1001606
603 Ga0055535_1001639
604 Ga0055542_1001602
605 Ga0055542_1004740
606 Ga0055529_1001193
607 Ga0055524_1007133
608 Ga0055528_1001484
609 Ga0055528_1005415
610 Ga0055540_1002714
611 Ga0058692_1016950
612 Ga0055543_1000079
613 Ga0055543_1000116
614 Ga0055543_1002291
615 Ga0065165_1002903
616 Ga0065165_1036443
617 Ga0070670_100009469
618 Ga0070670_100318602
619 Ga0070666_10033261
620 Ga0070666_10112887
621 Ga0070660_100000028
622 Ga0070661_100042078
623 Ga0070661_100070332
624 Ga0070668_100015221
625 Ga0070668_100179605
626 Ga0070668_100746361
627 Ga0070659_100000230
628 Ga0070709_10001293
629 Ga0070709_10026169
630 Ga0070714_100045562
631 Ga0070713_100009193
632 Ga0070710_10000282
633 Ga0070710_10231800
634 Ga0070711_100014925
635 Ga0070711_100134613
636 Ga0070708_100284339
637 Ga0070663_100003063
638 Ga0070663_100023282
639 Ga0070662_100007492
640 Ga0070662_100058201
641 Ga0070665_100000465
642 Ga0070665_100003470
643 Ga0070665_100097993
644 Ga0068855_100177750
645 Ga0068855_100310437
646 Ga0070664_100141871
647 Ga0068856_100327522
648 Ga0068856_101010871
649 Ga0068852_100029923
650 Ga0068859_100318350
651 Ga0068851_10002327
652 Ga0068863_100299783
653 Ga0068858_100013390
654 Ga0068858_100319541
655 Ga0068860_100243394
656 Ga0068862_100107747
657 Ga0081540_1009036
658 Ga0081540_1018480
659 Ga0070717_10271883
660 Ga0075363_100063664
661 Ga0075364_10020082
662 Ga0070712_100005683
663 Ga0075362_10129195
664 Ga0075367_10185266
665 Ga0075366_10021738
666 Ga0075370_10006671
667 Ga0068865_100311329
668 Ga0097620_100318339
669 Ga0099794_10013003
670 Ga0105250_10092105
671 Ga0105250_10200063
672 Ga0105240_10001146
673 Ga0105240_10014261
674 Ga0105240_10042503
675 Ga0105240_10070943
676 Ga0105240_10457071
677 Ga0111539_10000323
678 Ga0105247_10014641
679 Ga0105243_10164959
680 Ga0105241_10065423
681 Ga0105241_10074884
682 Ga0105241_10087414
683 Ga0105242_10975339
684 Ga0105248_10079304
685 Ga0105237_10001621
686 Ga0105237_10004870
687 Ga0105237_10016195
688 Ga0105237_10018112
689 Ga0105237_10115232
690 Ga0105237_10213030
691 Ga0105237_10395808
692 Ga0105237_10530513
693 Ga0105238_10025999
694 Ga0105238_10075985
695 Ga0105238_10503897
696 Ga0105249_10007619
697 Ga0099796_10000384
698 Ga0105239_10045380
699 Ga0105239_10078794
700 Ga0105239_10129037
701 Ga0105239_10174566
702 Ga0105239_10500869
703 Ga0105239_11372141
704 Ga0105246_10072109
705 Ga0157378_10807274
706 Ga0163162_10010810
707 Ga0157375_10416230
708 Ga0163163_10956599
709 Ga0182008_10000113
710 Ga0182007_10000213
711 Ga0213873_10002417
712 Ga0213872_10003532
713 Ga0213872_10018759
714 Ga0213872_10020568
715 Ga0213872_10024949
716 Ga0213872_10025083
717 Ga0213872_10057011
718 Ga0213876_10150635
719 Ga0209436_100066
720 Ga0209566_100904
721 Ga0209672_100019
722 Ga0209672_100069
723 Ga0209147_100026
724 Ga0209147_100044
725 Ga0209147_100128
726 Ga0209258_100031
727 Ga0209258_100079
728 Ga0209148_1000027
729 Ga0209148_1000474
730 Ga0209148_1000501
731 Ga0209148_1001447
732 Ga0209129_1006000
733 Ga0209233_1008059
734 Ga0209565_1018425
735 Ga0209455_1000058
736 Ga0209455_1001131
737 Ga0209455_1011491
738 Ga0209673_1000059
739 Ga0209673_1001545
740 Ga0209130_1000022
