F465817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 272 | 579 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10226379|Ga0075370_102263792 |
| Length | 247 |
| Sequence | MPFAFSTARSRSSNPYVKDTALPTAEEVAEFLKQNPGFFENHVEVLMDLQIPHPHGGRAVSIGERQLVAVREKSRLLEDKLRELIQFGEENDAVGGKVHKLACRLIEAASLDAALDTMYLDLLDHFAVPHVAVRLWNVAEDNPDTKEFGPVMPEMRQFVAQMTAPYCGHHAVYESQAWFGEAAPHLKSFAMVALRLDDRPFGAIALGSEDPKRFYPEMGTLYLQRIGELLSHALWRFVTPVREPEAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 201 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 202 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 203 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 204 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 205 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.07 |
| Nodule | 0 |
| Rhizoplane | 1.21 |
| Rhizosphere | 96.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10078424 | 3300003203 | Bacteria | 1018 |
| 2 | Ga0070658_10001128 | 3300005327 | Bacteria | 22780 |
| 3 | Ga0070658_10045857 | 3300005327 | Bacteria | 3536 |
| 4 | Ga0070658_10071603 | 3300005327 | Bacteria | 2839 |
| 5 | Ga0070658_10287415 | 3300005327 | Bacteria | 1401 |
| 6 | Ga0070676_10052499 | 3300005328 | Bacteria | 2397 |
| 7 | Ga0070683_100633332 | 3300005329 | Bacteria | 1024 |
| 8 | Ga0070690_100000207 | 3300005330 | Bacteria | 30496 |
| 9 | Ga0070690_100044209 | 3300005330 | Bacteria | 2826 |
| 10 | Ga0070690_100233906 | 3300005330 | Unclassified | 1293 |
| 11 | Ga0070670_100106030 | 3300005331 | Bacteria | 2422 |
| 12 | Ga0068869_100001484 | 3300005334 | Bacteria | 13884 |
| 13 | Ga0068869_100005354 | 3300005334 | Bacteria | 8069 |
| 14 | Ga0068869_100204745 | 3300005334 | Bacteria | 1558 |
| 15 | Ga0070680_100144545 | 3300005336 | Bacteria | 1995 |
| 16 | Ga0070680_100371454 | 3300005336 | Bacteria | 1217 |
| 17 | Ga0070680_100387132 | 3300005336 | Bacteria | 1191 |
| 18 | Ga0070680_100439236 | 3300005336 | Bacteria | 1114 |
| 19 | Ga0068868_100032519 | 3300005338 | Bacteria | 4013 |
| 20 | Ga0068868_100084771 | 3300005338 | Bacteria | 2545 |
| 21 | Ga0068868_100160562 | 3300005338 | Bacteria | 1856 |
| 22 | Ga0068868_100164353 | 3300005338 | Bacteria | 1835 |
| 23 | Ga0068868_100841264 | 3300005338 | Bacteria | 831 |
| 24 | Ga0070660_100448750 | 3300005339 | Bacteria | 1070 |
| 25 | Ga0070689_100000632 | 3300005340 | Bacteria | 21303 |
| 26 | Ga0070689_100053863 | 3300005340 | Bacteria | 3114 |
| 27 | Ga0070689_100196062 | 3300005340 | Bacteria | 1646 |
| 28 | Ga0070691_10301503 | 3300005341 | Bacteria | 875 |
| 29 | Ga0070687_100051522 | 3300005343 | Bacteria | 2131 |
| 30 | Ga0070687_100090317 | 3300005343 | Bacteria | 1693 |
| 31 | Ga0070687_100279606 | 3300005343 | Bacteria | 1050 |
| 32 | Ga0070661_100098543 | 3300005344 | Bacteria | 2171 |
| 33 | Ga0070692_10000846 | 3300005345 | Bacteria | 10306 |
| 34 | Ga0070692_10167776 | 3300005345 | Bacteria | 1263 |
| 35 | Ga0070669_100091361 | 3300005353 | Bacteria | 2283 |
| 36 | Ga0070675_100020756 | 3300005354 | Bacteria | 5243 |
| 37 | Ga0070675_100191734 | 3300005354 | Bacteria | 1771 |
| 38 | Ga0070674_100012416 | 3300005356 | Bacteria | 5230 |
| 39 | Ga0070674_100358624 | 3300005356 | Bacteria | 1180 |
| 40 | Ga0070673_100285170 | 3300005364 | Bacteria | 1449 |
| 41 | Ga0070673_100294769 | 3300005364 | Bacteria | 1426 |
| 42 | Ga0070673_100417945 | 3300005364 | Bacteria | 1202 |
| 43 | Ga0070659_100029685 | 3300005366 | Bacteria | 4227 |
| 44 | Ga0070667_100381682 | 3300005367 | Bacteria | 1280 |
| 45 | Ga0070714_100083896 | 3300005435 | Bacteria | 2779 |
| 46 | Ga0070714_100708320 | 3300005435 | Bacteria | 972 |
| 47 | Ga0070713_100706303 | 3300005436 | Bacteria | 963 |
| 48 | Ga0070710_10194251 | 3300005437 | Bacteria | 1278 |
| 49 | Ga0070701_10001232 | 3300005438 | Bacteria | 9394 |
| 50 | Ga0070701_10067387 | 3300005438 | Bacteria | 1904 |
| 51 | Ga0070701_10124941 | 3300005438 | Bacteria | 1455 |
| 52 | Ga0070711_100683540 | 3300005439 | Bacteria | 863 |
| 53 | Ga0070705_100013296 | 3300005440 | Bacteria | 4207 |
| 54 | Ga0070705_100262892 | 3300005440 | Bacteria | 1218 |
| 55 | Ga0070705_100451374 | 3300005440 | Bacteria | 965 |
| 56 | Ga0070700_100000469 | 3300005441 | Bacteria | 20211 |
| 57 | Ga0070700_100001919 | 3300005441 | Bacteria | 10509 |
| 58 | Ga0070700_100498814 | 3300005441 | Bacteria | 936 |
| 59 | Ga0070694_100053353 | 3300005444 | Bacteria | 2736 |
| 60 | Ga0070694_100218433 | 3300005444 | Bacteria | 1429 |
| 61 | Ga0070663_100361079 | 3300005455 | Bacteria | 1178 |
| 62 | Ga0070678_100003745 | 3300005456 | Bacteria | 8517 |
| 63 | Ga0070678_100555131 | 3300005456 | Bacteria | 1020 |
| 64 | Ga0070681_10008404 | 3300005458 | Bacteria | 10108 |
| 65 | Ga0070681_10140371 | 3300005458 | Bacteria | 2346 |
| 66 | Ga0070681_10300559 | 3300005458 | Bacteria | 1515 |
| 67 | Ga0070681_10485846 | 3300005458 | Bacteria | 1148 |
| 68 | Ga0068867_100005845 | 3300005459 | Bacteria | 8726 |
| 69 | Ga0068867_100268773 | 3300005459 | Bacteria | 1393 |
| 70 | Ga0070685_10017590 | 3300005466 | Bacteria | 3828 |
| 71 | Ga0070685_10323348 | 3300005466 | Unclassified | 1046 |
| 72 | Ga0070706_100554464 | 3300005467 | Bacteria | 1069 |
| 73 | Ga0070698_100226024 | 3300005471 | Bacteria | 1805 |
| 74 | Ga0070698_100329896 | 3300005471 | Bacteria | 1457 |
| 75 | Ga0070698_100342669 | 3300005471 | Bacteria | 1426 |
| 76 | Ga0070699_100036349 | 3300005518 | Bacteria | 4261 |
| 77 | Ga0070699_100121097 | 3300005518 | Bacteria | 2301 |
| 78 | Ga0070679_100088129 | 3300005530 | Bacteria | 3091 |
| 79 | Ga0070679_100209406 | 3300005530 | Bacteria | 1914 |
| 80 | Ga0070679_100240010 | 3300005530 | Bacteria | 1770 |
| 81 | Ga0070684_100117324 | 3300005535 | Bacteria | 2392 |
| 82 | Ga0070684_100377981 | 3300005535 | Bacteria | 1304 |
| 83 | Ga0070697_100217708 | 3300005536 | Bacteria | 1627 |
| 84 | Ga0070697_100288039 | 3300005536 | Unclassified | 1410 |
| 85 | Ga0070697_100819900 | 3300005536 | Bacteria | 824 |
| 86 | Ga0068853_100538453 | 3300005539 | Unclassified | 1105 |
| 87 | Ga0070686_100003579 | 3300005544 | Bacteria | 8527 |
| 88 | Ga0070686_100104130 | 3300005544 | Bacteria | 1922 |
| 89 | Ga0070686_100144024 | 3300005544 | Bacteria | 1662 |
| 90 | Ga0070686_100315459 | 3300005544 | Bacteria | 1164 |
| 91 | Ga0070695_100003131 | 3300005545 | Bacteria | 9640 |
| 92 | Ga0070695_100090722 | 3300005545 | Bacteria | 2040 |
| 93 | Ga0070696_100001158 | 3300005546 | Bacteria | 17126 |
| 94 | Ga0070696_100017398 | 3300005546 | Bacteria | 4851 |
| 95 | Ga0070696_100023822 | 3300005546 | Bacteria | 4160 |
| 96 | Ga0070696_100110857 | 3300005546 | Bacteria | 1976 |
| 97 | Ga0070696_100135591 | 3300005546 | Bacteria | 1794 |
| 98 | Ga0070696_100188778 | 3300005546 | Bacteria | 1533 |
| 99 | Ga0070696_100223403 | 3300005546 | Bacteria | 1414 |
| 100 | Ga0070696_100624300 | 3300005546 | Bacteria | 871 |
| 101 | Ga0070693_100004968 | 3300005547 | Bacteria | 6350 |
| 102 | Ga0070693_100195864 | 3300005547 | Bacteria | 1309 |
| 103 | Ga0070693_100223525 | 3300005547 | Bacteria | 1235 |
| 104 | Ga0070693_100252764 | 3300005547 | Bacteria | 1169 |
| 105 | Ga0070665_100154374 | 3300005548 | Bacteria | 2297 |
| 106 | Ga0070704_100073216 | 3300005549 | Bacteria | 2495 |
| 107 | Ga0070704_100286029 | 3300005549 | Bacteria | 1368 |
| 108 | Ga0070704_100318611 | 3300005549 | Bacteria | 1302 |
| 109 | Ga0070704_100388592 | 3300005549 | Bacteria | 1188 |
| 110 | Ga0070704_100514617 | 3300005549 | Bacteria | 1041 |
| 111 | Ga0068855_100011589 | 3300005563 | Bacteria | 10650 |
| 112 | Ga0068855_100014368 | 3300005563 | Bacteria | 9533 |
| 113 | Ga0068855_100048384 | 3300005563 | Bacteria | 5018 |
| 114 | Ga0068855_100492747 | 3300005563 | Bacteria | 1333 |
| 115 | Ga0070664_100268178 | 3300005564 | Bacteria | 1537 |
| 116 | Ga0070664_100506916 | 3300005564 | Bacteria | 1113 |
| 117 | Ga0070664_100892127 | 3300005564 | Bacteria | 833 |
| 118 | Ga0068857_100070065 | 3300005577 | Bacteria | 3123 |
| 119 | Ga0068857_100652860 | 3300005577 | Bacteria | 997 |
| 120 | Ga0068854_100215087 | 3300005578 | Bacteria | 1518 |
| 121 | Ga0068854_100342067 | 3300005578 | Bacteria | 1222 |
| 122 | Ga0068856_100146416 | 3300005614 | Bacteria | 2370 |
| 123 | Ga0068856_101109630 | 3300005614 | Unclassified | 808 |
| 124 | Ga0070702_100000215 | 3300005615 | Bacteria | 19248 |
| 125 | Ga0070702_100625537 | 3300005615 | Bacteria | 811 |
| 126 | Ga0068852_100000280 | 3300005616 | Bacteria | 34116 |
| 127 | Ga0068852_100006538 | 3300005616 | Bacteria | 8431 |
| 128 | Ga0068852_100015175 | 3300005616 | Bacteria | 5962 |
| 129 | Ga0068852_100249020 | 3300005616 | Bacteria | 1701 |
| 130 | Ga0068859_100020990 | 3300005617 | Bacteria | 6557 |
| 131 | Ga0068859_100230670 | 3300005617 | Bacteria | 1939 |
| 132 | Ga0068859_100346026 | 3300005617 | Bacteria | 1581 |
| 133 | Ga0068859_100574618 | 3300005617 | Bacteria | 1221 |
| 134 | Ga0068864_100241759 | 3300005618 | Bacteria | 1673 |
| 135 | Ga0068864_100386447 | 3300005618 | Bacteria | 1327 |
| 136 | Ga0068866_10000298 | 3300005718 | Bacteria | 23676 |
| 137 | Ga0068866_10201479 | 3300005718 | Bacteria | 1189 |
| 138 | Ga0068866_10317056 | 3300005718 | Bacteria | 979 |
| 139 | Ga0068861_100000393 | 3300005719 | Bacteria | 25233 |
| 140 | Ga0068861_100184270 | 3300005719 | Bacteria | 1740 |
| 141 | Ga0068851_10000350 | 3300005834 | Bacteria | 20761 |
| 142 | Ga0068870_10006603 | 3300005840 | Bacteria | 5124 |
| 143 | Ga0068870_10085893 | 3300005840 | Bacteria | 1749 |
| 144 | Ga0068858_100000730 | 3300005842 | Bacteria | 34410 |
| 145 | Ga0068858_100046556 | 3300005842 | Bacteria | 4020 |
| 146 | Ga0068858_100095592 | 3300005842 | Bacteria | 2769 |
| 147 | Ga0068858_100154349 | 3300005842 | Bacteria | 2160 |
| 148 | Ga0068860_100006996 | 3300005843 | Bacteria | 11302 |
| 149 | Ga0068860_100264001 | 3300005843 | Bacteria | 1679 |
| 150 | Ga0068860_100786103 | 3300005843 | Unclassified | 965 |
