F465810

General Info

Members Datasets Scaffolds Average Seq Length
579 262 579 339

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100002968|Ga0070699_10000296814
Length 350
Sequence MSRGWGPASMSKLRVLALVHRHLIPPATVEEGTDITSAPWRTEYDVISTLTAMGHEVRALGVHDDLGEIRRLADEWKPHIAFNLLEGFDDVTIFDQNVVSHLELLKLPYTGCNPRGLLMARDKSLSKKLLAYHRIAVPEFEVCRIGRPVRRHKRLTFPLIVKSLTQEASIGISQASVVDTDEKLKERVTFIHESIGTAAIVEQYIEGRELYVGVLGNQVLQALPVWELFFTNMPEGSKRIATDRVKWSVKYQKKYGIDSGPAVELADGQAEKIQHLCKRTYRALELSGYARIDLRLDDTGNAWVLEANPNPQIAKGEDFAASAEKVGVSYEGVLQRIINLGLRWQPESFA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.76
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10013682 3300002459 Unclassified 1675
2 Ga0065712_10134007 3300005290 Unclassified 1517
3 Ga0065715_10033993 3300005293 Unclassified 1443
4 Ga0065715_10130434 3300005293 Bacteria 2026
5 Ga0065707_10030388 3300005295 Unclassified 1353
6 Ga0065707_10120618 3300005295 Bacteria 2130
7 Ga0070658_10105552 3300005327 Bacteria 2330
8 Ga0070658_10115166 3300005327 Bacteria 2230
9 Ga0070676_10093764 3300005328 Bacteria 1844
10 Ga0070683_100149022 3300005329 Bacteria 2218
11 Ga0070683_100161076 3300005329 Bacteria 2129
12 Ga0070690_100007110 3300005330 Bacteria 6394
13 Ga0070690_100270778 3300005330 Bacteria 1208
14 Ga0070670_100040642 3300005331 Bacteria 3997
15 Ga0070670_100163564 3300005331 Unclassified 1929
16 Ga0068869_100075344 3300005334 Bacteria 2507
17 Ga0068869_100111935 3300005334 Bacteria 2078
18 Ga0068869_100188476 3300005334 Bacteria 1621
19 Ga0068868_100101883 3300005338 Bacteria 2324
20 Ga0068868_100163478 3300005338 Bacteria 1840
21 Ga0070689_100021368 3300005340 Bacteria 4818
22 Ga0070687_100006502 3300005343 Bacteria 4793
23 Ga0070668_100006035 3300005347 Bacteria 8986
24 Ga0070668_100041732 3300005347 Bacteria 3515
25 Ga0070668_100198499 3300005347 Bacteria 1646
26 Ga0070669_100024660 3300005353 Bacteria 4315
27 Ga0070669_100039142 3300005353 Bacteria 3444
28 Ga0070669_100108023 3300005353 Bacteria 2108
29 Ga0070675_100000256 3300005354 Bacteria 34835
30 Ga0070675_100008775 3300005354 Bacteria 7852
31 Ga0070675_100056873 3300005354 Bacteria 3225
32 Ga0070671_100053574 3300005355 Bacteria 3354
33 Ga0070671_100173649 3300005355 Bacteria 1823
34 Ga0070674_100002747 3300005356 Bacteria 9728
35 Ga0070674_100374590 3300005356 Unclassified 1156
36 Ga0070673_100085387 3300005364 Bacteria 2569
37 Ga0070673_100158610 3300005364 Bacteria 1922
38 Ga0070673_100162773 3300005364 Bacteria 1899
39 Ga0070673_100336881 3300005364 Bacteria 1336
40 Ga0070688_100076546 3300005365 Unclassified 2153
41 Ga0070659_100037950 3300005366 Bacteria 3756
42 Ga0070659_100137759 3300005366 Unclassified 1985
43 Ga0070667_100018119 3300005367 Bacteria 5838
44 Ga0070714_100025703 3300005435 Bacteria 4862
45 Ga0070701_10017833 3300005438 Bacteria 3326
46 Ga0070701_10094864 3300005438 Bacteria 1642
47 Ga0070711_100245135 3300005439 Bacteria 1403
48 Ga0070705_100004058 3300005440 Bacteria 7151
49 Ga0070705_100017483 3300005440 Bacteria 3744
50 Ga0070700_100010064 3300005441 Bacteria 5206
51 Ga0070694_100007550 3300005444 Bacteria 6637
52 Ga0070694_100225723 3300005444 Bacteria 1407
53 Ga0070708_100029777 3300005445 Bacteria 4712
54 Ga0070708_100205141 3300005445 Bacteria 1846
55 Ga0070708_100224280 3300005445 Bacteria 1763
56 Ga0070678_100161066 3300005456 Bacteria 1818
57 Ga0070681_10063568 3300005458 Bacteria 3663
58 Ga0070681_10156354 3300005458 Unclassified 2204
59 Ga0068867_100110622 3300005459 Bacteria 2110
60 Ga0068867_100216916 3300005459 Bacteria 1540
61 Ga0070685_10075745 3300005466 Bacteria 2005
62 Ga0070707_100188660 3300005468 Unclassified 2010
63 Ga0070707_100449718 3300005468 Bacteria 1249
64 Ga0070698_100057446 3300005471 Bacteria 3938
65 Ga0070698_100062739 3300005471 Bacteria 3749
66 Ga0070698_100273144 3300005471 Bacteria 1622
67 Ga0070699_100002968 3300005518 Bacteria 15082
68 Ga0070699_100434172 3300005518 Bacteria 1190
69 Ga0070679_100041452 3300005530 Bacteria 4582
70 Ga0070679_100044090 3300005530 Bacteria 4443
71 Ga0070679_100044360 3300005530 Bacteria 4430
72 Ga0070679_100178988 3300005530 Unclassified 2093
73 Ga0070697_100037644 3300005536 Bacteria 3908
74 Ga0070697_100089167 3300005536 Bacteria 2548
75 Ga0070672_100042165 3300005543 Bacteria 3513
76 Ga0070672_100075887 3300005543 Bacteria 2684
77 Ga0070672_100133060 3300005543 Bacteria 2046
78 Ga0070686_100001050 3300005544 Bacteria 15900
79 Ga0070686_100051969 3300005544 Bacteria 2611
80 Ga0070686_100125844 3300005544 Bacteria 1766
81 Ga0070686_100223188 3300005544 Bacteria 1363
82 Ga0070696_100024038 3300005546 Bacteria 4142
83 Ga0070693_100119288 3300005547 Unclassified 1634
84 Ga0070665_100013758 3300005548 Bacteria 8141
85 Ga0070665_100027996 3300005548 Bacteria 5677
86 Ga0070665_100247818 3300005548 Bacteria 1782
87 Ga0070704_100102472 3300005549 Bacteria 2160
88 Ga0068855_100005266 3300005563 Bacteria 15794
89 Ga0070664_100034520 3300005564 Unclassified 4243
90 Ga0070664_100058214 3300005564 Bacteria 3286
91 Ga0068854_100086619 3300005578 Bacteria 2323
92 Ga0068854_100120682 3300005578 Bacteria 1990
93 Ga0068854_100282575 3300005578 Bacteria 1337
94 Ga0068856_100025230 3300005614 Bacteria 5792
95 Ga0068856_100166694 3300005614 Bacteria 2214
96 Ga0070702_100006255 3300005615 Bacteria 5621
97 Ga0068852_100352146 3300005616 Bacteria 1438
98 Ga0068859_100119466 3300005617 Unclassified 2702
99 Ga0068859_100226449 3300005617 Bacteria 1958
100 Ga0068866_10015714 3300005718 Bacteria 3369
101 Ga0068861_100004175 3300005719 Bacteria 9682
102 Ga0068861_100048699 3300005719 Bacteria 3205
103 Ga0068870_10045533 3300005840 Bacteria 2298
104 Ga0068863_100019394 3300005841 Bacteria 6505
105 Ga0068858_100043977 3300005842 Bacteria 4141
106 Ga0068858_100104259 3300005842 Unclassified 2646
107 Ga0068862_100042083 3300005844 Bacteria 3890
108 Ga0068862_100057330 3300005844 Bacteria 3340
109 Ga0068862_100320323 3300005844 Bacteria 1431
110 Ga0081455_10000595 3300005937 Bacteria 46866
111 Ga0081455_10036780 3300005937 Bacteria 4354
112 Ga0081455_10110296 3300005937 Bacteria 2187
113 Ga0081539_10005962 3300005985 Bacteria 12013
114 Ga0081539_10026285 3300005985 Unclassified 3719
115 Ga0070716_100213596 3300006173 Bacteria 1291
116 Ga0097621_100019461 3300006237 Bacteria 5210
117 Ga0097621_100043532 3300006237 Bacteria 3619
118 Ga0097621_100065021 3300006237 Bacteria 3001
119 Ga0097621_100065569 3300006237 Bacteria 2989
120 Ga0097621_100123007 3300006237 Unclassified 2202
121 Ga0068871_100000257 3300006358 Bacteria 36771
122 Ga0068871_100009412 3300006358 Bacteria 7077
123 Ga0068871_100055101 3300006358 Bacteria 3227
124 Ga0068871_100238557 3300006358 Bacteria 1580
125 Ga0075428_100027444 3300006844 Bacteria 6299
126 Ga0075431_100052269 3300006847 Bacteria 4213
127 Ga0075433_10011248 3300006852 Bacteria 7204
128 Ga0075433_10106986 3300006852 Bacteria 2479
129 Ga0075433_10209860 3300006852 Unclassified 1731
130 Ga0075433_10275779 3300006852 Bacteria 1490
131 Ga0075434_100000505 3300006871 Bacteria 29553
132 Ga0075434_100057835 3300006871 Bacteria 3853
133 Ga0075434_100076867 3300006871 Bacteria 3333
134 Ga0075434_100078329 3300006871 Bacteria 3300
135 Ga0075434_100182270 3300006871 Bacteria 2120
136 Ga0075434_100354379 3300006871 Bacteria 1488
137 Ga0075434_100571832 3300006871 Unclassified 1149
138 Ga0068865_100057798 3300006881 Bacteria 2707
139 Ga0068865_100206648 3300006881 Bacteria 1527
140 Ga0075436_100001003 3300006914 Bacteria 18959
141 Ga0075436_100138041 3300006914 Bacteria 1712
142 Ga0075436_100188874 3300006914 Unclassified 1457
143 Ga0097620_100119467 3300006931 Unclassified 2702
144 Ga0097620_100226470 3300006931 Bacteria 1958
145 Ga0075435_100000129 3300007076 Bacteria 43005
146 Ga0075435_100000566 3300007076 Bacteria 22768
147 Ga0075435_100006354 3300007076 Bacteria 8352
148 Ga0075435_100012127 3300007076 Bacteria 6373
149 Ga0075435_100050103 3300007076 Bacteria 3360
150 Ga0075435_100057273 3300007076 Bacteria 3152
151 Ga0075435_100195798 3300007076 Bacteria 1711
152 Ga0099794_10011557 3300007265 Bacteria 3783
153 Ga0105240_10033599 3300009093 Bacteria 6623
154 Ga0111539_10002365 3300009094 Bacteria 25074
155 Ga0111539_10003171 3300009094 Bacteria 21764
156 Ga0111539_10007274 3300009094 Bacteria 14174
157 Ga0111539_10181571 3300009094 Bacteria 2457
158 Ga0111539_10243676 3300009094 Bacteria 2093
159 Ga0105245_10008629 3300009098 Bacteria 8891
160 Ga0105245_10187029 3300009098 Bacteria 1982
161 Ga0105245_10450225 3300009098 Unclassified 1296
162 Ga0105247_10007622 3300009101 Bacteria 6626
163 Ga0105247_10036543 3300009101 Unclassified 2994
164 Ga0114129_10000439 3300009147 Bacteria 49346
165 Ga0114129_10010707 3300009147 Bacteria 13075
166 Ga0114129_10013248 3300009147 Bacteria 11745
167 Ga0114129_10014568 3300009147 Bacteria 11206
168 Ga0114129_10018443 3300009147 Bacteria 9939
169 Ga0114129_10039931 3300009147 Bacteria 6620
170 Ga0114129_10077515 3300009147 Bacteria 4623
171 Ga0114129_10100822 3300009147 Bacteria 3995
172 Ga0114129_10147239 3300009147 Bacteria 3225
173 Ga0114129_10321143 3300009147 Bacteria 2058
174 Ga0105243_10029793 3300009148 Bacteria 4199
175 Ga0105243_10035229 3300009148 Bacteria 3880
176 Ga0105243_10077862 3300009148 Bacteria 2698