741 Ga0209130_1000219
742 Ga0209564_1000475
743 Ga0209758_1000993
744 Ga0209758_1007575
745 Ga0209256_1037569
746 Ga0209256_1044624
747 Ga0207426_1000005
748 Ga0207426_1000075
749 Ga0209051_1061830
750 Ga0209257_1051176
751 Ga0207656_10005520
752 Ga0207692_10120291
753 Ga0207710_10036840
754 Ga0207680_10023242
755 Ga0207647_10002100
756 Ga0207647_10051781
757 Ga0207647_10080733
758 Ga0207705_10078506
759 Ga0207684_10322804
760 Ga0207654_10067821
761 Ga0207654_10119718
762 Ga0207654_10177692
763 Ga0207695_10000006
764 Ga0207695_10003507
765 Ga0207695_10023432
766 Ga0207695_10071449
767 Ga0207695_10089774
768 Ga0207671_10013654
769 Ga0207671_10020670
770 Ga0207671_10022161
771 Ga0207671_10141456
772 Ga0207671_10270888
773 Ga0207693_10008068
774 Ga0207693_10036970
775 Ga0207663_10116032
776 Ga0207657_10000001
777 Ga0207694_10080842
778 Ga0207694_10097732
779 Ga0207650_10298737
780 Ga0207700_10005940
781 Ga0207664_10008161
782 Ga0207644_10040268
783 Ga0207690_10000072
784 Ga0207706_10001636
785 Ga0207706_10141303
786 Ga0207665_10024914
787 Ga0207711_10145182
788 Ga0207667_10673808
789 Ga0207712_10001146
790 Ga0207668_10009192
791 Ga0207668_10280590
792 Ga0207640_10729532
793 Ga0207658_10017385
794 Ga0207658_10468596
795 Ga0207677_10132213
796 Ga0207703_10011514
797 Ga0207703_10056162
798 Ga0207639_10004652
799 Ga0207639_10058139
800 Ga0207639_10326389
801 Ga0207678_10001112
802 Ga0207678_10012138
803 Ga0207678_10026489
804 Ga0207678_10030234
805 Ga0207702_10130697
806 Ga0207702_10979875
807 Ga0207641_10252675
808 Ga0207648_10331910
809 Ga0207674_10046570
810 Ga0207674_10267551
811 Ga0207675_100292014
812 Ga0207698_10187980
813 Ga0209371_1000243
814 Ga0209371_1002714
815 Ga0207428_10000129
816 Ga0268266_10000006
817 Ga0268266_10252816
818 Ga0268256_1000311
819 Ga0265331_10178578
820 Ga0307516_10000173
821 Ga0307410_10138330
822 Ga0307409_100042599
823 Ga0307414_10515187
824 Ga0373947_0298456
825 Ga0436365_0265027
826 Ga0436365_1822309
827 Ga0436360_0537233
828 Ga0436360_0695279
829 Ga0436360_0722236
830 Ga0436360_1172287
831 Ga0436361_0087656
832 Ga0436361_0091426
833 Ga0436361_0176654
834 Ga0436361_0267995
835 Ga0436361_0357323
836 Ga0436361_0362812
837 Ga0436361_0372030
838 Ga0436361_0472884
839 Ga0436361_0993041
840 Ga0436361_1192548
841 Ga0436362_0775664
842 Ga0436362_1289511
843 Ga0439465_0016516
844 Ga0451793_0280828
845 Ga0451795_0231223
846 Ga0451837_0701287
847 Ga0439431_0010234
848 Ga0439431_0044809
849 Ga0466972_0014613
850 Ga0466972_0016624
851 Ga0466961_0122803
852 Ga0466968_0002924
853 Ga0466968_0217313
854 Ga0466970_0169722
855 Ga0466960_0000523
856 Ga0466959_0059664
857 Ga0466967_0306456
858 Ga0495590_0049862
859 Ga0495629_0030964
860 Ga0495638_0000019
861 Ga0495605_0081139
862 Ga0495584_0316806
863 Ga0495596_0164548
864 Ga0495606_0017751
865 Ga0495606_0055014
866 Ga0495606_0097475
867 Ga0495610_0002011
868 Ga0495610_0068283
869 Ga0495616_0102608
870 Ga0495628_0189255
871 Ga0495628_0267754
872 Ga0495643_0015969
873 Ga0495643_0053328
874 Ga0495643_0057175
875 Ga0495648_0162125
876 Ga0495648_0288065
877 Ga0495640_0100321
878 Ga0495622_0078556
879 Ga0495667_0547230
880 Ga0495668_0128870
881 Ga0495634_0064965
882 Ga0495611_0019278