| 151 | Ga0068862_100009410 | 3300005844 | Bacteria | 8083 |
| 152 | Ga0068862_100038228 | 3300005844 | Bacteria | 4070 |
| 153 | Ga0081539_10001863 | 3300005985 | Bacteria | 33168 |
| 154 | Ga0075364_10095872 | 3300006051 | Bacteria | 1972 |
| 155 | Ga0075364_10289429 | 3300006051 | Bacteria | 1115 |
| 156 | Ga0070716_100462728 | 3300006173 | Unclassified | 927 |
| 157 | Ga0070716_100581596 | 3300006173 | Bacteria | 839 |
| 158 | Ga0075369_10014355 | 3300006186 | Bacteria | 3163 |
| 159 | Ga0075366_10040848 | 3300006195 | Bacteria | 2744 |
| 160 | Ga0097621_100003061 | 3300006237 | Bacteria | 11463 |
| 161 | Ga0097621_100014117 | 3300006237 | Bacteria | 5971 |
| 162 | Ga0097621_100339842 | 3300006237 | Bacteria | 1333 |
| 163 | Ga0097621_100696982 | 3300006237 | Bacteria | 935 |
| 164 | Ga0075370_10081940 | 3300006353 | Bacteria | 1855 |
| 165 | Ga0075370_10226379 | 3300006353 | Bacteria | 1106 |
| 166 | Ga0068871_100000782 | 3300006358 | Bacteria | 21411 |
| 167 | Ga0068871_100058527 | 3300006358 | Bacteria | 3138 |
| 168 | Ga0068871_100107005 | 3300006358 | Bacteria | 2348 |
| 169 | Ga0068871_100326139 | 3300006358 | Bacteria | 1353 |
| 170 | Ga0075428_100433961 | 3300006844 | Bacteria | 1407 |
| 171 | Ga0075430_100040553 | 3300006846 | Bacteria | 3941 |
| 172 | Ga0075431_100105958 | 3300006847 | Bacteria | 2901 |
| 173 | Ga0075431_100123489 | 3300006847 | Bacteria | 2671 |
| 174 | Ga0075431_100416855 | 3300006847 | Bacteria | 1342 |
| 175 | Ga0075433_10034242 | 3300006852 | Bacteria | 4360 |
| 176 | Ga0075433_10117196 | 3300006852 | Bacteria | 2363 |
| 177 | Ga0075433_10331255 | 3300006852 | Bacteria | 1346 |
| 178 | Ga0075433_10428725 | 3300006852 | Bacteria | 1166 |
| 179 | Ga0075434_100000002 | 3300006871 | Bacteria | 135661 |
| 180 | Ga0075434_101166549 | 3300006871 | Bacteria | 783 |
| 181 | Ga0075429_100129748 | 3300006880 | Bacteria | 2205 |
| 182 | Ga0068865_100000084 | 3300006881 | Bacteria | 50482 |
| 183 | Ga0068865_100137910 | 3300006881 | Bacteria | 1835 |
| 184 | Ga0068865_100236911 | 3300006881 | Unclassified | 1434 |
| 185 | Ga0068865_100904477 | 3300006881 | Bacteria | 768 |
| 186 | Ga0075436_100001674 | 3300006914 | Bacteria | 15155 |
| 187 | Ga0075436_100009216 | 3300006914 | Bacteria | 6754 |
| 188 | Ga0075436_100018295 | 3300006914 | Bacteria | 4799 |
| 189 | Ga0075436_100067072 | 3300006914 | Bacteria | 2480 |
| 190 | Ga0075436_100117776 | 3300006914 | Bacteria | 1857 |
| 191 | Ga0075436_100457544 | 3300006914 | Bacteria | 930 |
| 192 | Ga0097620_100020988 | 3300006931 | Bacteria | 6557 |
| 193 | Ga0097620_100230684 | 3300006931 | Bacteria | 1939 |
| 194 | Ga0097620_100346057 | 3300006931 | Bacteria | 1581 |
| 195 | Ga0097620_100574641 | 3300006931 | Bacteria | 1221 |
| 196 | Ga0075435_100004018 | 3300007076 | Bacteria | 10052 |
| 197 | Ga0075435_100062365 | 3300007076 | Bacteria | 3025 |
| 198 | Ga0075435_100211769 | 3300007076 | Bacteria | 1644 |
| 199 | Ga0105250_10089727 | 3300009092 | Unclassified | 1249 |
| 200 | Ga0105240_10004564 | 3300009093 | Bacteria | 21003 |
| 201 | Ga0105240_10071448 | 3300009093 | Bacteria | 4292 |
| 202 | Ga0105240_10211192 | 3300009093 | Bacteria | 2268 |
| 203 | Ga0105240_11023537 | 3300009093 | Unclassified | 882 |
| 204 | Ga0111539_10003186 | 3300009094 | Bacteria | 21711 |
| 205 | Ga0111539_10802926 | 3300009094 | Unclassified | 1095 |
| 206 | Ga0105245_10000063 | 3300009098 | Bacteria | 113377 |
| 207 | Ga0105245_10299721 | 3300009098 | Bacteria | 1577 |
| 208 | Ga0114129_10028894 | 3300009147 | Bacteria | 7856 |
| 209 | Ga0114129_10224424 | 3300009147 | Bacteria | 2533 |
| 210 | Ga0114129_10370501 | 3300009147 | Bacteria | 1893 |
| 211 | Ga0114129_10660045 | 3300009147 | Bacteria | 1349 |
| 212 | Ga0105243_10001155 | 3300009148 | Bacteria | 23948 |
| 213 | Ga0105243_10039765 | 3300009148 | Bacteria | 3669 |
| 214 | Ga0105243_10080444 | 3300009148 | Bacteria | 2658 |
| 215 | Ga0105243_10186691 | 3300009148 | Bacteria | 1807 |
| 216 | Ga0105241_10005299 | 3300009174 | Bacteria | 9527 |
| 217 | Ga0105241_10042764 | 3300009174 | Bacteria | 3430 |
| 218 | Ga0105241_10103780 | 3300009174 | Bacteria | 2264 |
| 219 | Ga0105241_10263492 | 3300009174 | Bacteria | 1465 |
| 220 | Ga0105241_10335171 | 3300009174 | Bacteria | 1309 |
| 221 | Ga0105242_10001356 | 3300009176 | Bacteria | 19311 |
| 222 | Ga0105242_10003831 | 3300009176 | Bacteria | 11695 |
| 223 | Ga0105242_10155391 | 3300009176 | Bacteria | 1998 |
| 224 | Ga0105242_10535094 | 3300009176 | Bacteria | 1120 |
| 225 | Ga0105248_10022713 | 3300009177 | Bacteria | 6962 |
| 226 | Ga0105248_10098292 | 3300009177 | Bacteria | 3297 |
| 227 | Ga0105248_10151287 | 3300009177 | Bacteria | 2618 |
| 228 | Ga0105248_10564815 | 3300009177 | Bacteria | 1284 |
| 229 | Ga0105248_10841248 | 3300009177 | Unclassified | 1036 |
| 230 | Ga0105237_10008404 | 3300009545 | Bacteria | 11187 |
| 231 | Ga0105238_10028411 | 3300009551 | Bacteria | 5699 |
| 232 | Ga0105238_10110772 | 3300009551 | Bacteria | 2726 |
| 233 | Ga0105238_10637216 | 3300009551 | Bacteria | 1075 |
| 234 | Ga0105238_10917566 | 3300009551 | Bacteria | 895 |
| 235 | Ga0105238_10971464 | 3300009551 | Bacteria | 870 |
| 236 | Ga0105249_10150073 | 3300009553 | Bacteria | 2243 |
| 237 | Ga0105249_10156492 | 3300009553 | Bacteria | 2198 |
| 238 | Ga0105239_10308196 | 3300010375 | Bacteria | 1784 |
| 239 | Ga0105239_10762649 | 3300010375 | Bacteria | 1107 |
| 240 | Ga0105246_10137781 | 3300011119 | Bacteria | 1831 |
| 241 | Ga0157371_10263841 | 3300013102 | Bacteria | 1242 |
| 242 | Ga0157370_10013031 | 3300013104 | Bacteria | 8586 |
| 243 | Ga0157370_10697592 | 3300013104 | Bacteria | 926 |
| 244 | Ga0157369_10000349 | 3300013105 | Bacteria | 61491 |
| 245 | Ga0157369_10404989 | 3300013105 | Bacteria | 1415 |
| 246 | Ga0157374_10075981 | 3300013296 | Bacteria | 3175 |
| 247 | Ga0157374_10660580 | 3300013296 | Bacteria | 1057 |
| 248 | Ga0157378_10001267 | 3300013297 | Bacteria | 22738 |
| 249 | Ga0157378_10060026 | 3300013297 | Bacteria | 3394 |
| 250 | Ga0157378_10214428 | 3300013297 | Bacteria | 1827 |
| 251 | Ga0163162_10186708 | 3300013306 | Bacteria | 2200 |
| 252 | Ga0163162_10437930 | 3300013306 | Unclassified | 1439 |
| 253 | Ga0163162_10766455 | 3300013306 | Bacteria | 1084 |
| 254 | Ga0163162_11132043 | 3300013306 | Bacteria | 887 |
| 255 | Ga0157372_10006727 | 3300013307 | Bacteria | 12224 |
| 256 | Ga0157372_10154709 | 3300013307 | Bacteria | 2648 |
| 257 | Ga0157372_10243396 | 3300013307 | Bacteria | 2087 |
| 258 | Ga0157372_10474389 | 3300013307 | Unclassified | 1458 |
| 259 | Ga0157372_10883453 | 3300013307 | Bacteria | 1037 |
| 260 | Ga0157375_10052169 | 3300013308 | Bacteria | 4019 |
| 261 | Ga0157375_10085494 | 3300013308 | Bacteria | 3204 |
| 262 | Ga0157375_10114069 | 3300013308 | Bacteria | 2804 |
| 263 | Ga0157375_10168153 | 3300013308 | Bacteria | 2339 |
| 264 | Ga0157375_10475804 | 3300013308 | Bacteria | 1414 |
| 265 | Ga0163163_11073296 | 3300014325 | Bacteria | 868 |
| 266 | Ga0157380_10025735 | 3300014326 | Bacteria | 4465 |
| 267 | Ga0157380_10103078 | 3300014326 | Bacteria | 2380 |
| 268 | Ga0157380_10107020 | 3300014326 | Bacteria | 2341 |
| 269 | Ga0157380_10552303 | 3300014326 | Bacteria | 1130 |
| 270 | Ga0157380_10838826 | 3300014326 | Bacteria | 940 |
| 271 | Ga0157377_10020294 | 3300014745 | Bacteria | 3479 |
| 272 | Ga0157377_10238744 | 3300014745 | Bacteria | 1172 |
| 273 | Ga0157379_10004490 | 3300014968 | Bacteria | 11965 |
| 274 | Ga0157379_10099171 | 3300014968 | Bacteria | 2615 |
| 275 | Ga0157379_10277898 | 3300014968 | Bacteria | 1524 |
| 276 | Ga0157379_10321606 | 3300014968 | Bacteria | 1412 |
| 277 | Ga0157376_10664189 | 3300014969 | Bacteria | 1044 |
| 278 | Ga0163161_10021559 | 3300017792 | Bacteria | 4527 |
| 279 | Ga0213876_10017617 | 3300021384 | Bacteria | 3770 |
| 280 | Ga0207642_10006974 | 3300025899 | Bacteria | 3787 |
| 281 | Ga0207685_10092233 | 3300025905 | Bacteria | 1278 |
| 282 | Ga0207643_10005404 | 3300025908 | Bacteria | 6837 |
| 283 | Ga0207643_10013492 | 3300025908 | Bacteria | 4427 |
| 284 | Ga0207705_10043075 | 3300025909 | Bacteria | 3242 |
| 285 | Ga0207705_10078860 | 3300025909 | Bacteria | 2398 |
| 286 | Ga0207705_10124592 | 3300025909 | Bacteria | 1914 |
| 287 | Ga0207705_10778710 | 3300025909 | Bacteria | 743 |
| 288 | Ga0207684_10312989 | 3300025910 | Bacteria | 1353 |
| 289 | Ga0207654_10029944 | 3300025911 | Bacteria | 2985 |
| 290 | Ga0207707_10041225 | 3300025912 | Bacteria | 4032 |
| 291 | Ga0207707_10285036 | 3300025912 | Bacteria | 1430 |
| 292 | Ga0207707_10342560 | 3300025912 | Bacteria | 1289 |
| 293 | Ga0207707_10507467 | 3300025912 | Bacteria | 1028 |
| 294 | Ga0207695_10021605 | 3300025913 | Bacteria | 7337 |
| 295 | Ga0207695_10059570 | 3300025913 | Bacteria | 3958 |
| 296 | Ga0207695_10107222 | 3300025913 | Bacteria | 2779 |
| 297 | Ga0207695_10570022 | 3300025913 | Bacteria | 1013 |
| 298 | Ga0207695_10925824 | 3300025913 | Unclassified | 751 |
| 299 | Ga0207671_10113569 | 3300025914 | Bacteria | 2063 |
| 300 | Ga0207663_10064278 | 3300025916 | Bacteria | 2341 |
| 301 | Ga0207663_10647677 | 3300025916 | Bacteria | 834 |
| 302 | Ga0207660_10268139 | 3300025917 | Bacteria | 1352 |
| 303 | Ga0207660_10273010 | 3300025917 | Bacteria | 1340 |
| 304 | Ga0207660_10286458 | 3300025917 | Bacteria | 1309 |
| 305 | Ga0207662_10031704 | 3300025918 | Bacteria | 3071 |
| 306 | Ga0207657_10448543 | 3300025919 | Bacteria | 1012 |
| 307 | Ga0207649_10121922 | 3300025920 | Bacteria | 1759 |
| 308 | Ga0207652_10336340 | 3300025921 | Bacteria | 1363 |
| 309 | Ga0207652_10450215 | 3300025921 | Bacteria | 1161 |
| 310 | Ga0207646_10485010 | 3300025922 | Bacteria | 1114 |
| 311 | Ga0207681_10330920 | 3300025923 | Bacteria | 1214 |
| 312 | Ga0207694_10035293 | 3300025924 | Bacteria | 3836 |
| 313 | Ga0207694_10264610 | 3300025924 | Bacteria | 1409 |
| 314 | Ga0207694_10283384 | 3300025924 | Bacteria | 1362 |