177 Ga0105243_10431708 3300009148 Bacteria 1231
178 Ga0105242_10001388 3300009176 Bacteria 19073
179 Ga0105242_10010963 3300009176 Bacteria 6964
180 Ga0105242_10064388 3300009176 Unclassified 3022
181 Ga0105242_10201705 3300009176 Bacteria 1767
182 Ga0105242_10207939 3300009176 Bacteria 1742
183 Ga0105242_10231270 3300009176 Bacteria 1657
184 Ga0105248_10007970 3300009177 Bacteria 11644
185 Ga0105248_10063608 3300009177 Bacteria 4142
186 Ga0105248_10066495 3300009177 Bacteria 4048
187 Ga0105248_10111119 3300009177 Bacteria 3091
188 Ga0105248_10182935 3300009177 Unclassified 2362
189 Ga0105248_10288067 3300009177 Bacteria 1849
190 Ga0105248_10421617 3300009177 Bacteria 1503
191 Ga0105238_10156320 3300009551 Bacteria 2256
192 Ga0105238_10198736 3300009551 Bacteria 1980
193 Ga0105238_10219299 3300009551 Bacteria 1878
194 Ga0105238_10275983 3300009551 Bacteria 1662
195 Ga0105238_10475197 3300009551 Unclassified 1249
196 Ga0105249_10091055 3300009553 Bacteria 2853
197 Ga0105249_10097553 3300009553 Bacteria 2759
198 Ga0105249_10104055 3300009553 Unclassified 2674
199 Ga0105249_10238917 3300009553 Bacteria 1795
200 Ga0105246_10127519 3300011119 Bacteria 1895
201 Ga0105246_10323533 3300011119 Bacteria 1254
202 Ga0157370_10067180 3300013104 Bacteria 3389
203 Ga0157374_10046981 3300013296 Bacteria 4000
204 Ga0157374_10110160 3300013296 Bacteria 2648
205 Ga0157374_10206483 3300013296 Bacteria 1925
206 Ga0157378_10010006 3300013297 Bacteria 8271
207 Ga0163162_10017441 3300013306 Bacteria 7025
208 Ga0163162_10167061 3300013306 Bacteria 2324
209 Ga0157372_10127466 3300013307 Unclassified 2926
210 Ga0157375_10006579 3300013308 Bacteria 10116
211 Ga0157375_10028737 3300013308 Bacteria 5218
212 Ga0157375_10076966 3300013308 Unclassified 3365
213 Ga0163163_10054508 3300014325 Bacteria 3950
214 Ga0163163_10077485 3300014325 Bacteria 3319
215 Ga0163163_10346141 3300014325 Bacteria 1542
216 Ga0157380_10180223 3300014326 Bacteria 1855
217 Ga0157380_10453198 3300014326 Bacteria 1233
218 Ga0157379_10014260 3300014968 Bacteria 6972
219 Ga0157379_10051051 3300014968 Bacteria 3694
220 Ga0157379_10188502 3300014968 Bacteria 1864
221 Ga0157379_10198866 3300014968 Bacteria 1812
222 Ga0157379_10355681 3300014968 Bacteria 1341
223 Ga0157376_10009978 3300014969 Bacteria 6930
224 Ga0157376_10225477 3300014969 Unclassified 1738
225 Ga0207688_10172915 3300025901 Unclassified 1285
226 Ga0207645_10164538 3300025907 Bacteria 1452
227 Ga0207643_10004664 3300025908 Bacteria 7355
228 Ga0207643_10063975 3300025908 Bacteria 2105
229 Ga0207705_10318199 3300025909 Bacteria 1195
230 Ga0207707_10017266 3300025912 Bacteria 6289
231 Ga0207707_10153738 3300025912 Bacteria 2012
232 Ga0207695_10285092 3300025913 Unclassified 1545
233 Ga0207693_10016421 3300025915 Bacteria 5917
234 Ga0207663_10027459 3300025916 Unclassified 3318
235 Ga0207660_10069122 3300025917 Bacteria 2563
236 Ga0207662_10022501 3300025918 Bacteria 3614
237 Ga0207662_10035068 3300025918 Bacteria 2929
238 Ga0207657_10204554 3300025919 Bacteria 1587
239 Ga0207646_10161465 3300025922 Bacteria 2022
240 Ga0207646_10190760 3300025922 Bacteria 1851
241 Ga0207646_10381570 3300025922 Unclassified 1273
242 Ga0207646_10404892 3300025922 Bacteria 1232
243 Ga0207681_10003393 3300025923 Bacteria 9959
244 Ga0207681_10010583 3300025923 Bacteria 5654
245 Ga0207681_10010897 3300025923 Bacteria 5583
246 Ga0207681_10013108 3300025923 Bacteria 5125
247 Ga0207650_10076631 3300025925 Unclassified 2526
248 Ga0207659_10004455 3300025926 Bacteria 8478
249 Ga0207659_10013061 3300025926 Bacteria 5308
250 Ga0207659_10018690 3300025926 Unclassified 4547
251 Ga0207659_10037105 3300025926 Bacteria 3381
252 Ga0207687_10008341 3300025927 Bacteria 6778
253 Ga0207687_10136987 3300025927 Bacteria 1852
254 Ga0207687_10246661 3300025927 Bacteria 1418
255 Ga0207700_10065019 3300025928 Bacteria 2781
256 Ga0207664_10129582 3300025929 Bacteria 2122
257 Ga0207664_10178938 3300025929 Bacteria 1820
258 Ga0207644_10075221 3300025931 Bacteria 2481
259 Ga0207644_10183329 3300025931 Bacteria 1642
260 Ga0207690_10114799 3300025932 Bacteria 1945
261 Ga0207706_10021540 3300025933 Bacteria 5786
262 Ga0207706_10056313 3300025933 Bacteria 3467
263 Ga0207706_10090392 3300025933 Bacteria 2692
264 Ga0207686_10020028 3300025934 Bacteria 3816
265 Ga0207686_10050511 3300025934 Bacteria 2586
266 Ga0207686_10055295 3300025934 Unclassified 2490
267 Ga0207686_10113387 3300025934 Bacteria 1833
268 Ga0207686_10345806 3300025934 Bacteria 1118
269 Ga0207709_10031521 3300025935 Bacteria 3097
270 Ga0207709_10033191 3300025935 Bacteria 3028
271 Ga0207670_10070208 3300025936 Bacteria 2419
272 Ga0207670_10147916 3300025936 Bacteria 1739
273 Ga0207669_10073065 3300025937 Bacteria 2162
274 Ga0207669_10137261 3300025937 Bacteria 1691
275 Ga0207704_10008815 3300025938 Bacteria 4842
276 Ga0207704_10120393 3300025938 Bacteria 1795
277 Ga0207704_10159231 3300025938 Bacteria 1604
278 Ga0207691_10018759 3300025940 Bacteria 6552
279 Ga0207691_10031489 3300025940 Bacteria 4949
280 Ga0207691_10067944 3300025940 Bacteria 3221
281 Ga0207711_10017848 3300025941 Bacteria 5895
282 Ga0207711_10033193 3300025941 Bacteria 4366
283 Ga0207711_10041355 3300025941 Bacteria 3925
284 Ga0207711_10051578 3300025941 Bacteria 3524
285 Ga0207711_10072865 3300025941 Bacteria 2984
286 Ga0207711_10132035 3300025941 Bacteria 2240
287 Ga0207711_10158468 3300025941 Bacteria 2047
288 Ga0207711_10242326 3300025941 Unclassified 1653
289 Ga0207711_10268784 3300025941 Bacteria 1568
290 Ga0207711_10327508 3300025941 Bacteria 1416
291 Ga0207689_10073162 3300025942 Bacteria 2816
292 Ga0207689_10135440 3300025942 Bacteria 2028
293 Ga0207667_10194849 3300025949 Bacteria 2079
294 Ga0207667_10347968 3300025949 Bacteria 1512
295 Ga0207651_10031764 3300025960 Bacteria 3381
296 Ga0207651_10045123 3300025960 Bacteria 2954
297 Ga0207651_10075632 3300025960 Bacteria 2404
298 Ga0207651_10102928 3300025960 Bacteria 2124
299 Ga0207712_10108654 3300025961 Bacteria 2076
300 Ga0207712_10187111 3300025961 Bacteria 1631
301 Ga0207712_10193501 3300025961 Bacteria 1607
302 Ga0207668_10045397 3300025972 Bacteria 2996
303 Ga0207640_10021110 3300025981 Bacteria 3876
304 Ga0207640_10066757 3300025981 Bacteria 2404
305 Ga0207640_10327768 3300025981 Bacteria 1222
306 Ga0207677_10063745 3300026023 Bacteria 2563
307 Ga0207677_10112531 3300026023 Bacteria 2030
308 Ga0207677_10185112 3300026023 Bacteria 1642
309 Ga0207677_10364708 3300026023 Bacteria 1215
310 Ga0207703_10006395 3300026035 Bacteria 9419
311 Ga0207703_10264422 3300026035 Bacteria 1556
312 Ga0207678_10194051 3300026067 Bacteria 1736
313 Ga0207708_10002255 3300026075 Bacteria 14198
314 Ga0207708_10205024 3300026075 Bacteria 1574
315 Ga0207702_10013654 3300026078 Bacteria 6746
316 Ga0207641_10002052 3300026088 Bacteria 19139
317 Ga0207648_10017949 3300026089 Bacteria 6417
318 Ga0207648_10122124 3300026089 Bacteria 2290
319 Ga0207676_10024773 3300026095 Bacteria 4444
320 Ga0207676_10155207 3300026095 Bacteria 1976
321 Ga0207674_10004766 3300026116 Bacteria 16267
322 Ga0207675_100001401 3300026118 Bacteria 24104
323 Ga0207675_100033630 3300026118 Bacteria 4777
324 Ga0207675_100146764 3300026118 Bacteria 2243
325 Ga0207683_10016232 3300026121 Bacteria 6337
326 Ga0207683_10048260 3300026121 Bacteria 3729
327 Ga0207683_10082135 3300026121 Bacteria 2862
328 Ga0207698_10402175 3300026142 Bacteria 1309
329 Ga0207428_10008381 3300027907 Bacteria 9336
330 Ga0207428_10063871 3300027907 Bacteria 2907
331 Ga0207428_10100382 3300027907 Bacteria 2237
332 Ga0268265_10004373 3300028380 Bacteria 9821
333 Ga0268265_10187295 3300028380 Bacteria 1784
334 Ga0268264_10236750 3300028381 Bacteria 1689
335 Ga0268264_10304571 3300028381 Bacteria 1501
336 Ga0316579_10010213 3300031691 Unclassified 3964
337 Ga0316579_10011221 3300031691 Unclassified 3804
338 Ga0265314_10128755 3300031711 Bacteria 1582
339 Ga0316578_10075316 3300031728 Bacteria 2002
340 Ga0307413_10104416 3300031824 Bacteria 1881
341 Ga0307407_10090753 3300031903 Bacteria 1872
342 Ga0307416_100123914 3300032002 Bacteria 2311
343 Ga0307416_100347486 3300032002 Bacteria 1499
344 Ga0307411_10005010 3300032005 Bacteria 6444
345 Ga0316583_10017769 3300032133 Bacteria 2555
346 Ga0316583_10026499 3300032133 Bacteria 2069
347 Ga0373930_0001256 3300034816 Bacteria 3744
348 Ga0373948_0009817 3300034817 Bacteria 1659
349 Ga0373950_0000367 3300034818 Bacteria 5609
350 Ga0373958_0001193 3300034819 Bacteria 3460
351 Ga0373959_0000325 3300034820 Bacteria 9805
352 Ga0373938_0000728 3300034957 Bacteria 5326
353 Ga0373928_0002071 3300035084 Bacteria 3909
354 Ga0373934_0057956 3300035086 Bacteria 1541
355 Ga0373949_0000664 3300035090 Bacteria 11205
356 Ga0373951_0000499 3300035091 Bacteria 11154
357 Ga0373952_0000347 3300035092 Bacteria 7814
358 Ga0373923_0021261 3300035111 Bacteria 2531
359 Ga0373932_0001093 3300035112 Bacteria 7822
360 Ga0373939_0001459 3300035114 Bacteria 5724
361 Ga0373939_0015662 3300035114 Bacteria 1988
362 Ga0373941_0000172 3300035115 Bacteria 11961
363 Ga0373953_0009362 3300035117 Bacteria 3367
364 Ga0373954_0046233 3300035118 Bacteria 2034
365 Ga0373956_0010188 3300035119 Bacteria 3843
366 Ga0373960_0000080 3300035121 Bacteria 14103
367 Ga0373946_0006371 3300035171 Bacteria 4277