883 Ga0495625_0389870
884 Ga0495635_0003891
885 Ga0495657_0012111
886 Ga0495624_0043274
887 Ga0495671_0309577
888 Ga0495589_0210396
889 Ga0495600_0006748
890 Ga0495604_0062128
891 Ga0495676_0076376
892 Ga0495683_0057977
893 Ga0495683_0115991
894 Ga0495687_041587
895 Ga0495673_0030030
896 Ga0495686_0000082
897 Ga0495686_0000115
898 Ga0495626_0043928
899 Ga0496100_0381723
900 Ga0496101_0012616
901 Ga0496101_0159645
902 Ga0496102_0153244
903 Ga0496102_0195918
904 Ga0496104_0140344
905 Ga0496104_0195289
906 Ga0496104_0372072
907 Ga0496105_0001350
908 Ga0496105_0136364
909 Ga0496106_0015492
910 Ga0496106_0023403
911 Ga0496109_0396488
912 Ga0496111_0166994
913 Ga0496111_0243304
914 Ga0496111_0427029
915 Ga0496112_0165784
916 Ga0496113_0149569
917 Ga0496116_0070663
918 Ga0496116_0102306
919 Ga0496116_0109707
920 Ga0496117_0007273
921 Ga0496117_0130036
922 Ga0496118_0008990
923 Ga0496118_0010965
924 Ga0496118_0168112
925 Ga0496119_0004102
926 Ga0496119_0018244
927 Ga0496119_0039200
928 Ga0496119_0046340
929 Ga0496119_0057536
930 Ga0496120_0014557
931 Ga0496120_0056098
932 Ga0496121_0000022
933 Ga0496121_0000523
934 Ga0496121_0021639
935 Ga0496121_0027976
936 Ga0496121_0037444
937 Ga0496121_0049552
938 Ga0496121_0059791
939 Ga0496121_0095254
940 Ga0496121_0156446
941 Ga0496122_0004397
942 Ga0496123_0004520
943 Ga0496124_0076382
944 Ga0496125_0006913
945 Ga0496125_0199253
946 Ga0496126_0006108
947 Ga0496126_0073507
948 Ga0496126_0230731
949 Ga0496126_0374000
950 Ga0501036_0180150
951 Ga0501043_0003245
952 Ga0501047_0000197
953 Ga0501048_0106838
954 Ga0501035_0069454
955 Ga0501044_0090088
956 nmdc:mga03n38_207978_c1
957 nmdc:mga00v17_64043_c1
958 nmdc:mga0yw44_150308_c1
959 nmdc:mga0yw44_5700_c1
960 nmdc:mga0k408_42731_c1
961 nmdc:mga06z11_510122_c1
962 nmdc:mga07m45_91103_c1
963 nmdc:mga08y16_51_c1
964 nmdc:mga0sz30_179745_c1
965 Ga0500635_0011635
966 Ga0495655_0031192
967 Ga0500566_0000029
968 Ga0500566_0090729
969 Ga0500640_045153
970 Ga0500650_0132226
971 Ga0500569_003041
972 Ga0500572_002243
973 Ga0500595_018539
974 Ga0500608_250672
975 Ga0500655_018796
976 Ga0500559_0027379
977 Ga0500564_016690
978 Ga0500568_0045969
979 Ga0500590_215444
980 Ga0500620_006890
981 Ga0500622_0002004
982 Ga0500638_027971
983 Ga0500636_0000420
984 Ga0500645_000065
985 Ga0500601_000525
986 Ga0500661_003363
987 Ga0500661_010036
988 2508693071
989 2509149467
990 2513649324
991 2513702772
992 2513721373
993 2515630076
994 2517101011
995 2519458398
996 2524441256
997 2524464657
998 2524539455
999 2528851738
1000 2545672620
1001 2585292781
1002 2599738274
1003 2599742366
1004 2600204484
1005 2616555366
1006 2617382440
1007 2643983745
1008 2644155878
1009 2644238046
1010 2671118198
1011 2676741469
1012 2745082190
1013 2765469231
1014 2808970253
1015 2809004901
1016 2809011959
1017 2817260593
1018 2817278234
1019 2817452531
1020 2818239176
1021 2818240714
1022 2819608139
1023 2819633098
1024 2821447278
1025 2824620244
1026 2824629509
1027 2824635829
1028 2824646131
1029 2824668184
1030 2824716671
1031 2824726628
1032 2824777822
1033 2841954920
1034 2841980358
1035 2841988524
1036 2842211411
1037 2842284866
1038 2842700627
1039 2844533325
1040 2861693026