| 315 | Ga0207694_10719062 | 3300025924 | Bacteria | 842 |
| 316 | Ga0207650_10064294 | 3300025925 | Bacteria | 2746 |
| 317 | Ga0207650_10336209 | 3300025925 | Bacteria | 1239 |
| 318 | Ga0207659_10010298 | 3300025926 | Bacteria | 5870 |
| 319 | Ga0207659_10590325 | 3300025926 | Bacteria | 946 |
| 320 | Ga0207687_10005312 | 3300025927 | Bacteria | 8529 |
| 321 | Ga0207687_10038895 | 3300025927 | Bacteria | 3253 |
| 322 | Ga0207700_10103976 | 3300025928 | Bacteria | 2271 |
| 323 | Ga0207700_10548757 | 3300025928 | Bacteria | 1026 |
| 324 | Ga0207664_10152285 | 3300025929 | Bacteria | 1965 |
| 325 | Ga0207690_10015797 | 3300025932 | Bacteria | 4582 |
| 326 | Ga0207686_10001462 | 3300025934 | Bacteria | 13347 |
| 327 | Ga0207686_10003331 | 3300025934 | Bacteria | 8636 |
| 328 | Ga0207686_10123507 | 3300025934 | Bacteria | 1765 |
| 329 | Ga0207686_10226145 | 3300025934 | Bacteria | 1354 |
| 330 | Ga0207686_10307077 | 3300025934 | Bacteria | 1180 |
| 331 | Ga0207709_10003470 | 3300025935 | Bacteria | 9354 |
| 332 | Ga0207709_10045987 | 3300025935 | Bacteria | 2646 |
| 333 | Ga0207709_10110389 | 3300025935 | Bacteria | 1838 |
| 334 | Ga0207709_10296818 | 3300025935 | Bacteria | 1200 |
| 335 | Ga0207709_10467774 | 3300025935 | Bacteria | 978 |
| 336 | Ga0207670_10290363 | 3300025936 | Unclassified | 1277 |
| 337 | Ga0207669_10070021 | 3300025937 | Bacteria | 2197 |
| 338 | Ga0207669_10228658 | 3300025937 | Bacteria | 1371 |
| 339 | Ga0207704_10000948 | 3300025938 | Bacteria | 12827 |
| 340 | Ga0207704_10209392 | 3300025938 | Unclassified | 1434 |
| 341 | Ga0207704_10317931 | 3300025938 | Bacteria | 1200 |
| 342 | Ga0207704_10447928 | 3300025938 | Bacteria | 1030 |
| 343 | Ga0207704_10661603 | 3300025938 | Bacteria | 861 |
| 344 | Ga0207665_10019784 | 3300025939 | Bacteria | 4424 |
| 345 | Ga0207691_10016851 | 3300025940 | Bacteria | 6933 |
| 346 | Ga0207711_10026199 | 3300025941 | Bacteria | 4891 |
| 347 | Ga0207711_10070138 | 3300025941 | Bacteria | 3039 |
| 348 | Ga0207711_10139985 | 3300025941 | Bacteria | 2176 |
| 349 | Ga0207711_10677323 | 3300025941 | Bacteria | 962 |
| 350 | Ga0207689_10000152 | 3300025942 | Bacteria | 59757 |
| 351 | Ga0207689_10011552 | 3300025942 | Bacteria | 7564 |
| 352 | Ga0207689_10060742 | 3300025942 | Bacteria | 3108 |
| 353 | Ga0207679_10163736 | 3300025945 | Bacteria | 1824 |
| 354 | Ga0207679_10241729 | 3300025945 | Bacteria | 1530 |
| 355 | Ga0207679_10627601 | 3300025945 | Bacteria | 970 |
| 356 | Ga0207667_10025530 | 3300025949 | Bacteria | 6467 |
| 357 | Ga0207667_10027390 | 3300025949 | Bacteria | 6204 |
| 358 | Ga0207667_10064821 | 3300025949 | Bacteria | 3812 |
| 359 | Ga0207667_10106339 | 3300025949 | Bacteria | 2894 |
| 360 | Ga0207667_10790524 | 3300025949 | Bacteria | 946 |
| 361 | Ga0207651_10355001 | 3300025960 | Bacteria | 1236 |
| 362 | Ga0207712_10136756 | 3300025961 | Bacteria | 1875 |
| 363 | Ga0207712_10397055 | 3300025961 | Unclassified | 1158 |
| 364 | Ga0207640_10087739 | 3300025981 | Bacteria | 2146 |
| 365 | Ga0207640_10133347 | 3300025981 | Bacteria | 1799 |
| 366 | Ga0207640_10214788 | 3300025981 | Bacteria | 1468 |
| 367 | Ga0207658_10612723 | 3300025986 | Bacteria | 979 |
| 368 | Ga0207658_10705635 | 3300025986 | Bacteria | 912 |
| 369 | Ga0207677_10031150 | 3300026023 | Bacteria | 3414 |
| 370 | Ga0207677_10076597 | 3300026023 | Bacteria | 2382 |
| 371 | Ga0207677_10107202 | 3300026023 | Bacteria | 2072 |
| 372 | Ga0207677_10759746 | 3300026023 | Bacteria | 865 |
| 373 | Ga0207703_10016607 | 3300026035 | Bacteria | 5741 |
| 374 | Ga0207703_10121781 | 3300026035 | Bacteria | 2240 |
| 375 | Ga0207703_10428602 | 3300026035 | Bacteria | 1232 |
| 376 | Ga0207639_10038467 | 3300026041 | Bacteria | 3559 |
| 377 | Ga0207708_10000166 | 3300026075 | Bacteria | 51921 |
| 378 | Ga0207708_10017322 | 3300026075 | Bacteria | 5423 |
| 379 | Ga0207708_10095882 | 3300026075 | Bacteria | 2292 |
| 380 | Ga0207702_10142159 | 3300026078 | Bacteria | 2173 |
| 381 | Ga0207702_10208666 | 3300026078 | Bacteria | 1815 |
| 382 | Ga0207702_10228588 | 3300026078 | Bacteria | 1737 |
| 383 | Ga0207702_10669465 | 3300026078 | Bacteria | 1021 |
| 384 | Ga0207648_10000131 | 3300026089 | Bacteria | 73949 |
| 385 | Ga0207648_10062166 | 3300026089 | Bacteria | 3256 |
| 386 | Ga0207648_10318485 | 3300026089 | Unclassified | 1397 |
| 387 | Ga0207648_10322147 | 3300026089 | Bacteria | 1389 |
| 388 | Ga0207648_10389906 | 3300026089 | Bacteria | 1260 |
| 389 | Ga0207648_10395975 | 3300026089 | Bacteria | 1251 |
| 390 | Ga0207648_10545680 | 3300026089 | Bacteria | 1064 |
| 391 | Ga0207676_10465945 | 3300026095 | Bacteria | 1194 |
| 392 | Ga0207674_10008824 | 3300026116 | Bacteria | 11602 |
| 393 | Ga0207674_10264404 | 3300026116 | Bacteria | 1668 |
| 394 | Ga0207675_100001354 | 3300026118 | Bacteria | 24525 |
| 395 | Ga0207675_100064181 | 3300026118 | Bacteria | 3432 |
| 396 | Ga0207675_100270444 | 3300026118 | Bacteria | 1649 |
| 397 | Ga0207675_101138126 | 3300026118 | Bacteria | 800 |
| 398 | Ga0207683_10009460 | 3300026121 | Bacteria | 8303 |
| 399 | Ga0207683_10012340 | 3300026121 | Bacteria | 7290 |
| 400 | Ga0207683_10166274 | 3300026121 | Bacteria | 1996 |
| 401 | Ga0207683_10423221 | 3300026121 | Bacteria | 1227 |
| 402 | Ga0207683_10528326 | 3300026121 | Bacteria | 1090 |
| 403 | Ga0207698_10003270 | 3300026142 | Bacteria | 9739 |
| 404 | Ga0207698_10004206 | 3300026142 | Bacteria | 8754 |
| 405 | Ga0209969_1029982 | 3300027360 | Bacteria | 830 |
| 406 | Ga0210000_1005848 | 3300027462 | Bacteria | 1788 |
| 407 | Ga0209970_1008266 | 3300027614 | Bacteria | 1708 |
| 408 | Ga0209966_1001918 | 3300027695 | Bacteria | 3492 |
| 409 | Ga0209966_1012280 | 3300027695 | Bacteria | 1572 |
| 410 | Ga0209998_10064217 | 3300027717 | Bacteria | 869 |
| 411 | Ga0209974_10023228 | 3300027876 | Bacteria | 2052 |
| 412 | Ga0207428_10002577 | 3300027907 | Bacteria | 18107 |
| 413 | Ga0268265_10021816 | 3300028380 | Bacteria | 4492 |
| 414 | Ga0268264_10016844 | 3300028381 | Bacteria | 5983 |
| 415 | Ga0265338_10241669 | 3300028800 | Bacteria | 1337 |
| 416 | Ga0265339_10069485 | 3300031249 | Bacteria | 1880 |
| 417 | Ga0307408_100095275 | 3300031548 | Bacteria | 2256 |
| 418 | Ga0307408_100198227 | 3300031548 | Bacteria | 1623 |
| 419 | Ga0307408_100238807 | 3300031548 | Bacteria | 1492 |
| 420 | Ga0307408_100248789 | 3300031548 | Bacteria | 1465 |
| 421 | Ga0307408_100360948 | 3300031548 | Bacteria | 1236 |
| 422 | Ga0307408_100368805 | 3300031548 | Bacteria | 1224 |
| 423 | Ga0307408_100597885 | 3300031548 | Bacteria | 980 |
| 424 | Ga0265314_10081086 | 3300031711 | Bacteria | 2139 |
| 425 | Ga0307405_10304901 | 3300031731 | Bacteria | 1210 |
| 426 | Ga0307406_10267863 | 3300031901 | Bacteria | 1296 |
| 427 | Ga0307406_10271753 | 3300031901 | Bacteria | 1288 |
| 428 | Ga0307406_10811482 | 3300031901 | Bacteria | 790 |
| 429 | Ga0307412_10396380 | 3300031911 | Bacteria | 1122 |
| 430 | Ga0307412_10493481 | 3300031911 | Bacteria | 1018 |
| 431 | Ga0307412_10595535 | 3300031911 | Bacteria | 935 |
| 432 | Ga0307409_100156840 | 3300031995 | Bacteria | 1985 |
| 433 | Ga0307416_100252561 | 3300032002 | Bacteria | 1717 |
| 434 | Ga0307416_100322240 | 3300032002 | Bacteria | 1548 |
| 435 | Ga0307416_100568466 | 3300032002 | Bacteria | 1209 |
| 436 | Ga0307416_100833397 | 3300032002 | Bacteria | 1020 |
| 437 | Ga0307411_10597579 | 3300032005 | Bacteria | 948 |
| 438 | Ga0373928_0071385 | 3300035084 | Bacteria | 859 |
| 439 | Ga0373929_0055495 | 3300035085 | Bacteria | 915 |
| 440 | Ga0373949_0023738 | 3300035090 | Unclassified | 1422 |
| 441 | Ga0373941_0012088 | 3300035115 | Bacteria | 2248 |
| 442 | Ga0373956_0266452 | 3300035119 | Bacteria | 815 |
| 443 | Ga0373957_0223689 | 3300035120 | Bacteria | 788 |
| 444 | Ga0373943_0291465 | 3300035170 | Bacteria | 925 |
| 445 | Ga0373955_0057054 | 3300035172 | Bacteria | 2144 |
| 446 | Ga0373961_0097542 | 3300035241 | Bacteria | 947 |
| 447 | Ga0373962_0010642 | 3300035242 | Bacteria | 2297 |
| 448 | Ga0373924_0007898 | 3300035410 | Bacteria | 3850 |
| 449 | Ga0373931_0009772 | 3300035691 | Bacteria | 4595 |
| 450 | Ga0373931_0311099 | 3300035691 | Bacteria | 975 |
| 451 | Ga0373931_0371158 | 3300035691 | Bacteria | 900 |
| 452 | Ga0373931_0574672 | 3300035691 | Bacteria | 734 |
| 453 | Ga0373927_0086519 | 3300035695 | Bacteria | 2035 |
| 454 | Ga0373927_0196449 | 3300035695 | Bacteria | 1324 |
| 455 | Ga0373947_0207843 | 3300035725 | Bacteria | 1283 |
| 456 | Ga0373937_0117836 | 3300036401 | Bacteria | 2473 |
| 457 | Ga0373937_0188555 | 3300036401 | Bacteria | 1937 |
| 458 | Ga0373925_0051113 | 3300037068 | Bacteria | 3085 |
| 459 | Ga0373925_0364727 | 3300037068 | Bacteria | 1175 |
| 460 | Ga0395899_0273537 | 3300037312 | Bacteria | 1151 |
| 461 | Ga0395905_0186083 | 3300037471 | Bacteria | 1949 |
| 462 | Ga0395901_0107553 | 3300038443 | Bacteria | 2928 |
| 463 | Ga0436365_0234883 | 3300039437 | Bacteria | 9692 |
| 464 | Ga0436365_0749296 | 3300039437 | Bacteria | 914 |
| 465 | Ga0439447_017732 | 3300041407 | Bacteria | 1935 |
| 466 | Ga0451845_0324412 | 3300041501 | Bacteria | 1005 |
| 467 | Ga0439441_008321 | 3300042001 | Bacteria | 1691 |
| 468 | Ga0439443_008880 | 3300042003 | Bacteria | 1429 |
| 469 | Ga0439446_0027170 | 3300042156 | Bacteria | 1642 |
| 470 | Ga0439460_0020812 | 3300042461 | Bacteria | 1786 |
| 471 | Ga0451577_0321625 | 3300042876 | Bacteria | 1403 |
| 472 | Ga0466961_0192394 | 3300044693 | Bacteria | 1264 |
| 473 | Ga0453684_1034077 | 3300044712 | Bacteria | 872 |
| 474 | Ga0466971_0062066 | 3300044719 | Bacteria | 1691 |
| 475 | Ga0466960_0087637 | 3300044901 | Bacteria | 1581 |
| 476 | Ga0466959_0125502 | 3300045049 | Bacteria | 1822 |
| 477 | Ga0451576_0116245 | 3300045051 | Bacteria | 2785 |
| 478 | Ga0451576_0153982 | 3300045051 | Bacteria | 2398 |
| 479 | Ga0466958_0099105 | 3300045836 | Bacteria | 1810 |
| 480 | Ga0495592_0010771 | 3300046454 | Bacteria | 6895 |