368 Ga0373955_0001279 3300035172 Bacteria 10707
369 Ga0373955_0096692 3300035172 Bacteria 1690
370 Ga0373955_0184744 3300035172 Bacteria 1238
371 Ga0373942_0000596 3300035207 Bacteria 10173
372 Ga0373961_0001275 3300035241 Bacteria 7666
373 Ga0373961_0011136 3300035241 Bacteria 2229
374 Ga0373962_0000167 3300035242 Bacteria 14056
375 Ga0373924_0073962 3300035410 Unclassified 1441
376 Ga0373931_0002352 3300035691 Bacteria 8354
377 Ga0373933_0004986 3300035724 Bacteria 7241
378 Ga0373933_0008600 3300035724 Bacteria 5568
379 Ga0373933_0145412 3300035724 Bacteria 1499
380 Ga0373937_0000210 3300036401 Bacteria 56371
381 Ga0373937_0020132 3300036401 Bacteria 5978
382 Ga0373937_0149810 3300036401 Bacteria 2185
383 Ga0373937_0232871 3300036401 Bacteria 1735
384 Ga0316582_0026150 3300036647 Bacteria 3511
385 Ga0373925_0041926 3300037068 Unclassified 3395
386 Ga0373925_0046485 3300037068 Bacteria 3228
387 Ga0373925_0275197 3300037068 Bacteria 1355
388 Ga0316581_0000512 3300037588 Bacteria 7515
389 Ga0436365_1916363 3300039437 Bacteria 1239
390 Ga0436361_0447444 3300039447 Bacteria 3802
391 Ga0439445_0039060 3300042004 Bacteria 1257
392 Ga0439435_0004498 3300042436 Bacteria 3009
393 Ga0450916_000365 3300042530 Bacteria 3778
394 Ga0451576_0013503 3300045051 Bacteria 9136
395 Ga0495592_0009245 3300046454 Bacteria 7414
396 Ga0495603_0043876 3300046455 Bacteria 2669
397 Ga0495603_0044880 3300046455 Bacteria 2637
398 Ga0495629_0108426 3300046459 Bacteria 1937
399 Ga0495608_0003468 3300046511 Bacteria 11288
400 Ga0495608_0155480 3300046511 Unclassified 1456
401 Ga0495618_0168872 3300046514 Bacteria 1393
402 Ga0495628_0109283 3300046516 Bacteria 2128
403 Ga0495628_0134824 3300046516 Bacteria 1888
404 Ga0495630_0232360 3300046517 Unclassified 1409
405 Ga0495652_0070942 3300046529 Bacteria 2910
406 Ga0495640_0195136 3300046533 Bacteria 1286
407 Ga0495587_0052167 3300046536 Archaea 2414
408 Ga0495587_0071109 3300046536 Bacteria 2024
409 Ga0495645_0052667 3300046543 Bacteria 2960
410 Ga0495634_0047806 3300046642 Bacteria 2882
411 Ga0495599_0139367 3300046678 Bacteria 1505
412 Ga0495599_0195844 3300046678 Bacteria 1242
413 Ga0495669_0008713 3300046684 Bacteria 4272
414 Ga0495669_0104683 3300046684 Bacteria 1317
415 Ga0495600_0055147 3300046809 Bacteria 2596
416 Ga0495600_0127892 3300046809 Bacteria 1652
417 Ga0495604_0039596 3300047317 Bacteria 3704
418 Ga0495604_0053185 3300047317 Unclassified 3132
419 Ga0495674_0009481 3300047319 Bacteria 9249
420 Ga0495674_0134907 3300047319 Bacteria 2078
421 Ga0495674_0150787 3300047319 Bacteria 1950
422 Ga0495680_0115728 3300047322 Bacteria 1984
423 Ga0495675_0054218 3300047444 Bacteria 2545
424 Ga0495685_003696 3300047447 Bacteria 4892
425 Ga0495684_0000601 3300047471 Bacteria 28931
426 Ga0495684_0037392 3300047471 Bacteria 3723
427 Ga0495684_0241053 3300047471 Bacteria 1319
428 Ga0496100_0065825 3300048903 Unclassified 2403
429 Ga0496101_0037485 3300048904 Bacteria 3439
430 Ga0496102_0100543 3300048905 Bacteria 2686
431 Ga0496103_0317150 3300048906 Bacteria 1003
432 Ga0496104_0115190 3300048907 Bacteria 2579
433 Ga0496104_0225241 3300048907 Bacteria 1787
434 Ga0496106_0231836 3300048909 Bacteria 1474
435 Ga0496109_0291782 3300048912 Bacteria 1538
436 Ga0496110_0018662 3300048913 Bacteria 5819
437 Ga0496110_0019709 3300048913 Bacteria 5682
438 Ga0496112_0063101 3300048915 Bacteria 3654
439 Ga0496112_0218517 3300048915 Bacteria 1862
440 Ga0496112_0383600 3300048915 Bacteria 1346
441 Ga0496113_0171179 3300048916 Bacteria 1720
442 Ga0496114_0083664 3300048917 Bacteria 2700
443 Ga0496114_0241570 3300048917 Bacteria 1588
444 Ga0501031_0005593 3300049568 Bacteria 8191
445 Ga0501031_0145881 3300049568 Bacteria 1546
446 Ga0501032_0083230 3300049569 Bacteria 2128
447 Ga0501033_0016324 3300049570 Bacteria 5624
448 Ga0501036_0002948 3300049572 Bacteria 13518
449 Ga0501036_0005831 3300049572 Bacteria 9972
450 Ga0501036_0112273 3300049572 Unclassified 2303
451 Ga0501037_0026224 3300049573 Bacteria 4306
452 Ga0501037_0073237 3300049573 Bacteria 2490
453 Ga0501037_0173505 3300049573 Bacteria 1532
454 Ga0501038_0001025 3300049574 Bacteria 25187
455 Ga0501038_0003218 3300049574 Bacteria 15235
456 Ga0501038_0078099 3300049574 Bacteria 2794
457 Ga0501038_0112085 3300049574 Bacteria 2259
458 Ga0501039_0008312 3300049575 Bacteria 7908
459 Ga0501039_0091975 3300049575 Bacteria 2364
460 Ga0501039_0148710 3300049575 Bacteria 1840
461 Ga0501039_0430350 3300049575 Bacteria 1036
462 Ga0501040_0000631 3300049576 Bacteria 21526
463 Ga0501040_0018766 3300049576 Bacteria 4594
464 Ga0501041_0000459 3300049577 Bacteria 20658
465 Ga0501041_0004935 3300049577 Bacteria 7755
466 Ga0501041_0013354 3300049577 Bacteria 4867
467 Ga0501041_0038827 3300049577 Bacteria 2888
468 Ga0501042_0000828 3300049578 Bacteria 17181
469 Ga0501042_0004651 3300049578 Bacteria 8759
470 Ga0501042_0039701 3300049578 Bacteria 3346
471 Ga0501043_0006508 3300049579 Bacteria 9373
472 Ga0501043_0141264 3300049579 Unclassified 1886
473 Ga0501046_0007522 3300049580 Bacteria 9557
474 Ga0501046_0040700 3300049580 Bacteria 3712
475 Ga0501046_0041902 3300049580 Bacteria 3651
476 Ga0501046_0048819 3300049580 Bacteria 3350
477 Ga0501046_0116686 3300049580 Bacteria 2034
478 Ga0501047_0003215 3300049581 Bacteria 15490
479 Ga0501048_0000457 3300049582 Bacteria 28577
480 Ga0501048_0024598 3300049582 Bacteria 4395
481 Ga0501048_0026787 3300049582 Bacteria 4196
482 Ga0501068_0027408 3300049584 Bacteria 3364
483 Ga0501068_0109091 3300049584 Unclassified 1720
484 Ga0501069_0089445 3300049585 Bacteria 1741
485 Ga0501070_0021522 3300049586 Bacteria 5410
486 Ga0501070_0238676 3300049586 Bacteria 1488
487 Ga0501071_0000456 3300049587 Bacteria 20604
488 Ga0501071_0031766 3300049587 Bacteria 3746
489 Ga0501071_0041095 3300049587 Bacteria 3311
490 Ga0501072_0001602 3300049588 Bacteria 16913
491 Ga0501072_0007595 3300049588 Bacteria 8226
492 Ga0501073_0070236 3300049589 Bacteria 2440
493 Ga0501074_0002370 3300049590 Bacteria 13122
494 Ga0501074_0284170 3300049590 Bacteria 1176
495 Ga0501075_0000003 3300049591 Bacteria 173182
496 Ga0501075_0014251 3300049591 Bacteria 5696
497 Ga0501075_0017229 3300049591 Bacteria 5216
498 Ga0501075_0388230 3300049591 Bacteria 1064
499 Ga0501076_0000010 3300049592 Bacteria 116774
500 Ga0501076_0008443 3300049592 Bacteria 7550
501 Ga0501076_0014040 3300049592 Bacteria 6020
502 Ga0501077_0000456 3300049593 Bacteria 24833
503 Ga0501079_0000036 3300049741 Bacteria 57722
504 Ga0501079_0015793 3300049741 Bacteria 5769
505 Ga0501080_0000401 3300049742 Bacteria 33489
506 Ga0501080_0081502 3300049742 Bacteria 3006
507 Ga0501080_0176997 3300049742 Bacteria 1965
508 Ga0501081_0000154 3300049743 Bacteria 31349
509 Ga0501081_0009377 3300049743 Bacteria 6376
510 Ga0501081_0017789 3300049743 Bacteria 4711
511 Ga0501083_0029962 3300049744 Bacteria 3739
512 Ga0501035_0013314 3300049822 Bacteria 7590
513 Ga0501044_0005224 3300049823 Bacteria 14450
514 Ga0501045_0000013 3300049824 Bacteria 73989
515 Ga0501045_0024004 3300049824 Bacteria 4377
516 Ga0501045_0098670 3300049824 Bacteria 2161
517 nmdc:mga05p37_130393_c1 3300050507 Bacteria 3084
518 nmdc:mga05p37_13531_c1 3300050507 Bacteria 9781
519 nmdc:mga05p37_139892_c1 3300050507 Bacteria 2966
520 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
521 nmdc:mga05p37_288831_c1 3300050507 Bacteria 1953
522 nmdc:mga05p37_301613_c1 3300050507 Bacteria 1903
523 nmdc:mga05p37_349481_c1 3300050507 Bacteria 1741
524 nmdc:mga05p37_369694_c1 3300050507 Bacteria 1683
525 nmdc:mga05p37_430504_c1 3300050507 Bacteria 1533
526 nmdc:mga05p37_4985_c1 3300050507 Bacteria 15559
527 nmdc:mga05p37_612_c1 3300050507 Bacteria 39414
528 nmdc:mga05p37_6313_c1 3300050507 Bacteria 11729
529 nmdc:mga05p37_63822_c1 3300050507 Bacteria 4533
530 nmdc:mga05p37_660749_c1 3300050507 Bacteria 1168
531 nmdc:mga05p37_8400_c1 3300050507 Bacteria 12208
532 nmdc:mga09592_392492_c1 3300050508 Unclassified 1200
533 nmdc:mga06r32_436314_c1 3300050510 Bacteria 1290
534 nmdc:mga06r32_558328_c1 3300050510 Bacteria 1118
535 nmdc:mga06r32_79470_c1 3300050510 Bacteria 3190
536 nmdc:mga08y16_127368_c1 3300050511 Bacteria 2648
537 nmdc:mga08y16_16332_c1 3300050511 Bacteria 7805
538 nmdc:mga08y16_1959_c1 3300050511 Bacteria 20984
539 nmdc:mga08y16_23054_c1 3300050511 Bacteria 6572
540 nmdc:mga08y16_9897_c1 3300050511 Bacteria 10008
541 nmdc:mga0n895_10821_c1 3300050512 Bacteria 8096
542 nmdc:mga0n895_109_c1 3300050512 Bacteria 48376
543 nmdc:mga0n895_28503_c1 3300050512 Bacteria 5312
544 nmdc:mga0n895_288842_c1 3300050512 Bacteria 1663
545 nmdc:mga0n895_433223_c1 3300050512 Bacteria 1328
546 nmdc:mga0n895_9600_c1 3300050512 Bacteria 8477
547 nmdc:mga0rr50_14747_c1 3300050513 Bacteria 5138
548 nmdc:mga0rr50_16769_c1 3300050513 Bacteria 4875
549 nmdc:mga0rr50_30951_c1 3300050513 Bacteria 3794
550 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
551 nmdc:mga0rr50_854_c1 3300050513 Bacteria 16404
552 nmdc:mga0rr50_86730_c1 3300050513 Bacteria 2429
553 nmdc:mga0rr50_88832_c1 3300050513 Bacteria 2402
554 nmdc:mga08x19_171241_c1 3300050514 Unclassified 1479
555 nmdc:mga08x19_213714_c1 3300050514 Unclassified 1324
556 nmdc:mga08x19_223_c1 3300050514 Bacteria 43405
557 nmdc:mga0a205_142551_c1 3300050515 Unclassified 2296