1041 2863422111
1042 2874106565
1043 2874594163
1044 2874617378
1045 2874651935
1046 2876773609
1047 2876824763
1048 2879081490
1049 2879105198
1050 2881167253
1051 2888379191
1052 2888380318
1053 2904707000
1054 2919077109
1055 2919102418
1056 2922371705
1057 2923559078
1058 2928159320
1059 2928164620
1060 2928176553
1061 2932790662
1062 2932811859
1063 2932822655
1064 2932835559
1065 2935624713
1066 2935646156
1067 2935650315
1068 2935658462
1069 2935670725
1070 2935679536
1071 2935683579
1072 2935691448
1073 2935693456
1074 2935701905
1075 2935704520
1076 2935719282
1077 2935721646
1078 2935729118
1079 2935731024
1080 2935737641
1081 2935740785
1082 2935747017
1083 2935750049
1084 2935758183
1085 2935759439
1086 2935768860
1087 2935769223
1088 2935776873
1089 2935778335
1090 2935792869
1091 2935800989
1092 2935809152
1093 2935816494
1094 2935835466
1095 2935845770
1096 2935863374
1097 2935871452
1098 2935881701
1099 2935981820
1100 2935993879
1101 2936009695
1102 2936013126
1103 2936021787
1104 2936030419
1105 2936042554
1106 2936047981
1107 2940563906
1108 2940565343
1109 2941545944
1110 2958094601
1111 2981993743
1112 3005420926
1113 3005595762
1114 641646936
1115 643600842
1116 8005319339
1117 8005487797
1118 8005650283
1119 8005685753
1120 8006934782
1121 8006974750
1122 8016516051
1123 8016529829
1124 8016535063
1125 8016548269
1126 8016553856
1127 8016562231
1128 8016573406
1129 8016577538
1130 8016600047
1131 8016610715
1132 8016614215
1133 8016626769
1134 8017060465
1135 8018850586
1136 8019534818
1137 8019544657
1138 8019553880
1139 8019579941
1140 8019587653
1141 8019603675
1142 8019614852
1143 8019620985
1144 8019629576
1145 8019648778
1146 8019659784
1147 8019669164
1148 8019678236
1149 8020808319
1150 8020944496
1151 8020947036
1152 8020960065
1153 8021122999
1154 8039104180
1155 8040172603
1156 8040175170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06833

MdcE

Malonate decarboxylase gamma subunit

46

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.7908 1 208
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.7882 1 208
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.7845 1 202
4fb8-assembly1.cif.gz_B crystal structure of apo acyl-coa carboxylase 0.7799 7 140
5inf-assembly1.cif.gz_F structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.7789 4 208
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7843 1 202 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7815 22 201 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.778 22 203 3.90.226.10
af_O53578_265_515_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7723 5 197 3.90.226.10
af_A4HUX0_281_535_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7681 1 201 3.90.226.10
ID Description Score Start End GO Terms
AF-F0G5D1-F1-model_v4 Malonate decarboxylase, gamma subunit 0.9457 1 124
AF-F0G5D1-F1-model_v4 Malonate decarboxylase, gamma subunit 0.9312 1 124
AF-A0A520HR39-F1-model_v4 Biotin-independent malonate decarboxylase subunit gamma 0.9307 1 146 GO:0016020
AF-A0A520HR39-F1-model_v4 Biotin-independent malonate decarboxylase subunit gamma 0.9246 1 146 GO:0016020
AF-A0A5E8TF07-F1-model_v4 deleted 0.9182 1 204

Map