| 481 | Ga0495653_0047820 | 3300046463 | Bacteria | 3307 |
| 482 | Ga0495664_0439797 | 3300046477 | Bacteria | 781 |
| 483 | Ga0495608_0034154 | 3300046511 | Bacteria | 3434 |
| 484 | Ga0495628_0033977 | 3300046516 | Bacteria | 4105 |
| 485 | Ga0495598_0078835 | 3300046537 | Bacteria | 1053 |
| 486 | Ga0495621_0016886 | 3300046539 | Bacteria | 2350 |
| 487 | Ga0495621_0031435 | 3300046539 | Bacteria | 1821 |
| 488 | Ga0495621_0050641 | 3300046539 | Bacteria | 1484 |
| 489 | Ga0495621_0052556 | 3300046539 | Bacteria | 1461 |
| 490 | Ga0495645_0004434 | 3300046543 | Bacteria | 9587 |
| 491 | Ga0495659_0134051 | 3300046664 | Bacteria | 984 |
| 492 | Ga0495599_0005280 | 3300046678 | Bacteria | 7709 |
| 493 | Ga0495623_0022426 | 3300046679 | Bacteria | 4079 |
| 494 | Ga0495669_0093411 | 3300046684 | Bacteria | 1391 |
| 495 | Ga0495604_0043216 | 3300047317 | Bacteria | 3529 |
| 496 | Ga0495680_0032331 | 3300047322 | Bacteria | 4248 |
| 497 | Ga0495684_0123545 | 3300047471 | Bacteria | 1948 |
| 498 | Ga0496102_0129191 | 3300048905 | Bacteria | 2364 |
| 499 | Ga0496104_0279210 | 3300048907 | Bacteria | 1583 |
| 500 | Ga0496105_0051995 | 3300048908 | Bacteria | 3383 |
| 501 | Ga0496105_0880661 | 3300048908 | Unclassified | 676 |
| 502 | Ga0496106_0272286 | 3300048909 | Bacteria | 1356 |
| 503 | Ga0496110_0100519 | 3300048913 | Bacteria | 2592 |
| 504 | Ga0496110_0382090 | 3300048913 | Bacteria | 1283 |
| 505 | Ga0501297_019309 | 3300049520 | Bacteria | 842 |
| 506 | Ga0501034_0001554 | 3300049571 | Bacteria | 30039 |
| 507 | Ga0501034_0028169 | 3300049571 | Bacteria | 5715 |
| 508 | Ga0501034_0178834 | 3300049571 | Bacteria | 2087 |
| 509 | Ga0501039_0402408 | 3300049575 | Unclassified | 1075 |
| 510 | Ga0501046_0025159 | 3300049580 | Bacteria | 4875 |
| 511 | Ga0501047_0039309 | 3300049581 | Bacteria | 4576 |
| 512 | Ga0501048_0036384 | 3300049582 | Bacteria | 3539 |
| 513 | Ga0501048_0266060 | 3300049582 | Bacteria | 1218 |
| 514 | Ga0501067_0014774 | 3300049583 | Bacteria | 4320 |
| 515 | Ga0501068_0008226 | 3300049584 | Bacteria | 5800 |
| 516 | Ga0501069_0007055 | 3300049585 | Bacteria | 5884 |
| 517 | Ga0501070_0000645 | 3300049586 | Bacteria | 32122 |
| 518 | Ga0501070_0083637 | 3300049586 | Bacteria | 2642 |
| 519 | Ga0501072_0008617 | 3300049588 | Bacteria | 7741 |
| 520 | Ga0501073_0002029 | 3300049589 | Bacteria | 15122 |
| 521 | Ga0501073_0019315 | 3300049589 | Bacteria | 4920 |
| 522 | Ga0501074_0000097 | 3300049590 | Bacteria | 42311 |
| 523 | Ga0501074_0024375 | 3300049590 | Bacteria | 4397 |
| 524 | Ga0501075_0227323 | 3300049591 | Bacteria | 1423 |
| 525 | Ga0501236_012178 | 3300049670 | Bacteria | 1155 |
| 526 | Ga0501079_0057664 | 3300049741 | Bacteria | 2996 |
| 527 | Ga0501079_0168548 | 3300049741 | Bacteria | 1708 |
| 528 | Ga0501079_0637094 | 3300049741 | Unclassified | 839 |
| 529 | Ga0501080_0002441 | 3300049742 | Bacteria | 16251 |
| 530 | Ga0501080_0191385 | 3300049742 | Bacteria | 1880 |
| 531 | Ga0501080_0338226 | 3300049742 | Bacteria | 1360 |
| 532 | Ga0501081_0037793 | 3300049743 | Bacteria | 3295 |
| 533 | Ga0501081_0157186 | 3300049743 | Bacteria | 1636 |
| 534 | Ga0501083_0002426 | 3300049744 | Bacteria | 12758 |
| 535 | Ga0501083_0036118 | 3300049744 | Bacteria | 3372 |
| 536 | Ga0501083_0127752 | 3300049744 | Bacteria | 1666 |
| 537 | Ga0501280_003541 | 3300049776 | Bacteria | 2389 |
| 538 | Ga0501282_008168 | 3300049778 | Bacteria | 1121 |
| 539 | Ga0501044_0026133 | 3300049823 | Bacteria | 6183 |
| 540 | nmdc:mga0yw44_460155_c1 | 3300050492 | Bacteria | 862 |
| 541 | nmdc:mga0k408_153227_c1 | 3300050493 | Bacteria | 1373 |
| 542 | nmdc:mga0k408_16043_c1 | 3300050493 | Bacteria | 4149 |
| 543 | nmdc:mga0k408_367889_c1 | 3300050493 | Bacteria | 857 |
| 544 | nmdc:mga07m45_120901_c1 | 3300050496 | Bacteria | 1512 |
| 545 | nmdc:mga05p37_1083389_c1 | 3300050507 | Bacteria | 841 |
| 546 | nmdc:mga05p37_34342_c1 | 3300050507 | Bacteria | 6211 |
| 547 | nmdc:mga05p37_634667_c1 | 3300050507 | Bacteria | 1199 |
| 548 | nmdc:mga09592_152375_c1 | 3300050508 | Bacteria | 1995 |
| 549 | nmdc:mga09592_345373_c1 | 3300050508 | Bacteria | 1288 |
| 550 | nmdc:mga09592_548895_c1 | 3300050508 | Bacteria | 993 |
| 551 | nmdc:mga0qj67_293433_c1 | 3300050509 | Bacteria | 1318 |
| 552 | nmdc:mga0qj67_35567_c1 | 3300050509 | Bacteria | 3895 |
| 553 | nmdc:mga06r32_281241_c1 | 3300050510 | Bacteria | 1651 |
| 554 | nmdc:mga06r32_982498_c1 | 3300050510 | Unclassified | 798 |
| 555 | nmdc:mga08y16_1100665_c1 | 3300050511 | Unclassified | 769 |
| 556 | nmdc:mga08y16_52711_c1 | 3300050511 | Bacteria | 3505 |
| 557 | nmdc:mga08y16_585_c1 | 3300050511 | Bacteria | 33898 |
| 558 | nmdc:mga0n895_1811_c1 | 3300050512 | Bacteria | 16267 |
| 559 | nmdc:mga0n895_74764_c1 | 3300050512 | Bacteria | 3366 |
| 560 | nmdc:mga0n895_774982_c1 | 3300050512 | Bacteria | 951 |
| 561 | nmdc:mga0rr50_1193_c1 | 3300050513 | Bacteria | 14104 |
| 562 | nmdc:mga0rr50_22826_c1 | 3300050513 | Bacteria | 4302 |
| 563 | nmdc:mga0rr50_231443_c1 | 3300050513 | Bacteria | 1529 |
| 564 | nmdc:mga0rr50_331385_c1 | 3300050513 | Bacteria | 1278 |
| 565 | nmdc:mga08x19_11345_c1 | 3300050514 | Bacteria | 5364 |
| 566 | nmdc:mga08x19_14467_c1 | 3300050514 | Bacteria | 4785 |
| 567 | nmdc:mga08x19_151057_c1 | 3300050514 | Bacteria | 1573 |
| 568 | nmdc:mga08x19_56189_c1 | 3300050514 | Bacteria | 2540 |
| 569 | nmdc:mga08x19_762_c1 | 3300050514 | Bacteria | 20508 |
| 570 | nmdc:mga0a205_308622_c1 | 3300050515 | Bacteria | 1454 |
| 571 | nmdc:mga0a205_331743_c1 | 3300050515 | Bacteria | 1391 |
| 572 | nmdc:mga0a205_390300_c1 | 3300050515 | Bacteria | 1256 |
| 573 | nmdc:mga0a205_393219_c1 | 3300050515 | Bacteria | 1250 |
| 574 | nmdc:mga0a205_41071_c1 | 3300050515 | Bacteria | 4454 |
| 575 | nmdc:mga0sz30_49409_c1 | 3300050516 | Bacteria | 1782 |
| 576 | Ga0495601_0030984 | 3300053077 | Bacteria | 3324 |
| 577 | Ga0495595_0067123 | 3300053084 | Bacteria | 1690 |
| 578 | Ga0495619_0517778 | 3300053085 | Bacteria | 820 |
| 579 | Ga0501082_0022516 | 3300060353 | Bacteria | 5427 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_0749296 | Ga0436365_0749296_264_872 | 190 |
| 2 | 3300048908 | Ga0496105_0051995 | Ga0496105_0051995_844_1443 | 190 |
| 3 | 3300035691 | Ga0373931_0574672 | Ga0373931_0574672_26_640 | 194 |
| 4 | 3300005328 | Ga0070676_10052499 | Ga0070676_100524992 | 195 |
| 5 | 3300005331 | Ga0070670_100106030 | Ga0070670_1001060302 | 195 |
| 6 | 3300005334 | Ga0068869_100005354 | Ga0068869_1000053546 | 195 |
| 7 | 3300005338 | Ga0068868_100032519 | Ga0068868_1000325195 | 195 |
| 8 | 3300005353 | Ga0070669_100091361 | Ga0070669_1000913613 | 195 |
| 9 | 3300005367 | Ga0070667_100381682 | Ga0070667_1003816822 | 195 |
| 10 | 3300005455 | Ga0070663_100361079 | Ga0070663_1003610792 | 195 |
| 11 | 3300005564 | Ga0070664_100268178 | Ga0070664_1002681782 | 195 |
| 12 | 3300005577 | Ga0068857_100652860 | Ga0068857_1006528602 | 195 |
| 13 | 3300005617 | Ga0068859_100346026 | Ga0068859_1003460262 | 195 |
| 14 | 3300005842 | Ga0068858_100154349 | Ga0068858_1001543493 | 195 |
| 15 | 3300006931 | Ga0097620_100346057 | Ga0097620_1003460572 | 195 |
| 16 | 3300009098 | Ga0105245_10299721 | Ga0105245_102997212 | 195 |
| 17 | 3300010375 | Ga0105239_10762649 | Ga0105239_107626492 | 195 |
| 18 | 3300013102 | Ga0157371_10263841 | Ga0157371_102638412 | 195 |
| 19 | 3300013306 | Ga0163162_11132043 | Ga0163162_111320432 | 195 |
| 20 | 3300013308 | Ga0157375_10085494 | Ga0157375_100854944 | 195 |
| 21 | 3300014326 | Ga0157380_10838826 | Ga0157380_108388262 | 195 |
| 22 | 3300014745 | Ga0157377_10238744 | Ga0157377_102387442 | 195 |
| 23 | 3300025925 | Ga0207650_10336209 | Ga0207650_103362092 | 195 |
| 24 | 3300025942 | Ga0207689_10011552 | Ga0207689_100115524 | 195 |
| 25 | 3300025945 | Ga0207679_10241729 | Ga0207679_102417292 | 195 |
| 26 | 3300025986 | Ga0207658_10705635 | Ga0207658_107056351 | 195 |
| 27 | 3300026035 | Ga0207703_10428602 | Ga0207703_104286022 | 195 |
| 28 | 3300026089 | Ga0207648_10389906 | Ga0207648_103899062 | 195 |
| 29 | 3300026116 | Ga0207674_10264404 | Ga0207674_102644042 | 195 |
| 30 | 3300026118 | Ga0207675_100270444 | Ga0207675_1002704443 | 195 |
| 31 | 3300048905 | Ga0496102_0129191 | Ga0496102_0129191_557_1210 | 195 |
| 32 | 3300048909 | Ga0496106_0272286 | Ga0496106_0272286_274_927 | 195 |
| 33 | 3300048913 | Ga0496110_0382090 | Ga0496110_0382090_87_740 | 195 |
| 34 | 3300025928 | Ga0207700_10103976 | Ga0207700_101039761 | 196 |
| 35 | 3300005444 | Ga0070694_100218433 | Ga0070694_1002184332 | 197 |
| 36 | 3300005544 | Ga0070686_100144024 | Ga0070686_1001440242 | 197 |
| 37 | 3300005546 | Ga0070696_100188778 | Ga0070696_1001887782 | 197 |
| 38 | 3300005617 | Ga0068859_100020990 | Ga0068859_1000209905 | 197 |
| 39 | 3300005719 | Ga0068861_100184270 | Ga0068861_1001842702 | 197 |
| 40 | 3300006931 | Ga0097620_100020988 | Ga0097620_1000209885 | 197 |
| 41 | 3300014326 | Ga0157380_10103078 | Ga0157380_101030781 | 197 |
| 42 | 3300026118 | Ga0207675_100064181 | Ga0207675_1000641814 | 197 |
| 43 | 3300044712 | Ga0453684_1034077 | Ga0453684_1034077_39_743 | 205 |
| 44 | 3300049742 | Ga0501080_0191385 | Ga0501080_0191385_738_1382 | 207 |
| 45 | 3300006051 | Ga0075364_10289429 | Ga0075364_102894292 | 209 |
| 46 | 3300006358 | Ga0068871_100107005 | Ga0068871_1001070053 | 209 |
| 47 | 3300009177 | Ga0105248_10022713 | Ga0105248_100227135 | 209 |
| 48 | 3300025942 | Ga0207689_10060742 | Ga0207689_100607422 | 210 |
| 49 | 3300042876 | Ga0451577_0321625 | Ga0451577_0321625_385_1038 | 211 |
| 50 | 3300005844 | Ga0068862_100038228 | Ga0068862_1000382282 | 213 |
| 51 | 3300028800 | Ga0265338_10241669 | Ga0265338_102416692 | 213 |
| 52 | 3300031249 | Ga0265339_10069485 | Ga0265339_100694852 | 213 |
| 53 | 3300031711 | Ga0265314_10081086 | Ga0265314_100810863 | 213 |
| 54 | 3300049571 | Ga0501034_0178834 | Ga0501034_0178834_708_1412 | 213 |
| 55 | 3300049581 | Ga0501047_0039309 | Ga0501047_0039309_2179_2883 | 213 |