558 nmdc:mga0a205_17134_c1 3300050515 Bacteria 6785
559 nmdc:mga0a205_182418_c1 3300050515 Bacteria 1993
560 nmdc:mga0a205_21641_c1 3300050515 Bacteria 6080
561 nmdc:mga0a205_30017_c1 3300050515 Bacteria 5204
562 nmdc:mga0a205_8291_c1 3300050515 Bacteria 7789
563 Ga0495601_0031465 3300053077 Bacteria 3298
564 Ga0495619_0000386 3300053085 Bacteria 30136
565 Ga0495619_0056059 3300053085 Bacteria 2612
566 Ga0495619_0084210 3300053085 Bacteria 2146
567 Ga0495619_0095766 3300053085 Bacteria 2014
568 Ga0495619_0192308 3300053085 Bacteria 1412
569 Ga0501084_0000346 3300054114 Bacteria 35396
570 Ga0501084_0002305 3300054114 Bacteria 15326
571 Ga0501084_0137268 3300054114 Bacteria 2059
572 Ga0501084_0243477 3300054114 Bacteria 1518
573 Ga0501082_0000478 3300060353 Bacteria 35347
574 Ga0501082_0003011 3300060353 Bacteria 14718
575 Ga0501082_0059512 3300060353 Bacteria 3292
576 Ga0530510_0000008 3300061734 Bacteria 165671
577 Ga0530510_0012277 3300061734 Bacteria 6013
578 Ga0530510_0055103 3300061734 Bacteria 2873
579 Ga0530510_0105479 3300061734 Bacteria 2062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0317150 Ga0496103_0317150_14_865 272
2 3300049575 Ga0501039_0430350 Ga0501039_0430350_154_1005 272
3 3300049591 Ga0501075_0388230 Ga0501075_0388230_50_901 272
4 3300046529 Ga0495652_0070942 Ga0495652_0070942_2015_2884 278
5 3300048916 Ga0496113_0171179 Ga0496113_0171179_17_901 283
6 3300047471 Ga0495684_0241053 Ga0495684_0241053_402_1298 287
7 3300050513 nmdc:mga0rr50_88832_c1 nmdc:mga0rr50_88832_c1_1487_2383 287
8 3300050515 nmdc:mga0a205_21641_c1 nmdc:mga0a205_21641_c1_1860_2756 287
9 3300049572 Ga0501036_0112273 Ga0501036_0112273_802_1806 314
10 3300049587 Ga0501071_0041095 Ga0501071_0041095_11_991 315
11 3300005340 Ga0070689_100021368 Ga0070689_1000213683 317
12 3300005353 Ga0070669_100039142 Ga0070669_1000391423 317
13 3300005354 Ga0070675_100008775 Ga0070675_1000087752 317
14 3300005364 Ga0070673_100085387 Ga0070673_1000853872 317
15 3300005366 Ga0070659_100137759 Ga0070659_1001377591 317
16 3300005617 Ga0068859_100119466 Ga0068859_1001194662 317
17 3300005840 Ga0068870_10045533 Ga0068870_100455332 317
18 3300006931 Ga0097620_100119467 Ga0097620_1001194673 317
19 3300013308 Ga0157375_10006579 Ga0157375_100065795 317
20 3300025908 Ga0207643_10004664 Ga0207643_100046646 317
21 3300025923 Ga0207681_10013108 Ga0207681_100131083 317
22 3300025926 Ga0207659_10018690 Ga0207659_100186904 317
23 3300025936 Ga0207670_10147916 Ga0207670_101479162 317
24 3300025940 Ga0207691_10031489 Ga0207691_100314893 317
25 3300026035 Ga0207703_10264422 Ga0207703_102644222 317
26 3300005331 Ga0070670_100040642 Ga0070670_1000406421 318
27 3300005365 Ga0070688_100076546 Ga0070688_1000765462 318
28 3300005564 Ga0070664_100034520 Ga0070664_1000345202 318
29 3300005564 Ga0070664_100058214 Ga0070664_1000582142 318
30 3300006173 Ga0070716_100213596 Ga0070716_1002135961 318
31 3300011119 Ga0105246_10127519 Ga0105246_101275192 318
32 3300026116 Ga0207674_10004766 Ga0207674_1000476611 318
33 3300028380 Ga0268265_10187295 Ga0268265_101872952 318
34 3300048907 Ga0496104_0115190 Ga0496104_0115190_238_1263 318
35 3300048915 Ga0496112_0218517 Ga0496112_0218517_692_1717 318
36 3300049572 Ga0501036_0002948 Ga0501036_0002948_9500_10522 319
37 3300049574 Ga0501038_0001025 Ga0501038_0001025_4496_5518 319
38 3300049575 Ga0501039_0091975 Ga0501039_0091975_331_1353 319
39 3300049576 Ga0501040_0018766 Ga0501040_0018766_1876_2898 319
40 3300049577 Ga0501041_0013354 Ga0501041_0013354_3796_4818 319
41 3300049578 Ga0501042_0000828 Ga0501042_0000828_11005_12027 319
42 3300049580 Ga0501046_0040700 Ga0501046_0040700_2350_3372 319
43 3300049582 Ga0501048_0024598 Ga0501048_0024598_2296_3318 319
44 3300049587 Ga0501071_0031766 Ga0501071_0031766_2064_3086 319
45 3300049588 Ga0501072_0007595 Ga0501072_0007595_984_2006 319
46 3300049589 Ga0501073_0070236 Ga0501073_0070236_364_1386 319
47 3300049591 Ga0501075_0000003 Ga0501075_0000003_38282_39304 319
48 3300049592 Ga0501076_0000010 Ga0501076_0000010_83072_84094 319
49 3300049741 Ga0501079_0015793 Ga0501079_0015793_4398_5420 319
50 3300049742 Ga0501080_0081502 Ga0501080_0081502_1236_2258 319
51 3300049743 Ga0501081_0009377 Ga0501081_0009377_2239_3261 319
52 3300049822 Ga0501035_0013314 Ga0501035_0013314_4127_5149 319
53 3300054114 Ga0501084_0002305 Ga0501084_0002305_12411_13433 319
54 3300060353 Ga0501082_0000478 Ga0501082_0000478_27050_28072 319
55 3300061734 Ga0530510_0000008 Ga0530510_0000008_50300_51322 319
56 3300009148 Ga0105243_10431708 Ga0105243_104317081 320
57 3300025933 Ga0207706_10021540 Ga0207706_100215404 320
58 3300032002 Ga0307416_100123914 Ga0307416_1001239142 320
59 3300035119 Ga0373956_0010188 Ga0373956_0010188_2447_3445 320
60 3300035172 Ga0373955_0001279 Ga0373955_0001279_6068_7066 320
61 3300035724 Ga0373933_0004986 Ga0373933_0004986_5950_6948 320
62 3300036401 Ga0373937_0000210 Ga0373937_0000210_40130_41128 320
63 3300005353 Ga0070669_100024660 Ga0070669_1000246603 321
64 3300005354 Ga0070675_100000256 Ga0070675_10000025632 321
65 3300005438 Ga0070701_10017833 Ga0070701_100178332 321
66 3300005440 Ga0070705_100004058 Ga0070705_1000040586 321
67 3300005441 Ga0070700_100010064 Ga0070700_1000100643 321
68 3300005530 Ga0070679_100178988 Ga0070679_1001789882 321
69 3300005578 Ga0068854_100120682 Ga0068854_1001206821 321
70 3300005615 Ga0070702_100006255 Ga0070702_1000062556 321
71 3300005719 Ga0068861_100004175 Ga0068861_1000041756 321
72 3300009148 Ga0105243_10035229 Ga0105243_100352292 321
73 3300009176 Ga0105242_10231270 Ga0105242_102312702 321
74 3300025908 Ga0207643_10063975 Ga0207643_100639752 321
75 3300025923 Ga0207681_10010583 Ga0207681_100105836 321
76 3300025926 Ga0207659_10004455 Ga0207659_100044551 321
77 3300025934 Ga0207686_10113387 Ga0207686_101133872 321
78 3300025935 Ga0207709_10031521 Ga0207709_100315216 321
79 3300025981 Ga0207640_10021110 Ga0207640_100211102 321
80 3300026075 Ga0207708_10002255 Ga0207708_100022556 321
81 3300026118 Ga0207675_100001401 Ga0207675_10000140122 321
82 3300031691 Ga0316579_10010213 Ga0316579_100102133 321
83 3300031691 Ga0316579_10011221 Ga0316579_100112212 321
84 3300032133 Ga0316583_10017769 Ga0316583_100177694 321
85 3300047447 Ga0495685_003696 Ga0495685_003696_3621_4661 321
86 3300005293 Ga0065715_10033993 Ga0065715_100339932 323
87 3300005295 Ga0065707_10030388 Ga0065707_100303882 323
88 3300005328 Ga0070676_10093764 Ga0070676_100937641 323
89 3300005347 Ga0070668_100006035 Ga0070668_1000060359 323
90 3300005356 Ga0070674_100374590 Ga0070674_1003745901 323
91 3300005844 Ga0068862_100057330 Ga0068862_1000573303 323
92 3300025901 Ga0207688_10172915 Ga0207688_101729152 323
93 3300025926 Ga0207659_10037105 Ga0207659_100371052 323
94 3300025937 Ga0207669_10137261 Ga0207669_101372611 323
95 3300025972 Ga0207668_10045397 Ga0207668_100453972 323
96 3300005366 Ga0070659_100037950 Ga0070659_1000379504 324
97 3300005530 Ga0070679_100044360 Ga0070679_1000443605 324
98 3300025912 Ga0207707_10017266 Ga0207707_100172668 324
99 3300032005 Ga0307411_10005010 Ga0307411_100050105 324
100 3300049573 Ga0501037_0173505 Ga0501037_0173505_134_1141 324
101 3300049574 Ga0501038_0112085 Ga0501038_0112085_995_2002 324
102 3300049581 Ga0501047_0003215 Ga0501047_0003215_3307_4314 324
103 3300049586 Ga0501070_0238676 Ga0501070_0238676_109_1116 324
104 3300049823 Ga0501044_0005224 Ga0501044_0005224_3285_4292 324
105 3300005327 Ga0070658_10105552 Ga0070658_101055522 325
106 3300005347 Ga0070668_100198499 Ga0070668_1001984991 325
107 3300031824 Ga0307413_10104416 Ga0307413_101044162 325
108 3300031903 Ga0307407_10090753 Ga0307407_100907532 325
109 3300006914 Ga0075436_100138041 Ga0075436_1001380412 326
110 3300005329 Ga0070683_100161076 Ga0070683_1001610762 327
111 3300005444 Ga0070694_100007550 Ga0070694_1000075508 327
112 3300005445 Ga0070708_100205141 Ga0070708_1002051413 327
113 3300005468 Ga0070707_100188660 Ga0070707_1001886602 327
114 3300005471 Ga0070698_100273144 Ga0070698_1002731442 327
115 3300005536 Ga0070697_100089167 Ga0070697_1000891672 327
116 3300005549 Ga0070704_100102472 Ga0070704_1001024721 327
117 3300005937 Ga0081455_10110296 Ga0081455_101102962 327
118 3300006852 Ga0075433_10011248 Ga0075433_100112485 327
119 3300006871 Ga0075434_100182270 Ga0075434_1001822702 327
120 3300006871 Ga0075434_100354379 Ga0075434_1003543792 327
121 3300006914 Ga0075436_100188874 Ga0075436_1001888742 327
122 3300007076 Ga0075435_100006354 Ga0075435_1000063543 327
123 3300007076 Ga0075435_100012127 Ga0075435_1000121276 327
124 3300007076 Ga0075435_100050103 Ga0075435_1000501034 327
125 3300009147 Ga0114129_10010707 Ga0114129_1001070713 327
126 3300009147 Ga0114129_10100822 Ga0114129_101008227 327
127 3300025922 Ga0207646_10381570 Ga0207646_103815701 327
128 3300032002 Ga0307416_100347486 Ga0307416_1003474862 327
129 3300050507 nmdc:mga05p37_1909_c1 nmdc:mga05p37_1909_c1_16524_17540 327
130 3300050507 nmdc:mga05p37_301613_c1 nmdc:mga05p37_301613_c1_334_1350 327
131 3300050507 nmdc:mga05p37_430504_c1 nmdc:mga05p37_430504_c1_405_1421 327
132 3300050507 nmdc:mga05p37_8400_c1 nmdc:mga05p37_8400_c1_1444_2460 327
133 3300050512 nmdc:mga0n895_28503_c1 nmdc:mga0n895_28503_c1_2802_3818 327
134 3300050512 nmdc:mga0n895_9600_c1 nmdc:mga0n895_9600_c1_5678_6694 327
135 3300050513 nmdc:mga0rr50_14747_c1 nmdc:mga0rr50_14747_c1_630_1646 327
136 3300050513 nmdc:mga0rr50_30951_c1 nmdc:mga0rr50_30951_c1_1431_2447 327
137 3300050514 nmdc:mga08x19_171241_c1 nmdc:mga08x19_171241_c1_344_1360 327
138 3300050515 nmdc:mga0a205_142551_c1 nmdc:mga0a205_142551_c1_828_1844 327
139 3300050515 nmdc:mga0a205_30017_c1 nmdc:mga0a205_30017_c1_3582_4598 327
140 3300005544 Ga0070686_100051969 Ga0070686_1000519692 328
141 3300005844 Ga0068862_100320323 Ga0068862_1003203232 328
142 3300009094 Ga0111539_10243676 Ga0111539_102436762 328
143 3300009147 Ga0114129_10000439 Ga0114129_1000043916 328
144 3300009177 Ga0105248_10421617 Ga0105248_104216172 328
145 3300009553 Ga0105249_10091055 Ga0105249_100910552 328
146 3300009553 Ga0105249_10097553 Ga0105249_100975532 328
147 3300025933 Ga0207706_10056313 Ga0207706_100563134 328
148 3300025961 Ga0207712_10187111 Ga0207712_101871112 328
149 3300025961 Ga0207712_10193501 Ga0207712_101935012 328
150 3300026067 Ga0207678_10194051 Ga0207678_101940512 328
151 3300031728 Ga0316578_10075316 Ga0316578_100753162 328
152 3300032133 Ga0316583_10026499 Ga0316583_100264991 328
153 3300036647 Ga0316582_0026150 Ga0316582_0026150_2291_3322 328
154 3300037588 Ga0316581_0000512 Ga0316581_0000512_430_1461 328
155 3300042004 Ga0439445_0039060 Ga0439445_0039060_79_1098 328
156 3300049568 Ga0501031_0005593 Ga0501031_0005593_2211_3233 328
157 3300049568 Ga0501031_0145881 Ga0501031_0145881_367_1389 328
158 3300049569 Ga0501032_0083230 Ga0501032_0083230_190_1212 328
159 3300049570 Ga0501033_0016324 Ga0501033_0016324_2225_3247 328
160 3300049572 Ga0501036_0005831 Ga0501036_0005831_6845_7867 328
161 3300049573 Ga0501037_0026224 Ga0501037_0026224_158_1180 328
162 3300049573 Ga0501037_0073237 Ga0501037_0073237_105_1127 328
163 3300049574 Ga0501038_0003218 Ga0501038_0003218_5429_6451 328
164 3300049574 Ga0501038_0078099 Ga0501038_0078099_846_1868 328
165 3300049575 Ga0501039_0008312 Ga0501039_0008312_2387_3409 328
166 3300049575 Ga0501039_0148710 Ga0501039_0148710_536_1558 328
167 3300049576 Ga0501040_0000631 Ga0501040_0000631_16274_17296 328
168 3300049577 Ga0501041_0000459 Ga0501041_0000459_1494_2516 328
169 3300049577 Ga0501041_0004935 Ga0501041_0004935_868_1890 328
170 3300049577 Ga0501041_0038827 Ga0501041_0038827_641_1663 328
171 3300049578 Ga0501042_0004651 Ga0501042_0004651_3656_4678 328
172 3300049578 Ga0501042_0039701 Ga0501042_0039701_892_1914 328
173 3300049579 Ga0501043_0006508 Ga0501043_0006508_1753_2775 328
174 3300049579 Ga0501043_0141264 Ga0501043_0141264_825_1847 328
175 3300049580 Ga0501046_0007522 Ga0501046_0007522_4454_5476 328
176 3300049580 Ga0501046_0041902 Ga0501046_0041902_2467_3489 328
177 3300049580 Ga0501046_0048819 Ga0501046_0048819_18_1040 328
178 3300049580 Ga0501046_0116686 Ga0501046_0116686_270_1292 328
179 3300049582 Ga0501048_0000457 Ga0501048_0000457_12089_13111 328
180 3300049582 Ga0501048_0026787 Ga0501048_0026787_1468_2490 328
181 3300049584 Ga0501068_0027408 Ga0501068_0027408_241_1263 328
182 3300049585 Ga0501069_0089445 Ga0501069_0089445_603_1625 328
183 3300049586 Ga0501070_0021522 Ga0501070_0021522_3326_4348 328
184 3300049587 Ga0501071_0000456 Ga0501071_0000456_6899_7921 328
185 3300049588 Ga0501072_0001602 Ga0501072_0001602_4336_5358 328
186 3300049590 Ga0501074_0002370 Ga0501074_0002370_3364_4386 328
187 3300049591 Ga0501075_0017229 Ga0501075_0017229_351_1373 328
188 3300049592 Ga0501076_0008443 Ga0501076_0008443_3597_4619 328
189 3300049592 Ga0501076_0014040 Ga0501076_0014040_4648_5670 328
190 3300049593 Ga0501077_0000456 Ga0501077_0000456_6198_7220 328
191 3300049741 Ga0501079_0000036 Ga0501079_0000036_51685_52707 328
192 3300049742 Ga0501080_0000401 Ga0501080_0000401_23003_24025 328
193 3300049742 Ga0501080_0176997 Ga0501080_0176997_50_1072 328
194 3300049743 Ga0501081_0000154 Ga0501081_0000154_30191_31213 328
195 3300049743 Ga0501081_0017789 Ga0501081_0017789_2380_3402 328
196 3300049744 Ga0501083_0029962 Ga0501083_0029962_400_1422 328
197 3300049824 Ga0501045_0000013 Ga0501045_0000013_16889_17911 328
198 3300049824 Ga0501045_0024004 Ga0501045_0024004_2713_3735 328
199 3300049824 Ga0501045_0098670 Ga0501045_0098670_1066_2088 328
200 3300050507 nmdc:mga05p37_612_c1 nmdc:mga05p37_612_c1_2850_3872 328
201 3300050508 nmdc:mga09592_392492_c1 nmdc:mga09592_392492_c1_30_1067 328
202 3300050510 nmdc:mga06r32_558328_c1 nmdc:mga06r32_558328_c1_27_1049 328
203 3300054114 Ga0501084_0000346 Ga0501084_0000346_29798_30820 328
204 3300060353 Ga0501082_0003011 Ga0501082_0003011_12191_13213 328
205 3300060353 Ga0501082_0059512 Ga0501082_0059512_1331_2353 328
206 3300061734 Ga0530510_0012277 Ga0530510_0012277_447_1469 328
207 3300061734 Ga0530510_0055103 Ga0530510_0055103_784_1806 328
208 3300061734 Ga0530510_0105479 Ga0530510_0105479_279_1301 328
209 3300005334 Ga0068869_100111935 Ga0068869_1001119352 329
210 3300005338 Ga0068868_100101883 Ga0068868_1001018834 329
211 3300005338 Ga0068868_100163478 Ga0068868_1001634781 329
212 3300005445 Ga0070708_100029777 Ga0070708_1000297772 329
213 3300005456 Ga0070678_100161066 Ga0070678_1001610663 329
214 3300005458 Ga0070681_10063568 Ga0070681_100635682 329
215 3300005466 Ga0070685_10075745 Ga0070685_100757453 329
216 3300005530 Ga0070679_100041452 Ga0070679_1000414526 329
217 3300005548 Ga0070665_100013758 Ga0070665_1000137589 329
218 3300005578 Ga0068854_100282575 Ga0068854_1002825751 329
219 3300005614 Ga0068856_100025230 Ga0068856_1000252302 329
220 3300005617 Ga0068859_100226449 Ga0068859_1002264492 329
221 3300005842 Ga0068858_100043977 Ga0068858_1000439773 329
222 3300005937 Ga0081455_10000595 Ga0081455_1000059537 329
223 3300005985 Ga0081539_10005962 Ga0081539_100059624 329
224 3300006237 Ga0097621_100065021 Ga0097621_1000650214 329
225 3300006871 Ga0075434_100078329 Ga0075434_1000783292 329
226 3300006881 Ga0068865_100206648 Ga0068865_1002066482 329
227 3300006931 Ga0097620_100226470 Ga0097620_1002264702 329
228 3300007265 Ga0099794_10011557 Ga0099794_100115574 329
229 3300009101 Ga0105247_10007622 Ga0105247_100076225 329
230 3300009176 Ga0105242_10001388 Ga0105242_100013883 329
231 3300009176 Ga0105242_10010963 Ga0105242_100109639 329
232 3300009177 Ga0105248_10063608 Ga0105248_100636086 329
233 3300009177 Ga0105248_10182935 Ga0105248_101829355 329
234 3300009177 Ga0105248_10288067 Ga0105248_102880672 329
235 3300009551 Ga0105238_10198736 Ga0105238_101987362 329
236 3300011119 Ga0105246_10323533 Ga0105246_103235332 329
237 3300013104 Ga0157370_10067180 Ga0157370_100671806 329
238 3300013296 Ga0157374_10110160 Ga0157374_101101602 329
239 3300013306 Ga0163162_10167061 Ga0163162_101670612 329
240 3300013307 Ga0157372_10127466 Ga0157372_101274666 329
241 3300014325 Ga0163163_10054508 Ga0163163_100545082 329
242 3300014325 Ga0163163_10077485 Ga0163163_100774853 329
243 3300014968 Ga0157379_10051051 Ga0157379_100510512 329
244 3300014968 Ga0157379_10198866 Ga0157379_101988662 329
245 3300014968 Ga0157379_10355681 Ga0157379_103556812 329
246 3300025912 Ga0207707_10153738 Ga0207707_101537382 329
247 3300025915 Ga0207693_10016421 Ga0207693_100164214 329
248 3300025922 Ga0207646_10161465 Ga0207646_101614652 329
249 3300025927 Ga0207687_10246661 Ga0207687_102466611 329
250 3300025928 Ga0207700_10065019 Ga0207700_100650192 329
251 3300025929 Ga0207664_10178938 Ga0207664_101789382 329
252 3300025934 Ga0207686_10050511 Ga0207686_100505114 329
253 3300025934 Ga0207686_10345806 Ga0207686_103458062 329
254 3300025936 Ga0207670_10070208 Ga0207670_100702083 329
255 3300025938 Ga0207704_10008815 Ga0207704_100088155 329
256 3300025938 Ga0207704_10120393 Ga0207704_101203932 329
257 3300025941 Ga0207711_10017848 Ga0207711_100178486 329
258 3300025941 Ga0207711_10158468 Ga0207711_101584682 329
259 3300025942 Ga0207689_10073162 Ga0207689_100731622 329
260 3300025949 Ga0207667_10347968 Ga0207667_103479682 329
261 3300025981 Ga0207640_10327768 Ga0207640_103277681 329
262 3300026023 Ga0207677_10112531 Ga0207677_101125314 329
263 3300026023 Ga0207677_10185112 Ga0207677_101851122 329
264 3300026035 Ga0207703_10006395 Ga0207703_100063959 329
265 3300026078 Ga0207702_10013654 Ga0207702_100136547 329
266 3300026095 Ga0207676_10155207 Ga0207676_101552074 329
267 3300026121 Ga0207683_10082135 Ga0207683_100821354 329
268 3300035086 Ga0373934_0057956 Ga0373934_0057956_348_1376 329
269 3300035111 Ga0373923_0021261 Ga0373923_0021261_1096_2136 329
270 3300035117 Ga0373953_0009362 Ga0373953_0009362_319_1359 329
271 3300035118 Ga0373954_0046233 Ga0373954_0046233_714_1754 329
272 3300035724 Ga0373933_0008600 Ga0373933_0008600_859_1899 329
273 3300036401 Ga0373937_0020132 Ga0373937_0020132_1424_2464 329
274 3300039447 Ga0436361_0447444 Ga0436361_0447444_391_1422 329
275 3300046455 Ga0495603_0043876 Ga0495603_0043876_1335_2363 329
276 3300046459 Ga0495629_0108426 Ga0495629_0108426_19_1047 329
277 3300046536 Ga0495587_0071109 Ga0495587_0071109_899_1927 329
278 3300046543 Ga0495645_0052667 Ga0495645_0052667_1477_2505 329
279 3300046678 Ga0495599_0139367 Ga0495599_0139367_293_1321 329
280 3300046809 Ga0495600_0127892 Ga0495600_0127892_107_1135 329
281 3300047319 Ga0495674_0150787 Ga0495674_0150787_750_1778 329
282 3300047471 Ga0495684_0037392 Ga0495684_0037392_1016_2044 329
283 3300048905 Ga0496102_0100543 Ga0496102_0100543_135_1163 329
284 3300048913 Ga0496110_0019709 Ga0496110_0019709_4042_5073 329
285 3300048915 Ga0496112_0063101 Ga0496112_0063101_1472_2500 329
286 3300048915 Ga0496112_0383600 Ga0496112_0383600_151_1182 329
287 3300048917 Ga0496114_0083664 Ga0496114_0083664_140_1168 329
288 3300050507 nmdc:mga05p37_130393_c1 nmdc:mga05p37_130393_c1_1564_2586 329
289 3300050507 nmdc:mga05p37_369694_c1 nmdc:mga05p37_369694_c1_257_1306 329
290 3300050507 nmdc:mga05p37_660749_c1 nmdc:mga05p37_660749_c1_49_1077 329
291 3300053077 Ga0495601_0031465 Ga0495601_0031465_549_1577 329
292 3300053085 Ga0495619_0056059 Ga0495619_0056059_752_1792 329
293 3300053085 Ga0495619_0095766 Ga0495619_0095766_392_1420 329
294 3300002459 JGI24751J29686_10013682 JGI24751J29686_100136822 330
295 3300005290 Ga0065712_10134007 Ga0065712_101340071 330
296 3300005293 Ga0065715_10130434 Ga0065715_101304343 330
297 3300005295 Ga0065707_10120618 Ga0065707_101206182 330
298 3300005327 Ga0070658_10115166 Ga0070658_101151663 330
299 3300005329 Ga0070683_100149022 Ga0070683_1001490222 330
300 3300005330 Ga0070690_100007110 Ga0070690_1000071102 330
301 3300005330 Ga0070690_100270778 Ga0070690_1002707781 330
302 3300005331 Ga0070670_100163564 Ga0070670_1001635642 330
303 3300005334 Ga0068869_100075344 Ga0068869_1000753442 330
304 3300005334 Ga0068869_100188476 Ga0068869_1001884763 330
305 3300005343 Ga0070687_100006502 Ga0070687_1000065022 330
306 3300005347 Ga0070668_100041732 Ga0070668_1000417326 330
307 3300005353 Ga0070669_100108023 Ga0070669_1001080232 330
308 3300005354 Ga0070675_100056873 Ga0070675_1000568733 330
309 3300005355 Ga0070671_100053574 Ga0070671_1000535742 330
310 3300005355 Ga0070671_100173649 Ga0070671_1001736492 330
311 3300005356 Ga0070674_100002747 Ga0070674_1000027475 330
312 3300005364 Ga0070673_100158610 Ga0070673_1001586102 330
313 3300005364 Ga0070673_100162773 Ga0070673_1001627733 330
314 3300005364 Ga0070673_100336881 Ga0070673_1003368812 330
315 3300005367 Ga0070667_100018119 Ga0070667_1000181195 330
316 3300005435 Ga0070714_100025703 Ga0070714_1000257036 330
317 3300005438 Ga0070701_10094864 Ga0070701_100948642 330
318 3300005439 Ga0070711_100245135 Ga0070711_1002451352 330
319 3300005440 Ga0070705_100017483 Ga0070705_1000174832 330
320 3300005444 Ga0070694_100225723 Ga0070694_1002257232 330
321 3300005445 Ga0070708_100224280 Ga0070708_1002242803 330
322 3300005458 Ga0070681_10156354 Ga0070681_101563542 330
323 3300005459 Ga0068867_100110622 Ga0068867_1001106222 330
324 3300005459 Ga0068867_100216916 Ga0068867_1002169162 330
325 3300005468 Ga0070707_100449718 Ga0070707_1004497181 330
326 3300005471 Ga0070698_100057446 Ga0070698_1000574466 330
327 3300005471 Ga0070698_100062739 Ga0070698_1000627393 330
328 3300005518 Ga0070699_100002968 Ga0070699_10000296814 330
329 3300005518 Ga0070699_100434172 Ga0070699_1004341721 330
330 3300005530 Ga0070679_100044090 Ga0070679_1000440905 330
331 3300005536 Ga0070697_100037644 Ga0070697_1000376443 330
332 3300005543 Ga0070672_100042165 Ga0070672_1000421653 330
333 3300005543 Ga0070672_100075887 Ga0070672_1000758872 330
334 3300005543 Ga0070672_100133060 Ga0070672_1001330602 330
335 3300005544 Ga0070686_100001050 Ga0070686_1000010509 330
336 3300005544 Ga0070686_100125844 Ga0070686_1001258442 330
337 3300005544 Ga0070686_100223188 Ga0070686_1002231882 330
338 3300005546 Ga0070696_100024038 Ga0070696_1000240383 330
339 3300005547 Ga0070693_100119288 Ga0070693_1001192882 330
340 3300005548 Ga0070665_100027996 Ga0070665_1000279964 330
341 3300005548 Ga0070665_100247818 Ga0070665_1002478182 330
342 3300005563 Ga0068855_100005266 Ga0068855_1000052662 330
343 3300005578 Ga0068854_100086619 Ga0068854_1000866193 330
344 3300005614 Ga0068856_100166694 Ga0068856_1001666942 330
345 3300005616 Ga0068852_100352146 Ga0068852_1003521461 330
346 3300005718 Ga0068866_10015714 Ga0068866_100157143 330
347 3300005719 Ga0068861_100048699 Ga0068861_1000486994 330
348 3300005841 Ga0068863_100019394 Ga0068863_1000193944 330
349 3300005842 Ga0068858_100104259 Ga0068858_1001042592 330
350 3300005844 Ga0068862_100042083 Ga0068862_1000420832 330
351 3300005937 Ga0081455_10036780 Ga0081455_100367803 330
352 3300005985 Ga0081539_10026285 Ga0081539_100262856 330
353 3300006237 Ga0097621_100019461 Ga0097621_1000194614 330
354 3300006237 Ga0097621_100043532 Ga0097621_1000435322 330
355 3300006237 Ga0097621_100065569 Ga0097621_1000655692 330
356 3300006237 Ga0097621_100123007 Ga0097621_1001230074 330
357 3300006358 Ga0068871_100000257 Ga0068871_10000025726 330
358 3300006358 Ga0068871_100009412 Ga0068871_1000094128 330
359 3300006358 Ga0068871_100055101 Ga0068871_1000551016 330
360 3300006358 Ga0068871_100238557 Ga0068871_1002385572 330
361 3300006844 Ga0075428_100027444 Ga0075428_1000274444 330
362 3300006847 Ga0075431_100052269 Ga0075431_1000522695 330
363 3300006852 Ga0075433_10106986 Ga0075433_101069862 330
364 3300006852 Ga0075433_10209860 Ga0075433_102098602 330
365 3300006852 Ga0075433_10275779 Ga0075433_102757792 330
366 3300006871 Ga0075434_100000505 Ga0075434_10000050511 330
367 3300006871 Ga0075434_100057835 Ga0075434_1000578356 330
368 3300006871 Ga0075434_100076867 Ga0075434_1000768677 330
369 3300006871 Ga0075434_100571832 Ga0075434_1005718322 330
370 3300006881 Ga0068865_100057798 Ga0068865_1000577982 330
371 3300006914 Ga0075436_100001003 Ga0075436_10000100316 330
372 3300007076 Ga0075435_100000129 Ga0075435_10000012925 330
373 3300007076 Ga0075435_100000566 Ga0075435_10000056621 330
374 3300007076 Ga0075435_100057273 Ga0075435_1000572733 330
375 3300007076 Ga0075435_100195798 Ga0075435_1001957982 330
376 3300009093 Ga0105240_10033599 Ga0105240_100335992 330
377 3300009094 Ga0111539_10002365 Ga0111539_1000236514 330
378 3300009094 Ga0111539_10003171 Ga0111539_1000317123 330
379 3300009094 Ga0111539_10007274 Ga0111539_1000727411 330
380 3300009094 Ga0111539_10181571 Ga0111539_101815714 330
381 3300009098 Ga0105245_10008629 Ga0105245_100086295 330
382 3300009098 Ga0105245_10187029 Ga0105245_101870292 330
383 3300009098 Ga0105245_10450225 Ga0105245_104502252 330
384 3300009101 Ga0105247_10036543 Ga0105247_100365432 330
385 3300009147 Ga0114129_10013248 Ga0114129_100132487 330
386 3300009147 Ga0114129_10014568 Ga0114129_1001456812 330
387 3300009147 Ga0114129_10018443 Ga0114129_100184436 330
388 3300009147 Ga0114129_10039931 Ga0114129_100399316 330
389 3300009147 Ga0114129_10077515 Ga0114129_100775152 330
390 3300009147 Ga0114129_10147239 Ga0114129_101472392 330
391 3300009147 Ga0114129_10321143 Ga0114129_103211432 330
392 3300009148 Ga0105243_10029793 Ga0105243_100297936 330
393 3300009148 Ga0105243_10077862 Ga0105243_100778623 330
394 3300009176 Ga0105242_10064388 Ga0105242_100643882 330
395 3300009176 Ga0105242_10201705 Ga0105242_102017052 330
396 3300009176 Ga0105242_10207939 Ga0105242_102079392 330
397 3300009177 Ga0105248_10007970 Ga0105248_1000797013 330
398 3300009177 Ga0105248_10066495 Ga0105248_100664952 330
399 3300009177 Ga0105248_10111119 Ga0105248_101111192 330
400 3300009551 Ga0105238_10156320 Ga0105238_101563203 330
401 3300009551 Ga0105238_10219299 Ga0105238_102192992 330
402 3300009551 Ga0105238_10275983 Ga0105238_102759833 330
403 3300009551 Ga0105238_10475197 Ga0105238_104751971 330
404 3300009553 Ga0105249_10104055 Ga0105249_101040555 330
405 3300009553 Ga0105249_10238917 Ga0105249_102389173 330
406 3300013296 Ga0157374_10046981 Ga0157374_100469813 330
407 3300013296 Ga0157374_10206483 Ga0157374_102064832 330
408 3300013297 Ga0157378_10010006 Ga0157378_100100066 330
409 3300013306 Ga0163162_10017441 Ga0163162_100174416 330
410 3300013308 Ga0157375_10028737 Ga0157375_100287372 330
411 3300013308 Ga0157375_10076966 Ga0157375_100769665 330
412 3300014325 Ga0163163_10346141 Ga0163163_103461412 330
413 3300014326 Ga0157380_10180223 Ga0157380_101802231 330
414 3300014326 Ga0157380_10453198 Ga0157380_104531981 330
415 3300014968 Ga0157379_10014260 Ga0157379_100142609 330
416 3300014968 Ga0157379_10188502 Ga0157379_101885022 330
417 3300014969 Ga0157376_10009978 Ga0157376_100099786 330
418 3300014969 Ga0157376_10225477 Ga0157376_102254772 330
419 3300025907 Ga0207645_10164538 Ga0207645_101645382 330
420 3300025909 Ga0207705_10318199 Ga0207705_103181991 330
421 3300025913 Ga0207695_10285092 Ga0207695_102850921 330
422 3300025916 Ga0207663_10027459 Ga0207663_100274592 330
423 3300025917 Ga0207660_10069122 Ga0207660_100691222 330
424 3300025918 Ga0207662_10022501 Ga0207662_100225012 330
425 3300025918 Ga0207662_10035068 Ga0207662_100350682 330
426 3300025919 Ga0207657_10204554 Ga0207657_102045541 330
427 3300025922 Ga0207646_10190760 Ga0207646_101907603 330
428 3300025922 Ga0207646_10404892 Ga0207646_104048921 330
429 3300025923 Ga0207681_10003393 Ga0207681_100033936 330
430 3300025923 Ga0207681_10010897 Ga0207681_100108975 330
431 3300025925 Ga0207650_10076631 Ga0207650_100766312 330
432 3300025926 Ga0207659_10013061 Ga0207659_100130613 330
433 3300025927 Ga0207687_10008341 Ga0207687_100083414 330
434 3300025927 Ga0207687_10136987 Ga0207687_101369872 330
435 3300025929 Ga0207664_10129582 Ga0207664_101295824 330
436 3300025931 Ga0207644_10075221 Ga0207644_100752212 330
437 3300025931 Ga0207644_10183329 Ga0207644_101833292 330
438 3300025932 Ga0207690_10114799 Ga0207690_101147992 330
439 3300025933 Ga0207706_10090392 Ga0207706_100903922 330
440 3300025934 Ga0207686_10020028 Ga0207686_100200282 330
441 3300025934 Ga0207686_10055295 Ga0207686_100552954 330
442 3300025935 Ga0207709_10033191 Ga0207709_100331912 330
443 3300025937 Ga0207669_10073065 Ga0207669_100730653 330
444 3300025938 Ga0207704_10159231 Ga0207704_101592312 330
445 3300025940 Ga0207691_10018759 Ga0207691_100187593 330
446 3300025940 Ga0207691_10067944 Ga0207691_100679445 330
447 3300025941 Ga0207711_10033193 Ga0207711_100331936 330
448 3300025941 Ga0207711_10041355 Ga0207711_100413552 330
449 3300025941 Ga0207711_10051578 Ga0207711_100515785 330
450 3300025941 Ga0207711_10072865 Ga0207711_100728653 330
451 3300025941 Ga0207711_10132035 Ga0207711_101320353 330
452 3300025941 Ga0207711_10242326 Ga0207711_102423261 330
453 3300025941 Ga0207711_10268784 Ga0207711_102687842 330
454 3300025941 Ga0207711_10327508 Ga0207711_103275082 330
455 3300025942 Ga0207689_10135440 Ga0207689_101354402 330
456 3300025949 Ga0207667_10194849 Ga0207667_101948492 330
457 3300025960 Ga0207651_10031764 Ga0207651_100317644 330
458 3300025960 Ga0207651_10045123 Ga0207651_100451233 330
459 3300025960 Ga0207651_10075632 Ga0207651_100756323 330
460 3300025960 Ga0207651_10102928 Ga0207651_101029282 330
461 3300025961 Ga0207712_10108654 Ga0207712_101086544 330
462 3300025981 Ga0207640_10066757 Ga0207640_100667571 330
463 3300026023 Ga0207677_10063745 Ga0207677_100637456 330
464 3300026023 Ga0207677_10364708 Ga0207677_103647082 330
465 3300026075 Ga0207708_10205024 Ga0207708_102050241 330
466 3300026088 Ga0207641_10002052 Ga0207641_1000205212 330
467 3300026089 Ga0207648_10017949 Ga0207648_100179497 330
468 3300026089 Ga0207648_10122124 Ga0207648_101221242 330
469 3300026095 Ga0207676_10024773 Ga0207676_100247732 330
470 3300026118 Ga0207675_100033630 Ga0207675_1000336304 330
471 3300026118 Ga0207675_100146764 Ga0207675_1001467643 330
472 3300026121 Ga0207683_10016232 Ga0207683_100162324 330
473 3300026121 Ga0207683_10048260 Ga0207683_100482602 330
474 3300026142 Ga0207698_10402175 Ga0207698_104021751 330
475 3300027907 Ga0207428_10008381 Ga0207428_100083812 330
476 3300027907 Ga0207428_10063871 Ga0207428_100638713 330
477 3300027907 Ga0207428_10100382 Ga0207428_101003822 330
478 3300028380 Ga0268265_10004373 Ga0268265_100043738 330
479 3300028381 Ga0268264_10236750 Ga0268264_102367501 330
480 3300028381 Ga0268264_10304571 Ga0268264_103045712 330
481 3300031711 Ga0265314_10128755 Ga0265314_101287551 330
482 3300034816 Ga0373930_0001256 Ga0373930_0001256_2040_3071 330
483 3300034817 Ga0373948_0009817 Ga0373948_0009817_47_1078 330
484 3300034818 Ga0373950_0000367 Ga0373950_0000367_775_1806 330
485 3300034819 Ga0373958_0001193 Ga0373958_0001193_655_1686 330
486 3300034820 Ga0373959_0000325 Ga0373959_0000325_2920_3951 330
487 3300034957 Ga0373938_0000728 Ga0373938_0000728_3672_4703 330
488 3300035084 Ga0373928_0002071 Ga0373928_0002071_48_1079 330
489 3300035090 Ga0373949_0000664 Ga0373949_0000664_7063_8094 330
490 3300035091 Ga0373951_0000499 Ga0373951_0000499_4810_5841 330
491 3300035092 Ga0373952_0000347 Ga0373952_0000347_3845_4876 330
492 3300035112 Ga0373932_0001093 Ga0373932_0001093_3227_4258 330
493 3300035114 Ga0373939_0001459 Ga0373939_0001459_461_1492 330
494 3300035114 Ga0373939_0015662 Ga0373939_0015662_51_1082 330
495 3300035115 Ga0373941_0000172 Ga0373941_0000172_7039_8070 330
496 3300035121 Ga0373960_0000080 Ga0373960_0000080_5183_6214 330
497 3300035171 Ga0373946_0006371 Ga0373946_0006371_1633_2664 330
498 3300035172 Ga0373955_0096692 Ga0373955_0096692_484_1515 330
499 3300035172 Ga0373955_0184744 Ga0373955_0184744_189_1220 330
500 3300035207 Ga0373942_0000596 Ga0373942_0000596_3314_4345 330
501 3300035241 Ga0373961_0001275 Ga0373961_0001275_2312_3343 330
502 3300035241 Ga0373961_0011136 Ga0373961_0011136_320_1351 330
503 3300035242 Ga0373962_0000167 Ga0373962_0000167_3804_4835 330
504 3300035410 Ga0373924_0073962 Ga0373924_0073962_22_1053 330
505 3300035691 Ga0373931_0002352 Ga0373931_0002352_2877_3908 330
506 3300035724 Ga0373933_0145412 Ga0373933_0145412_426_1451 330
507 3300036401 Ga0373937_0149810 Ga0373937_0149810_520_1551 330
508 3300036401 Ga0373937_0232871 Ga0373937_0232871_100_1131 330
509 3300037068 Ga0373925_0041926 Ga0373925_0041926_1972_3003 330
510 3300037068 Ga0373925_0046485 Ga0373925_0046485_1946_2971 330
511 3300037068 Ga0373925_0275197 Ga0373925_0275197_214_1245 330
512 3300039437 Ga0436365_1916363 Ga0436365_1916363_165_1196 330
513 3300042436 Ga0439435_0004498 Ga0439435_0004498_674_1702 330
514 3300042530 Ga0450916_000365 Ga0450916_000365_976_2004 330
515 3300045051 Ga0451576_0013503 Ga0451576_0013503_2401_3432 330
516 3300046454 Ga0495592_0009245 Ga0495592_0009245_4722_5753 330
517 3300046455 Ga0495603_0044880 Ga0495603_0044880_1558_2589 330
518 3300046511 Ga0495608_0003468 Ga0495608_0003468_1875_2906 330
519 3300046511 Ga0495608_0155480 Ga0495608_0155480_285_1310 330
520 3300046514 Ga0495618_0168872 Ga0495618_0168872_81_1106 330
521 3300046516 Ga0495628_0109283 Ga0495628_0109283_217_1248 330
522 3300046516 Ga0495628_0134824 Ga0495628_0134824_736_1761 330
523 3300046517 Ga0495630_0232360 Ga0495630_0232360_195_1220 330
524 3300046533 Ga0495640_0195136 Ga0495640_0195136_224_1249 330
525 3300046536 Ga0495587_0052167 Ga0495587_0052167_368_1399 330
526 3300046642 Ga0495634_0047806 Ga0495634_0047806_1526_2557 330
527 3300046678 Ga0495599_0195844 Ga0495599_0195844_46_1077 330
528 3300046684 Ga0495669_0008713 Ga0495669_0008713_1414_2445 330
529 3300046684 Ga0495669_0104683 Ga0495669_0104683_258_1289 330
530 3300046809 Ga0495600_0055147 Ga0495600_0055147_994_2025 330
531 3300047317 Ga0495604_0039596 Ga0495604_0039596_1293_2324 330
532 3300047317 Ga0495604_0053185 Ga0495604_0053185_673_1698 330
533 3300047319 Ga0495674_0009481 Ga0495674_0009481_6695_7726 330
534 3300047319 Ga0495674_0134907 Ga0495674_0134907_292_1323 330
535 3300047322 Ga0495680_0115728 Ga0495680_0115728_371_1402 330
536 3300047444 Ga0495675_0054218 Ga0495675_0054218_164_1195 330
537 3300047471 Ga0495684_0000601 Ga0495684_0000601_5149_6180 330
538 3300048903 Ga0496100_0065825 Ga0496100_0065825_180_1211 330
539 3300048904 Ga0496101_0037485 Ga0496101_0037485_1769_2800 330
540 3300048907 Ga0496104_0225241 Ga0496104_0225241_487_1518 330
541 3300048909 Ga0496106_0231836 Ga0496106_0231836_193_1224 330
542 3300048912 Ga0496109_0291782 Ga0496109_0291782_151_1182 330
543 3300048913 Ga0496110_0018662 Ga0496110_0018662_2077_3102 330
544 3300048917 Ga0496114_0241570 Ga0496114_0241570_114_1145 330
545 3300049584 Ga0501068_0109091 Ga0501068_0109091_151_1182 330
546 3300049590 Ga0501074_0284170 Ga0501074_0284170_63_1115 330
547 3300049591 Ga0501075_0014251 Ga0501075_0014251_2817_3869 330
548 3300050507 nmdc:mga05p37_13531_c1 nmdc:mga05p37_13531_c1_7155_8186 330
549 3300050507 nmdc:mga05p37_139892_c1 nmdc:mga05p37_139892_c1_1392_2417 330
550 3300050507 nmdc:mga05p37_288831_c1 nmdc:mga05p37_288831_c1_456_1487 330
551 3300050507 nmdc:mga05p37_349481_c1 nmdc:mga05p37_349481_c1_211_1242 330
552 3300050507 nmdc:mga05p37_4985_c1 nmdc:mga05p37_4985_c1_2165_3196 330
553 3300050507 nmdc:mga05p37_6313_c1 nmdc:mga05p37_6313_c1_5608_6639 330
554 3300050507 nmdc:mga05p37_63822_c1 nmdc:mga05p37_63822_c1_1113_2144 330
555 3300050510 nmdc:mga06r32_436314_c1 nmdc:mga06r32_436314_c1_148_1176 330
556 3300050510 nmdc:mga06r32_79470_c1 nmdc:mga06r32_79470_c1_1597_2628 330
557 3300050511 nmdc:mga08y16_127368_c1 nmdc:mga08y16_127368_c1_1107_2138 330
558 3300050511 nmdc:mga08y16_16332_c1 nmdc:mga08y16_16332_c1_4948_5979 330
559 3300050511 nmdc:mga08y16_1959_c1 nmdc:mga08y16_1959_c1_18436_19467 330
560 3300050511 nmdc:mga08y16_23054_c1 nmdc:mga08y16_23054_c1_5188_6219 330
561 3300050511 nmdc:mga08y16_9897_c1 nmdc:mga08y16_9897_c1_6553_7584 330
562 3300050512 nmdc:mga0n895_10821_c1 nmdc:mga0n895_10821_c1_1609_2640 330
563 3300050512 nmdc:mga0n895_109_c1 nmdc:mga0n895_109_c1_26928_27959 330
564 3300050512 nmdc:mga0n895_288842_c1 nmdc:mga0n895_288842_c1_336_1367 330
565 3300050512 nmdc:mga0n895_433223_c1 nmdc:mga0n895_433223_c1_84_1115 330
566 3300050513 nmdc:mga0rr50_16769_c1 nmdc:mga0rr50_16769_c1_639_1664 330
567 3300050513 nmdc:mga0rr50_36_c1 nmdc:mga0rr50_36_c1_50659_51690 330
568 3300050513 nmdc:mga0rr50_854_c1 nmdc:mga0rr50_854_c1_11533_12564 330
569 3300050513 nmdc:mga0rr50_86730_c1 nmdc:mga0rr50_86730_c1_941_1972 330
570 3300050514 nmdc:mga08x19_213714_c1 nmdc:mga08x19_213714_c1_40_1071 330
571 3300050514 nmdc:mga08x19_223_c1 nmdc:mga08x19_223_c1_20725_21756 330
572 3300050515 nmdc:mga0a205_17134_c1 nmdc:mga0a205_17134_c1_217_1248 330
573 3300050515 nmdc:mga0a205_182418_c1 nmdc:mga0a205_182418_c1_758_1783 330
574 3300050515 nmdc:mga0a205_8291_c1 nmdc:mga0a205_8291_c1_824_1855 330
575 3300053085 Ga0495619_0000386 Ga0495619_0000386_14004_15035 330
576 3300053085 Ga0495619_0084210 Ga0495619_0084210_1007_2038 330
577 3300053085 Ga0495619_0192308 Ga0495619_0192308_268_1293 330
578 3300054114 Ga0501084_0137268 Ga0501084_0137268_68_1096 330
579 3300054114 Ga0501084_0243477 Ga0501084_0243477_122_1153 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

129

339

0.88

PF02655

ATP-grasp_3

ATP-grasp domain

120

313

0.8

PF08443

RimK

RimK-like ATP-grasp domain

120

243

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8777 4 323
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8691 4 323
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8515 4 323
3r5x-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8465 4 323
3r23-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from bacillus anthracis 0.8461 4 323
ID Description Score Start End Superfamily
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8956 102 322 3.40.50.20
af_P9WP31_235_360_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8746 198 315 3.30.470.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8635 195 321 3.30.470.20
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8621 102 322 3.40.50.20
2yzgC02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8585 107 322 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A353EST0-F1-model_v4 D-alanine--D-alanine ligase 0.9608 33 326 GO:0005524
GO:0008716
GO:0046872
AF-A0A524KLL9-F1-model_v4 D-alanine--D-alanine ligase 0.9583 1 328 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A532BWC4-F1-model_v4 ATP-grasp domain-containing protein 0.9549 193 326 GO:0005524
GO:0006520
GO:0008716
GO:0016597
GO:0016743
GO:0046872
AF-A0A524KLL9-F1-model_v4 D-alanine--D-alanine ligase 0.9498 1 328 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A7V8W6B0-F1-model_v4 D-alanine--D-alanine ligase 0.9481 1 266 GO:0005524
GO:0008716
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map