| 56 | 3300049583 | Ga0501067_0014774 | Ga0501067_0014774_138_845 | 213 |
| 57 | 3300049585 | Ga0501069_0007055 | Ga0501069_0007055_3155_3859 | 213 |
| 58 | 3300049586 | Ga0501070_0000645 | Ga0501070_0000645_29975_30679 | 213 |
| 59 | 3300049589 | Ga0501073_0002029 | Ga0501073_0002029_5736_6440 | 213 |
| 60 | 3300049590 | Ga0501074_0000097 | Ga0501074_0000097_730_1434 | 213 |
| 61 | 3300049741 | Ga0501079_0057664 | Ga0501079_0057664_196_900 | 213 |
| 62 | 3300049742 | Ga0501080_0338226 | Ga0501080_0338226_253_957 | 213 |
| 63 | 3300049744 | Ga0501083_0002426 | Ga0501083_0002426_574_1278 | 213 |
| 64 | 3300049823 | Ga0501044_0026133 | Ga0501044_0026133_3142_3846 | 213 |
| 65 | 3300060353 | Ga0501082_0022516 | Ga0501082_0022516_2861_3565 | 213 |
| 66 | 3300003203 | JGI25406J46586_10078424 | JGI25406J46586_100784242 | 214 |
| 67 | 3300005327 | Ga0070658_10001128 | Ga0070658_1000112821 | 214 |
| 68 | 3300005327 | Ga0070658_10045857 | Ga0070658_100458574 | 214 |
| 69 | 3300005327 | Ga0070658_10071603 | Ga0070658_100716033 | 214 |
| 70 | 3300005327 | Ga0070658_10287415 | Ga0070658_102874152 | 214 |
| 71 | 3300005329 | Ga0070683_100633332 | Ga0070683_1006333321 | 214 |
| 72 | 3300005330 | Ga0070690_100000207 | Ga0070690_10000020719 | 214 |
| 73 | 3300005330 | Ga0070690_100044209 | Ga0070690_1000442092 | 214 |
| 74 | 3300005330 | Ga0070690_100233906 | Ga0070690_1002339062 | 214 |
| 75 | 3300005334 | Ga0068869_100001484 | Ga0068869_10000148411 | 214 |
| 76 | 3300005334 | Ga0068869_100204745 | Ga0068869_1002047452 | 214 |
| 77 | 3300005336 | Ga0070680_100144545 | Ga0070680_1001445452 | 214 |
| 78 | 3300005336 | Ga0070680_100371454 | Ga0070680_1003714542 | 214 |
| 79 | 3300005336 | Ga0070680_100387132 | Ga0070680_1003871322 | 214 |
| 80 | 3300005336 | Ga0070680_100439236 | Ga0070680_1004392362 | 214 |
| 81 | 3300005338 | Ga0068868_100084771 | Ga0068868_1000847712 | 214 |
| 82 | 3300005338 | Ga0068868_100160562 | Ga0068868_1001605622 | 214 |
| 83 | 3300005338 | Ga0068868_100164353 | Ga0068868_1001643532 | 214 |
| 84 | 3300005338 | Ga0068868_100841264 | Ga0068868_1008412641 | 214 |
| 85 | 3300005339 | Ga0070660_100448750 | Ga0070660_1004487502 | 214 |
| 86 | 3300005340 | Ga0070689_100000632 | Ga0070689_1000006321 | 214 |
| 87 | 3300005340 | Ga0070689_100053863 | Ga0070689_1000538633 | 214 |
| 88 | 3300005340 | Ga0070689_100196062 | Ga0070689_1001960622 | 214 |
| 89 | 3300005341 | Ga0070691_10301503 | Ga0070691_103015032 | 214 |
| 90 | 3300005343 | Ga0070687_100051522 | Ga0070687_1000515223 | 214 |
| 91 | 3300005343 | Ga0070687_100090317 | Ga0070687_1000903172 | 214 |
| 92 | 3300005343 | Ga0070687_100279606 | Ga0070687_1002796062 | 214 |
| 93 | 3300005344 | Ga0070661_100098543 | Ga0070661_1000985433 | 214 |
| 94 | 3300005345 | Ga0070692_10000846 | Ga0070692_1000084610 | 214 |
| 95 | 3300005345 | Ga0070692_10167776 | Ga0070692_101677762 | 214 |
| 96 | 3300005354 | Ga0070675_100020756 | Ga0070675_1000207566 | 214 |
| 97 | 3300005354 | Ga0070675_100191734 | Ga0070675_1001917342 | 214 |
| 98 | 3300005356 | Ga0070674_100012416 | Ga0070674_1000124165 | 214 |
| 99 | 3300005356 | Ga0070674_100358624 | Ga0070674_1003586242 | 214 |
| 100 | 3300005364 | Ga0070673_100285170 | Ga0070673_1002851701 | 214 |
| 101 | 3300005364 | Ga0070673_100294769 | Ga0070673_1002947692 | 214 |
| 102 | 3300005364 | Ga0070673_100417945 | Ga0070673_1004179452 | 214 |
| 103 | 3300005366 | Ga0070659_100029685 | Ga0070659_1000296853 | 214 |
| 104 | 3300005435 | Ga0070714_100083896 | Ga0070714_1000838963 | 214 |
| 105 | 3300005435 | Ga0070714_100708320 | Ga0070714_1007083202 | 214 |
| 106 | 3300005436 | Ga0070713_100706303 | Ga0070713_1007063032 | 214 |
| 107 | 3300005437 | Ga0070710_10194251 | Ga0070710_101942512 | 214 |
| 108 | 3300005438 | Ga0070701_10001232 | Ga0070701_1000123210 | 214 |
| 109 | 3300005438 | Ga0070701_10067387 | Ga0070701_100673873 | 214 |
| 110 | 3300005438 | Ga0070701_10124941 | Ga0070701_101249412 | 214 |
| 111 | 3300005439 | Ga0070711_100683540 | Ga0070711_1006835401 | 214 |
| 112 | 3300005440 | Ga0070705_100013296 | Ga0070705_1000132964 | 214 |
| 113 | 3300005440 | Ga0070705_100262892 | Ga0070705_1002628922 | 214 |
| 114 | 3300005440 | Ga0070705_100451374 | Ga0070705_1004513742 | 214 |
| 115 | 3300005441 | Ga0070700_100000469 | Ga0070700_1000004695 | 214 |
| 116 | 3300005441 | Ga0070700_100001919 | Ga0070700_1000019193 | 214 |
| 117 | 3300005441 | Ga0070700_100498814 | Ga0070700_1004988141 | 214 |
| 118 | 3300005444 | Ga0070694_100053353 | Ga0070694_1000533532 | 214 |
| 119 | 3300005456 | Ga0070678_100003745 | Ga0070678_1000037453 | 214 |
| 120 | 3300005456 | Ga0070678_100555131 | Ga0070678_1005551312 | 214 |
| 121 | 3300005458 | Ga0070681_10008404 | Ga0070681_100084049 | 214 |
| 122 | 3300005458 | Ga0070681_10140371 | Ga0070681_101403712 | 214 |
| 123 | 3300005458 | Ga0070681_10300559 | Ga0070681_103005592 | 214 |
| 124 | 3300005458 | Ga0070681_10485846 | Ga0070681_104858462 | 214 |
| 125 | 3300005459 | Ga0068867_100005845 | Ga0068867_1000058452 | 214 |
| 126 | 3300005459 | Ga0068867_100268773 | Ga0068867_1002687731 | 214 |
| 127 | 3300005466 | Ga0070685_10017590 | Ga0070685_100175902 | 214 |
| 128 | 3300005466 | Ga0070685_10323348 | Ga0070685_103233482 | 214 |
| 129 | 3300005467 | Ga0070706_100554464 | Ga0070706_1005544642 | 214 |
| 130 | 3300005471 | Ga0070698_100226024 | Ga0070698_1002260241 | 214 |
| 131 | 3300005471 | Ga0070698_100329896 | Ga0070698_1003298962 | 214 |
| 132 | 3300005471 | Ga0070698_100342669 | Ga0070698_1003426691 | 214 |
| 133 | 3300005518 | Ga0070699_100036349 | Ga0070699_1000363492 | 214 |
| 134 | 3300005518 | Ga0070699_100121097 | Ga0070699_1001210972 | 214 |
| 135 | 3300005530 | Ga0070679_100088129 | Ga0070679_1000881293 | 214 |
| 136 | 3300005530 | Ga0070679_100209406 | Ga0070679_1002094062 | 214 |
| 137 | 3300005530 | Ga0070679_100240010 | Ga0070679_1002400102 | 214 |
| 138 | 3300005535 | Ga0070684_100117324 | Ga0070684_1001173242 | 214 |
| 139 | 3300005535 | Ga0070684_100377981 | Ga0070684_1003779812 | 214 |
| 140 | 3300005536 | Ga0070697_100217708 | Ga0070697_1002177082 | 214 |
| 141 | 3300005536 | Ga0070697_100288039 | Ga0070697_1002880392 | 214 |
| 142 | 3300005536 | Ga0070697_100819900 | Ga0070697_1008199002 | 214 |
| 143 | 3300005539 | Ga0068853_100538453 | Ga0068853_1005384531 | 214 |
| 144 | 3300005544 | Ga0070686_100003579 | Ga0070686_1000035799 | 214 |
| 145 | 3300005544 | Ga0070686_100104130 | Ga0070686_1001041302 | 214 |
| 146 | 3300005544 | Ga0070686_100315459 | Ga0070686_1003154592 | 214 |
| 147 | 3300005545 | Ga0070695_100003131 | Ga0070695_1000031314 | 214 |
| 148 | 3300005545 | Ga0070695_100090722 | Ga0070695_1000907222 | 214 |
| 149 | 3300005546 | Ga0070696_100001158 | Ga0070696_1000011588 | 214 |
| 150 | 3300005546 | Ga0070696_100017398 | Ga0070696_1000173984 | 214 |
| 151 | 3300005546 | Ga0070696_100023822 | Ga0070696_1000238225 | 214 |
| 152 | 3300005546 | Ga0070696_100110857 | Ga0070696_1001108571 | 214 |
| 153 | 3300005546 | Ga0070696_100135591 | Ga0070696_1001355911 | 214 |
| 154 | 3300005546 | Ga0070696_100223403 | Ga0070696_1002234031 | 214 |
| 155 | 3300005546 | Ga0070696_100624300 | Ga0070696_1006243002 | 214 |
| 156 | 3300005547 | Ga0070693_100004968 | Ga0070693_1000049682 | 214 |
| 157 | 3300005547 | Ga0070693_100195864 | Ga0070693_1001958642 | 214 |
| 158 | 3300005547 | Ga0070693_100223525 | Ga0070693_1002235252 | 214 |
| 159 | 3300005547 | Ga0070693_100252764 | Ga0070693_1002527641 | 214 |
| 160 | 3300005548 | Ga0070665_100154374 | Ga0070665_1001543743 | 214 |
| 161 | 3300005549 | Ga0070704_100073216 | Ga0070704_1000732162 | 214 |
| 162 | 3300005549 | Ga0070704_100286029 | Ga0070704_1002860292 | 214 |
| 163 | 3300005549 | Ga0070704_100318611 | Ga0070704_1003186112 | 214 |
| 164 | 3300005549 | Ga0070704_100388592 | Ga0070704_1003885922 | 214 |
| 165 | 3300005549 | Ga0070704_100514617 | Ga0070704_1005146172 | 214 |
| 166 | 3300005563 | Ga0068855_100011589 | Ga0068855_10001158911 | 214 |
| 167 | 3300005563 | Ga0068855_100014368 | Ga0068855_1000143687 | 214 |
| 168 | 3300005563 | Ga0068855_100048384 | Ga0068855_1000483842 | 214 |
| 169 | 3300005563 | Ga0068855_100492747 | Ga0068855_1004927472 | 214 |
| 170 | 3300005564 | Ga0070664_100506916 | Ga0070664_1005069162 | 214 |
| 171 | 3300005564 | Ga0070664_100892127 | Ga0070664_1008921272 | 214 |
| 172 | 3300005577 | Ga0068857_100070065 | Ga0068857_1000700653 | 214 |
| 173 | 3300005578 | Ga0068854_100215087 | Ga0068854_1002150872 | 214 |
| 174 | 3300005578 | Ga0068854_100342067 | Ga0068854_1003420672 | 214 |
| 175 | 3300005614 | Ga0068856_100146416 | Ga0068856_1001464163 | 214 |
| 176 | 3300005614 | Ga0068856_101109630 | Ga0068856_1011096301 | 214 |
| 177 | 3300005615 | Ga0070702_100000215 | Ga0070702_10000021510 | 214 |
| 178 | 3300005615 | Ga0070702_100625537 | Ga0070702_1006255371 | 214 |
| 179 | 3300005616 | Ga0068852_100000280 | Ga0068852_10000028011 | 214 |
| 180 | 3300005616 | Ga0068852_100006538 | Ga0068852_1000065383 | 214 |
| 181 | 3300005616 | Ga0068852_100015175 | Ga0068852_1000151753 | 214 |
| 182 | 3300005616 | Ga0068852_100249020 | Ga0068852_1002490202 | 214 |
| 183 | 3300005617 | Ga0068859_100230670 | Ga0068859_1002306703 | 214 |
| 184 | 3300005617 | Ga0068859_100574618 | Ga0068859_1005746182 | 214 |
| 185 | 3300005618 | Ga0068864_100241759 | Ga0068864_1002417592 | 214 |
| 186 | 3300005618 | Ga0068864_100386447 | Ga0068864_1003864472 | 214 |
| 187 | 3300005718 | Ga0068866_10000298 | Ga0068866_1000029810 | 214 |
| 188 | 3300005718 | Ga0068866_10201479 | Ga0068866_102014792 | 214 |
| 189 | 3300005718 | Ga0068866_10317056 | Ga0068866_103170562 | 214 |
| 190 | 3300005719 | Ga0068861_100000393 | Ga0068861_10000039316 | 214 |
| 191 | 3300005834 | Ga0068851_10000350 | Ga0068851_100003502 | 214 |
| 192 | 3300005840 | Ga0068870_10006603 | Ga0068870_100066033 | 214 |
| 193 | 3300005840 | Ga0068870_10085893 | Ga0068870_100858932 | 214 |
| 194 | 3300005842 | Ga0068858_100000730 | Ga0068858_1000007306 | 214 |
| 195 | 3300005842 | Ga0068858_100046556 | Ga0068858_1000465563 | 214 |
| 196 | 3300005842 | Ga0068858_100095592 | Ga0068858_1000955923 | 214 |
| 197 | 3300005843 | Ga0068860_100006996 | Ga0068860_1000069967 | 214 |
| 198 | 3300005843 | Ga0068860_100264001 | Ga0068860_1002640012 | 214 |
| 199 | 3300005843 | Ga0068860_100786103 | Ga0068860_1007861032 | 214 |
| 200 | 3300005844 | Ga0068862_100009410 | Ga0068862_1000094106 | 214 |
| 201 | 3300005985 | Ga0081539_10001863 | Ga0081539_1000186320 | 214 |
| 202 | 3300006051 | Ga0075364_10095872 | Ga0075364_100958723 | 214 |
| 203 | 3300006173 | Ga0070716_100462728 | Ga0070716_1004627282 | 214 |
| 204 | 3300006173 | Ga0070716_100581596 | Ga0070716_1005815962 | 214 |
| 205 | 3300006186 | Ga0075369_10014355 | Ga0075369_100143553 | 214 |
| 206 | 3300006195 | Ga0075366_10040848 | Ga0075366_100408482 | 214 |
| 207 | 3300006237 | Ga0097621_100003061 | Ga0097621_1000030619 | 214 |
| 208 | 3300006237 | Ga0097621_100014117 | Ga0097621_1000141173 | 214 |
| 209 | 3300006237 | Ga0097621_100339842 | Ga0097621_1003398422 | 214 |
| 210 | 3300006237 | Ga0097621_100696982 | Ga0097621_1006969822 | 214 |
| 211 | 3300006353 | Ga0075370_10081940 | Ga0075370_100819402 | 214 |
| 212 | 3300006353 | Ga0075370_10226379 | Ga0075370_102263792 | 214 |
| 213 | 3300006358 | Ga0068871_100000782 | Ga0068871_1000007827 | 214 |
| 214 | 3300006358 | Ga0068871_100058527 | Ga0068871_1000585275 | 214 |
| 215 | 3300006358 | Ga0068871_100326139 | Ga0068871_1003261392 | 214 |
| 216 | 3300006844 | Ga0075428_100433961 | Ga0075428_1004339612 | 214 |
| 217 | 3300006846 | Ga0075430_100040553 | Ga0075430_1000405534 | 214 |
| 218 | 3300006847 | Ga0075431_100105958 | Ga0075431_1001059583 | 214 |
| 219 | 3300006847 | Ga0075431_100123489 | Ga0075431_1001234892 | 214 |
| 220 | 3300006847 | Ga0075431_100416855 | Ga0075431_1004168552 | 214 |
| 221 | 3300006852 | Ga0075433_10034242 | Ga0075433_100342424 | 214 |
| 222 | 3300006852 | Ga0075433_10117196 | Ga0075433_101171962 | 214 |
| 223 | 3300006852 | Ga0075433_10331255 | Ga0075433_103312552 | 214 |
| 224 | 3300006852 | Ga0075433_10428725 | Ga0075433_104287252 | 214 |
| 225 | 3300006871 | Ga0075434_100000002 | Ga0075434_10000000277 | 214 |
| 226 | 3300006871 | Ga0075434_101166549 | Ga0075434_1011665491 | 214 |
| 227 | 3300006880 | Ga0075429_100129748 | Ga0075429_1001297482 | 214 |
| 228 | 3300006881 | Ga0068865_100000084 | Ga0068865_10000008436 | 214 |
| 229 | 3300006881 | Ga0068865_100137910 | Ga0068865_1001379102 | 214 |
| 230 | 3300006881 | Ga0068865_100236911 | Ga0068865_1002369112 | 214 |
| 231 | 3300006881 | Ga0068865_100904477 | Ga0068865_1009044771 | 214 |
| 232 | 3300006914 | Ga0075436_100001674 | Ga0075436_10000167414 | 214 |
| 233 | 3300006914 | Ga0075436_100009216 | Ga0075436_1000092163 | 214 |
| 234 | 3300006914 | Ga0075436_100018295 | Ga0075436_1000182952 | 214 |
| 235 | 3300006914 | Ga0075436_100067072 | Ga0075436_1000670722 | 214 |
| 236 | 3300006914 | Ga0075436_100117776 | Ga0075436_1001177761 | 214 |
| 237 | 3300006914 | Ga0075436_100457544 | Ga0075436_1004575441 | 214 |
| 238 | 3300006931 | Ga0097620_100230684 | Ga0097620_1002306843 | 214 |
| 239 | 3300006931 | Ga0097620_100574641 | Ga0097620_1005746412 | 214 |
| 240 | 3300007076 | Ga0075435_100004018 | Ga0075435_1000040183 | 214 |
| 241 | 3300007076 | Ga0075435_100062365 | Ga0075435_1000623652 | 214 |
| 242 | 3300007076 | Ga0075435_100211769 | Ga0075435_1002117692 | 214 |
| 243 | 3300009092 | Ga0105250_10089727 | Ga0105250_100897271 | 214 |
| 244 | 3300009093 | Ga0105240_10004564 | Ga0105240_100045649 | 214 |
| 245 | 3300009093 | Ga0105240_10071448 | Ga0105240_100714483 | 214 |
| 246 | 3300009093 | Ga0105240_10211192 | Ga0105240_102111923 | 214 |
| 247 | 3300009093 | Ga0105240_11023537 | Ga0105240_110235372 | 214 |
| 248 | 3300009094 | Ga0111539_10003186 | Ga0111539_1000318620 | 214 |
| 249 | 3300009094 | Ga0111539_10802926 | Ga0111539_108029262 | 214 |
| 250 | 3300009098 | Ga0105245_10000063 | Ga0105245_1000006389 | 214 |
| 251 | 3300009147 | Ga0114129_10028894 | Ga0114129_100288944 | 214 |
| 252 | 3300009147 | Ga0114129_10224424 | Ga0114129_102244242 | 214 |
| 253 | 3300009147 | Ga0114129_10370501 | Ga0114129_103705012 | 214 |
| 254 | 3300009147 | Ga0114129_10660045 | Ga0114129_106600452 | 214 |
| 255 | 3300009148 | Ga0105243_10001155 | Ga0105243_1000115516 | 214 |
| 256 | 3300009148 | Ga0105243_10039765 | Ga0105243_100397654 | 214 |
| 257 | 3300009148 | Ga0105243_10080444 | Ga0105243_100804442 | 214 |
| 258 | 3300009148 | Ga0105243_10186691 | Ga0105243_101866912 | 214 |
| 259 | 3300009174 | Ga0105241_10005299 | Ga0105241_100052999 | 214 |
| 260 | 3300009174 | Ga0105241_10042764 | Ga0105241_100427642 | 214 |
| 261 | 3300009174 | Ga0105241_10103780 | Ga0105241_101037802 | 214 |
| 262 | 3300009174 | Ga0105241_10263492 | Ga0105241_102634922 | 214 |
| 263 | 3300009174 | Ga0105241_10335171 | Ga0105241_103351712 | 214 |
| 264 | 3300009176 | Ga0105242_10001356 | Ga0105242_100013568 | 214 |
| 265 | 3300009176 | Ga0105242_10003831 | Ga0105242_100038319 | 214 |
| 266 | 3300009176 | Ga0105242_10155391 | Ga0105242_101553912 | 214 |
| 267 | 3300009176 | Ga0105242_10535094 | Ga0105242_105350942 | 214 |
| 268 | 3300009177 | Ga0105248_10098292 | Ga0105248_100982922 | 214 |
| 269 | 3300009177 | Ga0105248_10151287 | Ga0105248_101512872 | 214 |
| 270 | 3300009177 | Ga0105248_10564815 | Ga0105248_105648152 | 214 |
| 271 | 3300009177 | Ga0105248_10841248 | Ga0105248_108412482 | 214 |
| 272 | 3300009545 | Ga0105237_10008404 | Ga0105237_100084042 | 214 |
| 273 | 3300009551 | Ga0105238_10028411 | Ga0105238_100284114 | 214 |
| 274 | 3300009551 | Ga0105238_10110772 | Ga0105238_101107722 | 214 |
| 275 | 3300009551 | Ga0105238_10637216 | Ga0105238_106372162 | 214 |
| 276 | 3300009551 | Ga0105238_10917566 | Ga0105238_109175662 | 214 |
| 277 | 3300009551 | Ga0105238_10971464 | Ga0105238_109714642 | 214 |
| 278 | 3300009553 | Ga0105249_10150073 | Ga0105249_101500732 | 214 |
| 279 | 3300009553 | Ga0105249_10156492 | Ga0105249_101564922 | 214 |
| 280 | 3300010375 | Ga0105239_10308196 | Ga0105239_103081962 | 214 |
| 281 | 3300011119 | Ga0105246_10137781 | Ga0105246_101377812 | 214 |
| 282 | 3300013104 | Ga0157370_10013031 | Ga0157370_100130317 | 214 |
| 283 | 3300013104 | Ga0157370_10697592 | Ga0157370_106975922 | 214 |
| 284 | 3300013105 | Ga0157369_10000349 | Ga0157369_1000034911 | 214 |
| 285 | 3300013105 | Ga0157369_10404989 | Ga0157369_104049892 | 214 |
| 286 | 3300013296 | Ga0157374_10075981 | Ga0157374_100759811 | 214 |
| 287 | 3300013296 | Ga0157374_10660580 | Ga0157374_106605802 | 214 |
| 288 | 3300013297 | Ga0157378_10001267 | Ga0157378_1000126716 | 214 |
| 289 | 3300013297 | Ga0157378_10060026 | Ga0157378_100600263 | 214 |
| 290 | 3300013297 | Ga0157378_10214428 | Ga0157378_102144282 | 214 |
| 291 | 3300013306 | Ga0163162_10186708 | Ga0163162_101867082 | 214 |
| 292 | 3300013306 | Ga0163162_10437930 | Ga0163162_104379302 | 214 |
| 293 | 3300013306 | Ga0163162_10766455 | Ga0163162_107664552 | 214 |
| 294 | 3300013307 | Ga0157372_10006727 | Ga0157372_1000672712 | 214 |
| 295 | 3300013307 | Ga0157372_10154709 | Ga0157372_101547094 | 214 |
| 296 | 3300013307 | Ga0157372_10243396 | Ga0157372_102433962 | 214 |
| 297 | 3300013307 | Ga0157372_10474389 | Ga0157372_104743892 | 214 |
| 298 | 3300013307 | Ga0157372_10883453 | Ga0157372_108834531 | 214 |
| 299 | 3300013308 | Ga0157375_10052169 | Ga0157375_100521693 | 214 |
| 300 | 3300013308 | Ga0157375_10114069 | Ga0157375_101140692 | 214 |
| 301 | 3300013308 | Ga0157375_10168153 | Ga0157375_101681532 | 214 |
| 302 | 3300013308 | Ga0157375_10475804 | Ga0157375_104758041 | 214 |
| 303 | 3300014325 | Ga0163163_11073296 | Ga0163163_110732962 | 214 |
| 304 | 3300014326 | Ga0157380_10025735 | Ga0157380_100257354 | 214 |
| 305 | 3300014326 | Ga0157380_10107020 | Ga0157380_101070202 | 214 |
| 306 | 3300014326 | Ga0157380_10552303 | Ga0157380_105523032 | 214 |
| 307 | 3300014745 | Ga0157377_10020294 | Ga0157377_100202942 | 214 |
| 308 | 3300014968 | Ga0157379_10004490 | Ga0157379_100044907 | 214 |
| 309 | 3300014968 | Ga0157379_10099171 | Ga0157379_100991713 | 214 |
| 310 | 3300014968 | Ga0157379_10277898 | Ga0157379_102778982 | 214 |
| 311 | 3300014968 | Ga0157379_10321606 | Ga0157379_103216062 | 214 |
| 312 | 3300014969 | Ga0157376_10664189 | Ga0157376_106641892 | 214 |
| 313 | 3300017792 | Ga0163161_10021559 | Ga0163161_100215592 | 214 |
| 314 | 3300021384 | Ga0213876_10017617 | Ga0213876_100176173 | 214 |
| 315 | 3300025899 | Ga0207642_10006974 | Ga0207642_100069744 | 214 |
| 316 | 3300025905 | Ga0207685_10092233 | Ga0207685_100922332 | 214 |
| 317 | 3300025908 | Ga0207643_10005404 | Ga0207643_100054047 | 214 |
| 318 | 3300025908 | Ga0207643_10013492 | Ga0207643_100134925 | 214 |
| 319 | 3300025909 | Ga0207705_10043075 | Ga0207705_100430753 | 214 |
| 320 | 3300025909 | Ga0207705_10078860 | Ga0207705_100788603 | 214 |
| 321 | 3300025909 | Ga0207705_10124592 | Ga0207705_101245922 | 214 |
| 322 | 3300025909 | Ga0207705_10778710 | Ga0207705_107787101 | 214 |
| 323 | 3300025910 | Ga0207684_10312989 | Ga0207684_103129892 | 214 |
| 324 | 3300025911 | Ga0207654_10029944 | Ga0207654_100299442 | 214 |
| 325 | 3300025912 | Ga0207707_10041225 | Ga0207707_100412256 | 214 |
| 326 | 3300025912 | Ga0207707_10285036 | Ga0207707_102850362 | 214 |
| 327 | 3300025912 | Ga0207707_10342560 | Ga0207707_103425602 | 214 |
| 328 | 3300025912 | Ga0207707_10507467 | Ga0207707_105074672 | 214 |
| 329 | 3300025913 | Ga0207695_10021605 | Ga0207695_100216058 | 214 |
| 330 | 3300025913 | Ga0207695_10059570 | Ga0207695_100595703 | 214 |
| 331 | 3300025913 | Ga0207695_10107222 | Ga0207695_101072223 | 214 |
| 332 | 3300025913 | Ga0207695_10570022 | Ga0207695_105700222 | 214 |
| 333 | 3300025913 | Ga0207695_10925824 | Ga0207695_109258241 | 214 |
| 334 | 3300025914 | Ga0207671_10113569 | Ga0207671_101135692 | 214 |
| 335 | 3300025916 | Ga0207663_10064278 | Ga0207663_100642781 | 214 |
| 336 | 3300025916 | Ga0207663_10647677 | Ga0207663_106476772 | 214 |
| 337 | 3300025917 | Ga0207660_10268139 | Ga0207660_102681392 | 214 |
| 338 | 3300025917 | Ga0207660_10273010 | Ga0207660_102730102 | 214 |
| 339 | 3300025917 | Ga0207660_10286458 | Ga0207660_102864582 | 214 |
| 340 | 3300025918 | Ga0207662_10031704 | Ga0207662_100317043 | 214 |
| 341 | 3300025919 | Ga0207657_10448543 | Ga0207657_104485432 | 214 |
| 342 | 3300025920 | Ga0207649_10121922 | Ga0207649_101219222 | 214 |
| 343 | 3300025921 | Ga0207652_10336340 | Ga0207652_103363401 | 214 |
| 344 | 3300025921 | Ga0207652_10450215 | Ga0207652_104502152 | 214 |
| 345 | 3300025922 | Ga0207646_10485010 | Ga0207646_104850102 | 214 |
| 346 | 3300025923 | Ga0207681_10330920 | Ga0207681_103309202 | 214 |
| 347 | 3300025924 | Ga0207694_10035293 | Ga0207694_100352932 | 214 |
| 348 | 3300025924 | Ga0207694_10264610 | Ga0207694_102646102 | 214 |
| 349 | 3300025924 | Ga0207694_10283384 | Ga0207694_102833842 | 214 |
| 350 | 3300025924 | Ga0207694_10719062 | Ga0207694_107190621 | 214 |
| 351 | 3300025925 | Ga0207650_10064294 | Ga0207650_100642943 | 214 |
| 352 | 3300025926 | Ga0207659_10010298 | Ga0207659_100102986 | 214 |
| 353 | 3300025926 | Ga0207659_10590325 | Ga0207659_105903251 | 214 |
| 354 | 3300025927 | Ga0207687_10005312 | Ga0207687_100053122 | 214 |
| 355 | 3300025927 | Ga0207687_10038895 | Ga0207687_100388952 | 214 |
| 356 | 3300025928 | Ga0207700_10548757 | Ga0207700_105487571 | 214 |
| 357 | 3300025929 | Ga0207664_10152285 | Ga0207664_101522852 | 214 |
| 358 | 3300025932 | Ga0207690_10015797 | Ga0207690_100157973 | 214 |
| 359 | 3300025934 | Ga0207686_10001462 | Ga0207686_100014627 | 214 |
| 360 | 3300025934 | Ga0207686_10003331 | Ga0207686_100033314 | 214 |
| 361 | 3300025934 | Ga0207686_10123507 | Ga0207686_101235072 | 214 |
| 362 | 3300025934 | Ga0207686_10226145 | Ga0207686_102261452 | 214 |
| 363 | 3300025934 | Ga0207686_10307077 | Ga0207686_103070772 | 214 |
| 364 | 3300025935 | Ga0207709_10003470 | Ga0207709_100034703 | 214 |
| 365 | 3300025935 | Ga0207709_10045987 | Ga0207709_100459872 | 214 |
| 366 | 3300025935 | Ga0207709_10110389 | Ga0207709_101103892 | 214 |
| 367 | 3300025935 | Ga0207709_10296818 | Ga0207709_102968182 | 214 |
| 368 | 3300025935 | Ga0207709_10467774 | Ga0207709_104677741 | 214 |
| 369 | 3300025936 | Ga0207670_10290363 | Ga0207670_102903632 | 214 |
| 370 | 3300025937 | Ga0207669_10070021 | Ga0207669_100700212 | 214 |
| 371 | 3300025937 | Ga0207669_10228658 | Ga0207669_102286582 | 214 |
| 372 | 3300025938 | Ga0207704_10000948 | Ga0207704_100009485 | 214 |
| 373 | 3300025938 | Ga0207704_10209392 | Ga0207704_102093922 | 214 |
| 374 | 3300025938 | Ga0207704_10317931 | Ga0207704_103179312 | 214 |
| 375 | 3300025938 | Ga0207704_10447928 | Ga0207704_104479282 | 214 |
| 376 | 3300025938 | Ga0207704_10661603 | Ga0207704_106616031 | 214 |
| 377 | 3300025939 | Ga0207665_10019784 | Ga0207665_100197843 | 214 |
| 378 | 3300025940 | Ga0207691_10016851 | Ga0207691_100168517 | 214 |
| 379 | 3300025941 | Ga0207711_10026199 | Ga0207711_100261995 | 214 |
| 380 | 3300025941 | Ga0207711_10070138 | Ga0207711_100701385 | 214 |
| 381 | 3300025941 | Ga0207711_10139985 | Ga0207711_101399852 | 214 |
| 382 | 3300025941 | Ga0207711_10677323 | Ga0207711_106773232 | 214 |
| 383 | 3300025942 | Ga0207689_10000152 | Ga0207689_1000015242 | 214 |
| 384 | 3300025945 | Ga0207679_10163736 | Ga0207679_101637362 | 214 |
| 385 | 3300025945 | Ga0207679_10627601 | Ga0207679_106276012 | 214 |
| 386 | 3300025949 | Ga0207667_10025530 | Ga0207667_100255302 | 214 |
| 387 | 3300025949 | Ga0207667_10027390 | Ga0207667_100273904 | 214 |
| 388 | 3300025949 | Ga0207667_10064821 | Ga0207667_100648213 | 214 |
| 389 | 3300025949 | Ga0207667_10106339 | Ga0207667_101063393 | 214 |
| 390 | 3300025949 | Ga0207667_10790524 | Ga0207667_107905242 | 214 |
| 391 | 3300025960 | Ga0207651_10355001 | Ga0207651_103550012 | 214 |
| 392 | 3300025961 | Ga0207712_10136756 | Ga0207712_101367562 | 214 |
| 393 | 3300025961 | Ga0207712_10397055 | Ga0207712_103970551 | 214 |
| 394 | 3300025981 | Ga0207640_10087739 | Ga0207640_100877393 | 214 |
| 395 | 3300025981 | Ga0207640_10133347 | Ga0207640_101333471 | 214 |
| 396 | 3300025981 | Ga0207640_10214788 | Ga0207640_102147882 | 214 |
| 397 | 3300025986 | Ga0207658_10612723 | Ga0207658_106127232 | 214 |
| 398 | 3300026023 | Ga0207677_10031150 | Ga0207677_100311502 | 214 |
| 399 | 3300026023 | Ga0207677_10076597 | Ga0207677_100765973 | 214 |
| 400 | 3300026023 | Ga0207677_10107202 | Ga0207677_101072022 | 214 |
| 401 | 3300026023 | Ga0207677_10759746 | Ga0207677_107597462 | 214 |
| 402 | 3300026035 | Ga0207703_10016607 | Ga0207703_100166075 | 214 |
| 403 | 3300026035 | Ga0207703_10121781 | Ga0207703_101217812 | 214 |
| 404 | 3300026041 | Ga0207639_10038467 | Ga0207639_100384674 | 214 |
| 405 | 3300026075 | Ga0207708_10000166 | Ga0207708_1000016635 | 214 |
| 406 | 3300026075 | Ga0207708_10017322 | Ga0207708_100173225 | 214 |
| 407 | 3300026075 | Ga0207708_10095882 | Ga0207708_100958822 | 214 |
| 408 | 3300026078 | Ga0207702_10142159 | Ga0207702_101421592 | 214 |
| 409 | 3300026078 | Ga0207702_10208666 | Ga0207702_102086662 | 214 |
| 410 | 3300026078 | Ga0207702_10228588 | Ga0207702_102285882 | 214 |
| 411 | 3300026078 | Ga0207702_10669465 | Ga0207702_106694652 | 214 |
| 412 | 3300026089 | Ga0207648_10000131 | Ga0207648_1000013115 | 214 |
| 413 | 3300026089 | Ga0207648_10062166 | Ga0207648_100621661 | 214 |
| 414 | 3300026089 | Ga0207648_10318485 | Ga0207648_103184852 | 214 |
| 415 | 3300026089 | Ga0207648_10322147 | Ga0207648_103221471 | 214 |
| 416 | 3300026089 | Ga0207648_10395975 | Ga0207648_103959752 | 214 |
| 417 | 3300026089 | Ga0207648_10545680 | Ga0207648_105456802 | 214 |
| 418 | 3300026095 | Ga0207676_10465945 | Ga0207676_104659452 | 214 |
| 419 | 3300026116 | Ga0207674_10008824 | Ga0207674_100088244 | 214 |
| 420 | 3300026118 | Ga0207675_100001354 | Ga0207675_10000135411 | 214 |
| 421 | 3300026118 | Ga0207675_101138126 | Ga0207675_1011381262 | 214 |
| 422 | 3300026121 | Ga0207683_10009460 | Ga0207683_100094603 | 214 |
| 423 | 3300026121 | Ga0207683_10012340 | Ga0207683_100123403 | 214 |
| 424 | 3300026121 | Ga0207683_10166274 | Ga0207683_101662742 | 214 |
| 425 | 3300026121 | Ga0207683_10423221 | Ga0207683_104232212 | 214 |
| 426 | 3300026121 | Ga0207683_10528326 | Ga0207683_105283262 | 214 |
| 427 | 3300026142 | Ga0207698_10003270 | Ga0207698_100032708 | 214 |
| 428 | 3300026142 | Ga0207698_10004206 | Ga0207698_100042062 | 214 |
| 429 | 3300027360 | Ga0209969_1029982 | Ga0209969_10299822 | 214 |
| 430 | 3300027462 | Ga0210000_1005848 | Ga0210000_10058482 | 214 |
| 431 | 3300027614 | Ga0209970_1008266 | Ga0209970_10082662 | 214 |
| 432 | 3300027695 | Ga0209966_1001918 | Ga0209966_10019182 | 214 |
| 433 | 3300027695 | Ga0209966_1012280 | Ga0209966_10122802 | 214 |
| 434 | 3300027717 | Ga0209998_10064217 | Ga0209998_100642172 | 214 |
| 435 | 3300027876 | Ga0209974_10023228 | Ga0209974_100232282 | 214 |
| 436 | 3300027907 | Ga0207428_10002577 | Ga0207428_1000257720 | 214 |
| 437 | 3300028380 | Ga0268265_10021816 | Ga0268265_100218165 | 214 |
| 438 | 3300028381 | Ga0268264_10016844 | Ga0268264_100168445 | 214 |
| 439 | 3300031548 | Ga0307408_100095275 | Ga0307408_1000952753 | 214 |
| 440 | 3300031548 | Ga0307408_100198227 | Ga0307408_1001982272 | 214 |
| 441 | 3300031548 | Ga0307408_100238807 | Ga0307408_1002388072 | 214 |
| 442 | 3300031548 | Ga0307408_100248789 | Ga0307408_1002487892 | 214 |
| 443 | 3300031548 | Ga0307408_100360948 | Ga0307408_1003609482 | 214 |
| 444 | 3300031548 | Ga0307408_100368805 | Ga0307408_1003688052 | 214 |
| 445 | 3300031548 | Ga0307408_100597885 | Ga0307408_1005978851 | 214 |
| 446 | 3300031731 | Ga0307405_10304901 | Ga0307405_103049011 | 214 |
| 447 | 3300031901 | Ga0307406_10267863 | Ga0307406_102678632 | 214 |
| 448 | 3300031901 | Ga0307406_10271753 | Ga0307406_102717532 | 214 |
| 449 | 3300031901 | Ga0307406_10811482 | Ga0307406_108114822 | 214 |
| 450 | 3300031911 | Ga0307412_10396380 | Ga0307412_103963801 | 214 |
| 451 | 3300031911 | Ga0307412_10493481 | Ga0307412_104934812 | 214 |
| 452 | 3300031911 | Ga0307412_10595535 | Ga0307412_105955352 | 214 |
| 453 | 3300031995 | Ga0307409_100156840 | Ga0307409_1001568403 | 214 |
| 454 | 3300032002 | Ga0307416_100252561 | Ga0307416_1002525612 | 214 |
| 455 | 3300032002 | Ga0307416_100322240 | Ga0307416_1003222402 | 214 |
| 456 | 3300032002 | Ga0307416_100568466 | Ga0307416_1005684662 | 214 |
| 457 | 3300032002 | Ga0307416_100833397 | Ga0307416_1008333972 | 214 |
| 458 | 3300032005 | Ga0307411_10597579 | Ga0307411_105975791 | 214 |
| 459 | 3300035084 | Ga0373928_0071385 | Ga0373928_0071385_12_656 | 214 |
| 460 | 3300035085 | Ga0373929_0055495 | Ga0373929_0055495_220_897 | 214 |
| 461 | 3300035090 | Ga0373949_0023738 | Ga0373949_0023738_538_1182 | 214 |
| 462 | 3300035115 | Ga0373941_0012088 | Ga0373941_0012088_21_665 | 214 |
| 463 | 3300035119 | Ga0373956_0266452 | Ga0373956_0266452_112_792 | 214 |
| 464 | 3300035120 | Ga0373957_0223689 | Ga0373957_0223689_108_758 | 214 |
| 465 | 3300035170 | Ga0373943_0291465 | Ga0373943_0291465_251_895 | 214 |
| 466 | 3300035172 | Ga0373955_0057054 | Ga0373955_0057054_1243_1923 | 214 |
| 467 | 3300035241 | Ga0373961_0097542 | Ga0373961_0097542_250_894 | 214 |
| 468 | 3300035242 | Ga0373962_0010642 | Ga0373962_0010642_324_968 | 214 |
| 469 | 3300035410 | Ga0373924_0007898 | Ga0373924_0007898_216_896 | 214 |
| 470 | 3300035691 | Ga0373931_0009772 | Ga0373931_0009772_2698_3375 | 214 |
| 471 | 3300035691 | Ga0373931_0311099 | Ga0373931_0311099_294_938 | 214 |
| 472 | 3300035691 | Ga0373931_0371158 | Ga0373931_0371158_147_791 | 214 |
| 473 | 3300035695 | Ga0373927_0086519 | Ga0373927_0086519_1105_1785 | 214 |
| 474 | 3300035695 | Ga0373927_0196449 | Ga0373927_0196449_644_1288 | 214 |
| 475 | 3300035725 | Ga0373947_0207843 | Ga0373947_0207843_383_1060 | 214 |
| 476 | 3300036401 | Ga0373937_0117836 | Ga0373937_0117836_62_742 | 214 |
| 477 | 3300036401 | Ga0373937_0188555 | Ga0373937_0188555_841_1521 | 214 |
| 478 | 3300037068 | Ga0373925_0051113 | Ga0373925_0051113_1822_2502 | 214 |
| 479 | 3300037068 | Ga0373925_0364727 | Ga0373925_0364727_81_761 | 214 |
| 480 | 3300037312 | Ga0395899_0273537 | Ga0395899_0273537_309_986 | 214 |
| 481 | 3300037471 | Ga0395905_0186083 | Ga0395905_0186083_1091_1768 | 214 |
| 482 | 3300038443 | Ga0395901_0107553 | Ga0395901_0107553_740_1417 | 214 |
| 483 | 3300039437 | Ga0436365_0234883 | Ga0436365_0234883_5358_6035 | 214 |
| 484 | 3300041407 | Ga0439447_017732 | Ga0439447_017732_540_1244 | 214 |
| 485 | 3300041501 | Ga0451845_0324412 | Ga0451845_0324412_242_919 | 214 |
| 486 | 3300042001 | Ga0439441_008321 | Ga0439441_008321_615_1295 | 214 |
| 487 | 3300042003 | Ga0439443_008880 | Ga0439443_008880_747_1391 | 214 |
| 488 | 3300042156 | Ga0439446_0027170 | Ga0439446_0027170_299_943 | 214 |
| 489 | 3300042461 | Ga0439460_0020812 | Ga0439460_0020812_161_805 | 214 |
| 490 | 3300044693 | Ga0466961_0192394 | Ga0466961_0192394_178_855 | 214 |
| 491 | 3300044719 | Ga0466971_0062066 | Ga0466971_0062066_608_1285 | 214 |
| 492 | 3300044901 | Ga0466960_0087637 | Ga0466960_0087637_621_1265 | 214 |
| 493 | 3300045049 | Ga0466959_0125502 | Ga0466959_0125502_764_1441 | 214 |
| 494 | 3300045051 | Ga0451576_0116245 | Ga0451576_0116245_868_1512 | 214 |
| 495 | 3300045051 | Ga0451576_0153982 | Ga0451576_0153982_1473_2150 | 214 |
| 496 | 3300045836 | Ga0466958_0099105 | Ga0466958_0099105_505_1182 | 214 |
| 497 | 3300046454 | Ga0495592_0010771 | Ga0495592_0010771_3921_4601 | 214 |
| 498 | 3300046463 | Ga0495653_0047820 | Ga0495653_0047820_1498_2178 | 214 |
| 499 | 3300046477 | Ga0495664_0439797 | Ga0495664_0439797_81_761 | 214 |
| 500 | 3300046511 | Ga0495608_0034154 | Ga0495608_0034154_2417_3097 | 214 |
| 501 | 3300046516 | Ga0495628_0033977 | Ga0495628_0033977_1745_2425 | 214 |
| 502 | 3300046537 | Ga0495598_0078835 | Ga0495598_0078835_119_793 | 214 |
| 503 | 3300046539 | Ga0495621_0016886 | Ga0495621_0016886_665_1345 | 214 |
| 504 | 3300046539 | Ga0495621_0031435 | Ga0495621_0031435_264_944 | 214 |
| 505 | 3300046539 | Ga0495621_0050641 | Ga0495621_0050641_777_1421 | 214 |
| 506 | 3300046539 | Ga0495621_0052556 | Ga0495621_0052556_631_1275 | 214 |
| 507 | 3300046543 | Ga0495645_0004434 | Ga0495645_0004434_5745_6425 | 214 |
| 508 | 3300046664 | Ga0495659_0134051 | Ga0495659_0134051_83_727 | 214 |
| 509 | 3300046678 | Ga0495599_0005280 | Ga0495599_0005280_5092_5772 | 214 |
| 510 | 3300046679 | Ga0495623_0022426 | Ga0495623_0022426_2852_3529 | 214 |
| 511 | 3300046684 | Ga0495669_0093411 | Ga0495669_0093411_380_1024 | 214 |
| 512 | 3300047317 | Ga0495604_0043216 | Ga0495604_0043216_272_949 | 214 |
| 513 | 3300047322 | Ga0495680_0032331 | Ga0495680_0032331_488_1168 | 214 |
| 514 | 3300047471 | Ga0495684_0123545 | Ga0495684_0123545_587_1267 | 214 |
| 515 | 3300048907 | Ga0496104_0279210 | Ga0496104_0279210_342_1019 | 214 |
| 516 | 3300048908 | Ga0496105_0880661 | Ga0496105_0880661_10_660 | 214 |
| 517 | 3300048913 | Ga0496110_0100519 | Ga0496110_0100519_1758_2435 | 214 |
| 518 | 3300049520 | Ga0501297_019309 | Ga0501297_019309_69_749 | 214 |
| 519 | 3300049571 | Ga0501034_0001554 | Ga0501034_0001554_17361_18005 | 214 |
| 520 | 3300049571 | Ga0501034_0028169 | Ga0501034_0028169_3172_3816 | 214 |
| 521 | 3300049575 | Ga0501039_0402408 | Ga0501039_0402408_82_726 | 214 |
| 522 | 3300049580 | Ga0501046_0025159 | Ga0501046_0025159_1532_2176 | 214 |
| 523 | 3300049582 | Ga0501048_0036384 | Ga0501048_0036384_2492_3136 | 214 |
| 524 | 3300049582 | Ga0501048_0266060 | Ga0501048_0266060_48_713 | 214 |
| 525 | 3300049584 | Ga0501068_0008226 | Ga0501068_0008226_2904_3548 | 214 |
| 526 | 3300049586 | Ga0501070_0083637 | Ga0501070_0083637_951_1595 | 214 |
| 527 | 3300049588 | Ga0501072_0008617 | Ga0501072_0008617_1127_1771 | 214 |
| 528 | 3300049589 | Ga0501073_0019315 | Ga0501073_0019315_2918_3562 | 214 |
| 529 | 3300049590 | Ga0501074_0024375 | Ga0501074_0024375_410_1054 | 214 |
| 530 | 3300049591 | Ga0501075_0227323 | Ga0501075_0227323_611_1255 | 214 |
| 531 | 3300049670 | Ga0501236_012178 | Ga0501236_012178_208_852 | 214 |
| 532 | 3300049741 | Ga0501079_0168548 | Ga0501079_0168548_921_1565 | 214 |
| 533 | 3300049741 | Ga0501079_0637094 | Ga0501079_0637094_134_778 | 214 |
| 534 | 3300049742 | Ga0501080_0002441 | Ga0501080_0002441_9862_10506 | 214 |
| 535 | 3300049743 | Ga0501081_0037793 | Ga0501081_0037793_1805_2449 | 214 |
| 536 | 3300049743 | Ga0501081_0157186 | Ga0501081_0157186_84_749 | 214 |
| 537 | 3300049744 | Ga0501083_0036118 | Ga0501083_0036118_1075_1719 | 214 |
| 538 | 3300049744 | Ga0501083_0127752 | Ga0501083_0127752_175_831 | 214 |
| 539 | 3300049776 | Ga0501280_003541 | Ga0501280_003541_752_1402 | 214 |
| 540 | 3300049778 | Ga0501282_008168 | Ga0501282_008168_430_1080 | 214 |
| 541 | 3300050492 | nmdc:mga0yw44_460155_c1 | nmdc:mga0yw44_460155_c1_62_742 | 214 |
| 542 | 3300050493 | nmdc:mga0k408_153227_c1 | nmdc:mga0k408_153227_c1_392_1087 | 214 |
| 543 | 3300050493 | nmdc:mga0k408_16043_c1 | nmdc:mga0k408_16043_c1_2458_3135 | 214 |
| 544 | 3300050493 | nmdc:mga0k408_367889_c1 | nmdc:mga0k408_367889_c1_114_794 | 214 |
| 545 | 3300050496 | nmdc:mga07m45_120901_c1 | nmdc:mga07m45_120901_c1_700_1377 | 214 |
| 546 | 3300050507 | nmdc:mga05p37_1083389_c1 | nmdc:mga05p37_1083389_c1_170_814 | 214 |
| 547 | 3300050507 | nmdc:mga05p37_34342_c1 | nmdc:mga05p37_34342_c1_3532_4176 | 214 |
| 548 | 3300050507 | nmdc:mga05p37_634667_c1 | nmdc:mga05p37_634667_c1_506_1150 | 214 |
| 549 | 3300050508 | nmdc:mga09592_152375_c1 | nmdc:mga09592_152375_c1_453_1127 | 214 |
| 550 | 3300050508 | nmdc:mga09592_345373_c1 | nmdc:mga09592_345373_c1_90_734 | 214 |
| 551 | 3300050508 | nmdc:mga09592_548895_c1 | nmdc:mga09592_548895_c1_199_843 | 214 |
| 552 | 3300050509 | nmdc:mga0qj67_293433_c1 | nmdc:mga0qj67_293433_c1_425_1069 | 214 |
| 553 | 3300050509 | nmdc:mga0qj67_35567_c1 | nmdc:mga0qj67_35567_c1_2619_3263 | 214 |
| 554 | 3300050510 | nmdc:mga06r32_281241_c1 | nmdc:mga06r32_281241_c1_751_1395 | 214 |
| 555 | 3300050510 | nmdc:mga06r32_982498_c1 | nmdc:mga06r32_982498_c1_23_667 | 214 |
| 556 | 3300050511 | nmdc:mga08y16_1100665_c1 | nmdc:mga08y16_1100665_c1_31_681 | 214 |
| 557 | 3300050511 | nmdc:mga08y16_52711_c1 | nmdc:mga08y16_52711_c1_1326_1970 | 214 |
| 558 | 3300050511 | nmdc:mga08y16_585_c1 | nmdc:mga08y16_585_c1_26680_27354 | 214 |
| 559 | 3300050512 | nmdc:mga0n895_1811_c1 | nmdc:mga0n895_1811_c1_2316_2960 | 214 |
| 560 | 3300050512 | nmdc:mga0n895_74764_c1 | nmdc:mga0n895_74764_c1_2571_3251 | 214 |
| 561 | 3300050512 | nmdc:mga0n895_774982_c1 | nmdc:mga0n895_774982_c1_244_888 | 214 |
| 562 | 3300050513 | nmdc:mga0rr50_1193_c1 | nmdc:mga0rr50_1193_c1_2074_2718 | 214 |
| 563 | 3300050513 | nmdc:mga0rr50_22826_c1 | nmdc:mga0rr50_22826_c1_1221_1865 | 214 |
| 564 | 3300050513 | nmdc:mga0rr50_231443_c1 | nmdc:mga0rr50_231443_c1_790_1470 | 214 |
| 565 | 3300050513 | nmdc:mga0rr50_331385_c1 | nmdc:mga0rr50_331385_c1_382_1026 | 214 |
| 566 | 3300050514 | nmdc:mga08x19_11345_c1 | nmdc:mga08x19_11345_c1_3550_4245 | 214 |
| 567 | 3300050514 | nmdc:mga08x19_14467_c1 | nmdc:mga08x19_14467_c1_1106_1750 | 214 |
| 568 | 3300050514 | nmdc:mga08x19_151057_c1 | nmdc:mga08x19_151057_c1_810_1454 | 214 |
| 569 | 3300050514 | nmdc:mga08x19_56189_c1 | nmdc:mga08x19_56189_c1_1810_2454 | 214 |
| 570 | 3300050514 | nmdc:mga08x19_762_c1 | nmdc:mga08x19_762_c1_1310_1954 | 214 |
| 571 | 3300050515 | nmdc:mga0a205_308622_c1 | nmdc:mga0a205_308622_c1_493_1140 | 214 |
| 572 | 3300050515 | nmdc:mga0a205_331743_c1 | nmdc:mga0a205_331743_c1_153_833 | 214 |
| 573 | 3300050515 | nmdc:mga0a205_390300_c1 | nmdc:mga0a205_390300_c1_348_1031 | 214 |
| 574 | 3300050515 | nmdc:mga0a205_393219_c1 | nmdc:mga0a205_393219_c1_98_742 | 214 |
| 575 | 3300050515 | nmdc:mga0a205_41071_c1 | nmdc:mga0a205_41071_c1_1109_1753 | 214 |
| 576 | 3300050516 | nmdc:mga0sz30_49409_c1 | nmdc:mga0sz30_49409_c1_495_1190 | 214 |
| 577 | 3300053077 | Ga0495601_0030984 | Ga0495601_0030984_318_998 | 214 |
| 578 | 3300053084 | Ga0495595_0067123 | Ga0495595_0067123_159_839 | 214 |
| 579 | 3300053085 | Ga0495619_0517778 | Ga0495619_0517778_30_710 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.7757 | 40 | 214 |
| 3e98-assembly1.cif.gz_B | crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution | 0.7564 | 40 | 214 |
| 3trc-assembly1.cif.gz_A-2 | structure of the gaf domain from a phosphoenolpyruvate-protein phosphotransferase (ptsp) from coxiella burnetii | 0.7476 | 74 | 212 |
| 3oov-assembly2.cif.gz_A | crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287 | 0.7053 | 79 | 212 |
| 3cit-assembly1.cif.gz_B-2 | crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato | 0.699 | 65 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23305_50_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.8275 | 38 | 213 | 3.30.450.40 |
| af_C0P685_1_140_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8067 | 73 | 100 | 1.25.40.10 |
| af_P23305_50_233_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7906 | 38 | 213 | 3.30.450.40 |
| af_P37013_4_170_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7862 | 73 | 213 | 3.30.450.40 |
| 3e98B00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7575 | 40 | 214 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A080LYV1-F1-model_v4 | DUF484 family protein | 0.9525 | 60 | 211 |
|
| AF-A0A4Q5VHV1-F1-model_v4 | deleted | 0.9445 | 53 | 213 |
|
| AF-A0A522BTZ7-F1-model_v4 | DUF484 family protein | 0.9402 | 79 | 212 |
|
| AF-A0A1G0DQ50-F1-model_v4 | deleted | 0.9401 | 57 | 213 |
|
| AF-A0A679HW17-F1-model_v4 | Uncharacterized protein | 0.9326 | 2 | 211 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar