F465817

General Info

Members Datasets Scaffolds Average Seq Length
579 272 579 220

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10226379|Ga0075370_102263792
Length 247
Sequence MPFAFSTARSRSSNPYVKDTALPTAEEVAEFLKQNPGFFENHVEVLMDLQIPHPHGGRAVSIGERQLVAVREKSRLLEDKLRELIQFGEENDAVGGKVHKLACRLIEAASLDAALDTMYLDLLDHFAVPHVAVRLWNVAEDNPDTKEFGPVMPEMRQFVAQMTAPYCGHHAVYESQAWFGEAAPHLKSFAMVALRLDDRPFGAIALGSEDPKRFYPEMGTLYLQRIGELLSHALWRFVTPVREPEAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
202 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
203 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
254 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 1.21
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10078424 3300003203 Bacteria 1018
2 Ga0070658_10001128 3300005327 Bacteria 22780
3 Ga0070658_10045857 3300005327 Bacteria 3536
4 Ga0070658_10071603 3300005327 Bacteria 2839
5 Ga0070658_10287415 3300005327 Bacteria 1401
6 Ga0070676_10052499 3300005328 Bacteria 2397
7 Ga0070683_100633332 3300005329 Bacteria 1024
8 Ga0070690_100000207 3300005330 Bacteria 30496
9 Ga0070690_100044209 3300005330 Bacteria 2826
10 Ga0070690_100233906 3300005330 Unclassified 1293
11 Ga0070670_100106030 3300005331 Bacteria 2422
12 Ga0068869_100001484 3300005334 Bacteria 13884
13 Ga0068869_100005354 3300005334 Bacteria 8069
14 Ga0068869_100204745 3300005334 Bacteria 1558
15 Ga0070680_100144545 3300005336 Bacteria 1995
16 Ga0070680_100371454 3300005336 Bacteria 1217
17 Ga0070680_100387132 3300005336 Bacteria 1191
18 Ga0070680_100439236 3300005336 Bacteria 1114
19 Ga0068868_100032519 3300005338 Bacteria 4013
20 Ga0068868_100084771 3300005338 Bacteria 2545
21 Ga0068868_100160562 3300005338 Bacteria 1856
22 Ga0068868_100164353 3300005338 Bacteria 1835
23 Ga0068868_100841264 3300005338 Bacteria 831
24 Ga0070660_100448750 3300005339 Bacteria 1070
25 Ga0070689_100000632 3300005340 Bacteria 21303
26 Ga0070689_100053863 3300005340 Bacteria 3114
27 Ga0070689_100196062 3300005340 Bacteria 1646
28 Ga0070691_10301503 3300005341 Bacteria 875
29 Ga0070687_100051522 3300005343 Bacteria 2131
30 Ga0070687_100090317 3300005343 Bacteria 1693
31 Ga0070687_100279606 3300005343 Bacteria 1050
32 Ga0070661_100098543 3300005344 Bacteria 2171
33 Ga0070692_10000846 3300005345 Bacteria 10306
34 Ga0070692_10167776 3300005345 Bacteria 1263
35 Ga0070669_100091361 3300005353 Bacteria 2283
36 Ga0070675_100020756 3300005354 Bacteria 5243
37 Ga0070675_100191734 3300005354 Bacteria 1771
38 Ga0070674_100012416 3300005356 Bacteria 5230
39 Ga0070674_100358624 3300005356 Bacteria 1180
40 Ga0070673_100285170 3300005364 Bacteria 1449
41 Ga0070673_100294769 3300005364 Bacteria 1426
42 Ga0070673_100417945 3300005364 Bacteria 1202
43 Ga0070659_100029685 3300005366 Bacteria 4227
44 Ga0070667_100381682 3300005367 Bacteria 1280
45 Ga0070714_100083896 3300005435 Bacteria 2779
46 Ga0070714_100708320 3300005435 Bacteria 972
47 Ga0070713_100706303 3300005436 Bacteria 963
48 Ga0070710_10194251 3300005437 Bacteria 1278
49 Ga0070701_10001232 3300005438 Bacteria 9394
50 Ga0070701_10067387 3300005438 Bacteria 1904
51 Ga0070701_10124941 3300005438 Bacteria 1455
52 Ga0070711_100683540 3300005439 Bacteria 863
53 Ga0070705_100013296 3300005440 Bacteria 4207
54 Ga0070705_100262892 3300005440 Bacteria 1218
55 Ga0070705_100451374 3300005440 Bacteria 965
56 Ga0070700_100000469 3300005441 Bacteria 20211
57 Ga0070700_100001919 3300005441 Bacteria 10509
58 Ga0070700_100498814 3300005441 Bacteria 936
59 Ga0070694_100053353 3300005444 Bacteria 2736
60 Ga0070694_100218433 3300005444 Bacteria 1429
61 Ga0070663_100361079 3300005455 Bacteria 1178
62 Ga0070678_100003745 3300005456 Bacteria 8517
63 Ga0070678_100555131 3300005456 Bacteria 1020
64 Ga0070681_10008404 3300005458 Bacteria 10108
65 Ga0070681_10140371 3300005458 Bacteria 2346
66 Ga0070681_10300559 3300005458 Bacteria 1515
67 Ga0070681_10485846 3300005458 Bacteria 1148
68 Ga0068867_100005845 3300005459 Bacteria 8726
69 Ga0068867_100268773 3300005459 Bacteria 1393
70 Ga0070685_10017590 3300005466 Bacteria 3828
71 Ga0070685_10323348 3300005466 Unclassified 1046
72 Ga0070706_100554464 3300005467 Bacteria 1069
73 Ga0070698_100226024 3300005471 Bacteria 1805
74 Ga0070698_100329896 3300005471 Bacteria 1457
75 Ga0070698_100342669 3300005471 Bacteria 1426
76 Ga0070699_100036349 3300005518 Bacteria 4261
77 Ga0070699_100121097 3300005518 Bacteria 2301
78 Ga0070679_100088129 3300005530 Bacteria 3091
79 Ga0070679_100209406 3300005530 Bacteria 1914
80 Ga0070679_100240010 3300005530 Bacteria 1770
81 Ga0070684_100117324 3300005535 Bacteria 2392
82 Ga0070684_100377981 3300005535 Bacteria 1304
83 Ga0070697_100217708 3300005536 Bacteria 1627
84 Ga0070697_100288039 3300005536 Unclassified 1410
85 Ga0070697_100819900 3300005536 Bacteria 824
86 Ga0068853_100538453 3300005539 Unclassified 1105
87 Ga0070686_100003579 3300005544 Bacteria 8527
88 Ga0070686_100104130 3300005544 Bacteria 1922
89 Ga0070686_100144024 3300005544 Bacteria 1662
90 Ga0070686_100315459 3300005544 Bacteria 1164
91 Ga0070695_100003131 3300005545 Bacteria 9640
92 Ga0070695_100090722 3300005545 Bacteria 2040
93 Ga0070696_100001158 3300005546 Bacteria 17126
94 Ga0070696_100017398 3300005546 Bacteria 4851
95 Ga0070696_100023822 3300005546 Bacteria 4160
96 Ga0070696_100110857 3300005546 Bacteria 1976
97 Ga0070696_100135591 3300005546 Bacteria 1794
98 Ga0070696_100188778 3300005546 Bacteria 1533
99 Ga0070696_100223403 3300005546 Bacteria 1414
100 Ga0070696_100624300 3300005546 Bacteria 871
101 Ga0070693_100004968 3300005547 Bacteria 6350
102 Ga0070693_100195864 3300005547 Bacteria 1309
103 Ga0070693_100223525 3300005547 Bacteria 1235
104 Ga0070693_100252764 3300005547 Bacteria 1169
105 Ga0070665_100154374 3300005548 Bacteria 2297
106 Ga0070704_100073216 3300005549 Bacteria 2495
107 Ga0070704_100286029 3300005549 Bacteria 1368
108 Ga0070704_100318611 3300005549 Bacteria 1302
109 Ga0070704_100388592 3300005549 Bacteria 1188
110 Ga0070704_100514617 3300005549 Bacteria 1041
111 Ga0068855_100011589 3300005563 Bacteria 10650
112 Ga0068855_100014368 3300005563 Bacteria 9533
113 Ga0068855_100048384 3300005563 Bacteria 5018
114 Ga0068855_100492747 3300005563 Bacteria 1333
115 Ga0070664_100268178 3300005564 Bacteria 1537
116 Ga0070664_100506916 3300005564 Bacteria 1113
117 Ga0070664_100892127 3300005564 Bacteria 833
118 Ga0068857_100070065 3300005577 Bacteria 3123
119 Ga0068857_100652860 3300005577 Bacteria 997
120 Ga0068854_100215087 3300005578 Bacteria 1518
121 Ga0068854_100342067 3300005578 Bacteria 1222
122 Ga0068856_100146416 3300005614 Bacteria 2370
123 Ga0068856_101109630 3300005614 Unclassified 808
124 Ga0070702_100000215 3300005615 Bacteria 19248
125 Ga0070702_100625537 3300005615 Bacteria 811
126 Ga0068852_100000280 3300005616 Bacteria 34116
127 Ga0068852_100006538 3300005616 Bacteria 8431
128 Ga0068852_100015175 3300005616 Bacteria 5962
129 Ga0068852_100249020 3300005616 Bacteria 1701
130 Ga0068859_100020990 3300005617 Bacteria 6557
131 Ga0068859_100230670 3300005617 Bacteria 1939
132 Ga0068859_100346026 3300005617 Bacteria 1581
133 Ga0068859_100574618 3300005617 Bacteria 1221
134 Ga0068864_100241759 3300005618 Bacteria 1673
135 Ga0068864_100386447 3300005618 Bacteria 1327
136 Ga0068866_10000298 3300005718 Bacteria 23676
137 Ga0068866_10201479 3300005718 Bacteria 1189
138 Ga0068866_10317056 3300005718 Bacteria 979
139 Ga0068861_100000393 3300005719 Bacteria 25233
140 Ga0068861_100184270 3300005719 Bacteria 1740
141 Ga0068851_10000350 3300005834 Bacteria 20761
142 Ga0068870_10006603 3300005840 Bacteria 5124
143 Ga0068870_10085893 3300005840 Bacteria 1749
144 Ga0068858_100000730 3300005842 Bacteria 34410
145 Ga0068858_100046556 3300005842 Bacteria 4020
146 Ga0068858_100095592 3300005842 Bacteria 2769
147 Ga0068858_100154349 3300005842 Bacteria 2160
148 Ga0068860_100006996 3300005843 Bacteria 11302
149 Ga0068860_100264001 3300005843 Bacteria 1679
150 Ga0068860_100786103 3300005843 Unclassified 965
151 Ga0068862_100009410 3300005844 Bacteria 8083
152 Ga0068862_100038228 3300005844 Bacteria 4070
153 Ga0081539_10001863 3300005985 Bacteria 33168
154 Ga0075364_10095872 3300006051 Bacteria 1972
155 Ga0075364_10289429 3300006051 Bacteria 1115
156 Ga0070716_100462728 3300006173 Unclassified 927
157 Ga0070716_100581596 3300006173 Bacteria 839
158 Ga0075369_10014355 3300006186 Bacteria 3163
159 Ga0075366_10040848 3300006195 Bacteria 2744
160 Ga0097621_100003061 3300006237 Bacteria 11463
161 Ga0097621_100014117 3300006237 Bacteria 5971
162 Ga0097621_100339842 3300006237 Bacteria 1333
163 Ga0097621_100696982 3300006237 Bacteria 935
164 Ga0075370_10081940 3300006353 Bacteria 1855
165 Ga0075370_10226379 3300006353 Bacteria 1106
166 Ga0068871_100000782 3300006358 Bacteria 21411
167 Ga0068871_100058527 3300006358 Bacteria 3138
168 Ga0068871_100107005 3300006358 Bacteria 2348
169 Ga0068871_100326139 3300006358 Bacteria 1353
170 Ga0075428_100433961 3300006844 Bacteria 1407
171 Ga0075430_100040553 3300006846 Bacteria 3941
172 Ga0075431_100105958 3300006847 Bacteria 2901
173 Ga0075431_100123489 3300006847 Bacteria 2671
174 Ga0075431_100416855 3300006847 Bacteria 1342
175 Ga0075433_10034242 3300006852 Bacteria 4360
176 Ga0075433_10117196 3300006852 Bacteria 2363
177 Ga0075433_10331255 3300006852 Bacteria 1346
178 Ga0075433_10428725 3300006852 Bacteria 1166
179 Ga0075434_100000002 3300006871 Bacteria 135661
180 Ga0075434_101166549 3300006871 Bacteria 783
181 Ga0075429_100129748 3300006880 Bacteria 2205
182 Ga0068865_100000084 3300006881 Bacteria 50482
183 Ga0068865_100137910 3300006881 Bacteria 1835
184 Ga0068865_100236911 3300006881 Unclassified 1434
185 Ga0068865_100904477 3300006881 Bacteria 768
186 Ga0075436_100001674 3300006914 Bacteria 15155
187 Ga0075436_100009216 3300006914 Bacteria 6754
188 Ga0075436_100018295 3300006914 Bacteria 4799
189 Ga0075436_100067072 3300006914 Bacteria 2480
190 Ga0075436_100117776 3300006914 Bacteria 1857
191 Ga0075436_100457544 3300006914 Bacteria 930
192 Ga0097620_100020988 3300006931 Bacteria 6557
193 Ga0097620_100230684 3300006931 Bacteria 1939
194 Ga0097620_100346057 3300006931 Bacteria 1581
195 Ga0097620_100574641 3300006931 Bacteria 1221
196 Ga0075435_100004018 3300007076 Bacteria 10052
197 Ga0075435_100062365 3300007076 Bacteria 3025
198 Ga0075435_100211769 3300007076 Bacteria 1644
199 Ga0105250_10089727 3300009092 Unclassified 1249
200 Ga0105240_10004564 3300009093 Bacteria 21003
201 Ga0105240_10071448 3300009093 Bacteria 4292
202 Ga0105240_10211192 3300009093 Bacteria 2268
203 Ga0105240_11023537 3300009093 Unclassified 882
204 Ga0111539_10003186 3300009094 Bacteria 21711
205 Ga0111539_10802926 3300009094 Unclassified 1095
206 Ga0105245_10000063 3300009098 Bacteria 113377
207 Ga0105245_10299721 3300009098 Bacteria 1577
208 Ga0114129_10028894 3300009147 Bacteria 7856
209 Ga0114129_10224424 3300009147 Bacteria 2533
210 Ga0114129_10370501 3300009147 Bacteria 1893
211 Ga0114129_10660045 3300009147 Bacteria 1349
212 Ga0105243_10001155 3300009148 Bacteria 23948
213 Ga0105243_10039765 3300009148 Bacteria 3669
214 Ga0105243_10080444 3300009148 Bacteria 2658
215 Ga0105243_10186691 3300009148 Bacteria 1807
216 Ga0105241_10005299 3300009174 Bacteria 9527
217 Ga0105241_10042764 3300009174 Bacteria 3430
218 Ga0105241_10103780 3300009174 Bacteria 2264
219 Ga0105241_10263492 3300009174 Bacteria 1465
220 Ga0105241_10335171 3300009174 Bacteria 1309
221 Ga0105242_10001356 3300009176 Bacteria 19311
222 Ga0105242_10003831 3300009176 Bacteria 11695
223 Ga0105242_10155391 3300009176 Bacteria 1998
224 Ga0105242_10535094 3300009176 Bacteria 1120
225 Ga0105248_10022713 3300009177 Bacteria 6962
226 Ga0105248_10098292 3300009177 Bacteria 3297
227 Ga0105248_10151287 3300009177 Bacteria 2618
228 Ga0105248_10564815 3300009177 Bacteria 1284
229 Ga0105248_10841248 3300009177 Unclassified 1036
230 Ga0105237_10008404 3300009545 Bacteria 11187
231 Ga0105238_10028411 3300009551 Bacteria 5699
232 Ga0105238_10110772 3300009551 Bacteria 2726
233 Ga0105238_10637216 3300009551 Bacteria 1075
234 Ga0105238_10917566 3300009551 Bacteria 895
235 Ga0105238_10971464 3300009551 Bacteria 870
236 Ga0105249_10150073 3300009553 Bacteria 2243
237 Ga0105249_10156492 3300009553 Bacteria 2198
238 Ga0105239_10308196 3300010375 Bacteria 1784
239 Ga0105239_10762649 3300010375 Bacteria 1107
240 Ga0105246_10137781 3300011119 Bacteria 1831
241 Ga0157371_10263841 3300013102 Bacteria 1242
242 Ga0157370_10013031 3300013104 Bacteria 8586
243 Ga0157370_10697592 3300013104 Bacteria 926
244 Ga0157369_10000349 3300013105 Bacteria 61491
245 Ga0157369_10404989 3300013105 Bacteria 1415
246 Ga0157374_10075981 3300013296 Bacteria 3175
247 Ga0157374_10660580 3300013296 Bacteria 1057
248 Ga0157378_10001267 3300013297 Bacteria 22738
249 Ga0157378_10060026 3300013297 Bacteria 3394
250 Ga0157378_10214428 3300013297 Bacteria 1827
251 Ga0163162_10186708 3300013306 Bacteria 2200
252 Ga0163162_10437930 3300013306 Unclassified 1439
253 Ga0163162_10766455 3300013306 Bacteria 1084
254 Ga0163162_11132043 3300013306 Bacteria 887
255 Ga0157372_10006727 3300013307 Bacteria 12224
256 Ga0157372_10154709 3300013307 Bacteria 2648
257 Ga0157372_10243396 3300013307 Bacteria 2087
258 Ga0157372_10474389 3300013307 Unclassified 1458
259 Ga0157372_10883453 3300013307 Bacteria 1037
260 Ga0157375_10052169 3300013308 Bacteria 4019
261 Ga0157375_10085494 3300013308 Bacteria 3204
262 Ga0157375_10114069 3300013308 Bacteria 2804
263 Ga0157375_10168153 3300013308 Bacteria 2339
264 Ga0157375_10475804 3300013308 Bacteria 1414
265 Ga0163163_11073296 3300014325 Bacteria 868
266 Ga0157380_10025735 3300014326 Bacteria 4465
267 Ga0157380_10103078 3300014326 Bacteria 2380
268 Ga0157380_10107020 3300014326 Bacteria 2341
269 Ga0157380_10552303 3300014326 Bacteria 1130
270 Ga0157380_10838826 3300014326 Bacteria 940
271 Ga0157377_10020294 3300014745 Bacteria 3479
272 Ga0157377_10238744 3300014745 Bacteria 1172
273 Ga0157379_10004490 3300014968 Bacteria 11965
274 Ga0157379_10099171 3300014968 Bacteria 2615
275 Ga0157379_10277898 3300014968 Bacteria 1524
276 Ga0157379_10321606 3300014968 Bacteria 1412
277 Ga0157376_10664189 3300014969 Bacteria 1044
278 Ga0163161_10021559 3300017792 Bacteria 4527
279 Ga0213876_10017617 3300021384 Bacteria 3770
280 Ga0207642_10006974 3300025899 Bacteria 3787
281 Ga0207685_10092233 3300025905 Bacteria 1278
282 Ga0207643_10005404 3300025908 Bacteria 6837
283 Ga0207643_10013492 3300025908 Bacteria 4427
284 Ga0207705_10043075 3300025909 Bacteria 3242
285 Ga0207705_10078860 3300025909 Bacteria 2398
286 Ga0207705_10124592 3300025909 Bacteria 1914
287 Ga0207705_10778710 3300025909 Bacteria 743
288 Ga0207684_10312989 3300025910 Bacteria 1353
289 Ga0207654_10029944 3300025911 Bacteria 2985
290 Ga0207707_10041225 3300025912 Bacteria 4032
291 Ga0207707_10285036 3300025912 Bacteria 1430
292 Ga0207707_10342560 3300025912 Bacteria 1289
293 Ga0207707_10507467 3300025912 Bacteria 1028
294 Ga0207695_10021605 3300025913 Bacteria 7337
295 Ga0207695_10059570 3300025913 Bacteria 3958
296 Ga0207695_10107222 3300025913 Bacteria 2779
297 Ga0207695_10570022 3300025913 Bacteria 1013
298 Ga0207695_10925824 3300025913 Unclassified 751
299 Ga0207671_10113569 3300025914 Bacteria 2063
300 Ga0207663_10064278 3300025916 Bacteria 2341
301 Ga0207663_10647677 3300025916 Bacteria 834
302 Ga0207660_10268139 3300025917 Bacteria 1352
303 Ga0207660_10273010 3300025917 Bacteria 1340
304 Ga0207660_10286458 3300025917 Bacteria 1309
305 Ga0207662_10031704 3300025918 Bacteria 3071
306 Ga0207657_10448543 3300025919 Bacteria 1012
307 Ga0207649_10121922 3300025920 Bacteria 1759
308 Ga0207652_10336340 3300025921 Bacteria 1363
309 Ga0207652_10450215 3300025921 Bacteria 1161
310 Ga0207646_10485010 3300025922 Bacteria 1114
311 Ga0207681_10330920 3300025923 Bacteria 1214
312 Ga0207694_10035293 3300025924 Bacteria 3836
313 Ga0207694_10264610 3300025924 Bacteria 1409
314 Ga0207694_10283384 3300025924 Bacteria 1362
315 Ga0207694_10719062 3300025924 Bacteria 842
316 Ga0207650_10064294 3300025925 Bacteria 2746
317 Ga0207650_10336209 3300025925 Bacteria 1239
318 Ga0207659_10010298 3300025926 Bacteria 5870
319 Ga0207659_10590325 3300025926 Bacteria 946
320 Ga0207687_10005312 3300025927 Bacteria 8529
321 Ga0207687_10038895 3300025927 Bacteria 3253
322 Ga0207700_10103976 3300025928 Bacteria 2271
323 Ga0207700_10548757 3300025928 Bacteria 1026
324 Ga0207664_10152285 3300025929 Bacteria 1965
325 Ga0207690_10015797 3300025932 Bacteria 4582
326 Ga0207686_10001462 3300025934 Bacteria 13347
327 Ga0207686_10003331 3300025934 Bacteria 8636
328 Ga0207686_10123507 3300025934 Bacteria 1765
329 Ga0207686_10226145 3300025934 Bacteria 1354
330 Ga0207686_10307077 3300025934 Bacteria 1180
331 Ga0207709_10003470 3300025935 Bacteria 9354
332 Ga0207709_10045987 3300025935 Bacteria 2646
333 Ga0207709_10110389 3300025935 Bacteria 1838
334 Ga0207709_10296818 3300025935 Bacteria 1200
335 Ga0207709_10467774 3300025935 Bacteria 978
336 Ga0207670_10290363 3300025936 Unclassified 1277
337 Ga0207669_10070021 3300025937 Bacteria 2197
338 Ga0207669_10228658 3300025937 Bacteria 1371
339 Ga0207704_10000948 3300025938 Bacteria 12827
340 Ga0207704_10209392 3300025938 Unclassified 1434
341 Ga0207704_10317931 3300025938 Bacteria 1200
342 Ga0207704_10447928 3300025938 Bacteria 1030
343 Ga0207704_10661603 3300025938 Bacteria 861
344 Ga0207665_10019784 3300025939 Bacteria 4424
345 Ga0207691_10016851 3300025940 Bacteria 6933
346 Ga0207711_10026199 3300025941 Bacteria 4891
347 Ga0207711_10070138 3300025941 Bacteria 3039
348 Ga0207711_10139985 3300025941 Bacteria 2176
349 Ga0207711_10677323 3300025941 Bacteria 962
350 Ga0207689_10000152 3300025942 Bacteria 59757
351 Ga0207689_10011552 3300025942 Bacteria 7564
352 Ga0207689_10060742 3300025942 Bacteria 3108
353 Ga0207679_10163736 3300025945 Bacteria 1824
354 Ga0207679_10241729 3300025945 Bacteria 1530
355 Ga0207679_10627601 3300025945 Bacteria 970
356 Ga0207667_10025530 3300025949 Bacteria 6467
357 Ga0207667_10027390 3300025949 Bacteria 6204
358 Ga0207667_10064821 3300025949 Bacteria 3812
359 Ga0207667_10106339 3300025949 Bacteria 2894
360 Ga0207667_10790524 3300025949 Bacteria 946
361 Ga0207651_10355001 3300025960 Bacteria 1236
362 Ga0207712_10136756 3300025961 Bacteria 1875
363 Ga0207712_10397055 3300025961 Unclassified 1158
364 Ga0207640_10087739 3300025981 Bacteria 2146
365 Ga0207640_10133347 3300025981 Bacteria 1799
366 Ga0207640_10214788 3300025981 Bacteria 1468
367 Ga0207658_10612723 3300025986 Bacteria 979
368 Ga0207658_10705635 3300025986 Bacteria 912
369 Ga0207677_10031150 3300026023 Bacteria 3414
370 Ga0207677_10076597 3300026023 Bacteria 2382
371 Ga0207677_10107202 3300026023 Bacteria 2072
372 Ga0207677_10759746 3300026023 Bacteria 865
373 Ga0207703_10016607 3300026035 Bacteria 5741
374 Ga0207703_10121781 3300026035 Bacteria 2240
375 Ga0207703_10428602 3300026035 Bacteria 1232
376 Ga0207639_10038467 3300026041 Bacteria 3559
377 Ga0207708_10000166 3300026075 Bacteria 51921
378 Ga0207708_10017322 3300026075 Bacteria 5423
379 Ga0207708_10095882 3300026075 Bacteria 2292
380 Ga0207702_10142159 3300026078 Bacteria 2173
381 Ga0207702_10208666 3300026078 Bacteria 1815
382 Ga0207702_10228588 3300026078 Bacteria 1737
383 Ga0207702_10669465 3300026078 Bacteria 1021
384 Ga0207648_10000131 3300026089 Bacteria 73949
385 Ga0207648_10062166 3300026089 Bacteria 3256
386 Ga0207648_10318485 3300026089 Unclassified 1397
387 Ga0207648_10322147 3300026089 Bacteria 1389
388 Ga0207648_10389906 3300026089 Bacteria 1260
389 Ga0207648_10395975 3300026089 Bacteria 1251
390 Ga0207648_10545680 3300026089 Bacteria 1064
391 Ga0207676_10465945 3300026095 Bacteria 1194
392 Ga0207674_10008824 3300026116 Bacteria 11602
393 Ga0207674_10264404 3300026116 Bacteria 1668
394 Ga0207675_100001354 3300026118 Bacteria 24525
395 Ga0207675_100064181 3300026118 Bacteria 3432
396 Ga0207675_100270444 3300026118 Bacteria 1649
397 Ga0207675_101138126 3300026118 Bacteria 800
398 Ga0207683_10009460 3300026121 Bacteria 8303
399 Ga0207683_10012340 3300026121 Bacteria 7290
400 Ga0207683_10166274 3300026121 Bacteria 1996
401 Ga0207683_10423221 3300026121 Bacteria 1227
402 Ga0207683_10528326 3300026121 Bacteria 1090
403 Ga0207698_10003270 3300026142 Bacteria 9739
404 Ga0207698_10004206 3300026142 Bacteria 8754
405 Ga0209969_1029982 3300027360 Bacteria 830
406 Ga0210000_1005848 3300027462 Bacteria 1788
407 Ga0209970_1008266 3300027614 Bacteria 1708
408 Ga0209966_1001918 3300027695 Bacteria 3492
409 Ga0209966_1012280 3300027695 Bacteria 1572
410 Ga0209998_10064217 3300027717 Bacteria 869
411 Ga0209974_10023228 3300027876 Bacteria 2052
412 Ga0207428_10002577 3300027907 Bacteria 18107
413 Ga0268265_10021816 3300028380 Bacteria 4492
414 Ga0268264_10016844 3300028381 Bacteria 5983
415 Ga0265338_10241669 3300028800 Bacteria 1337
416 Ga0265339_10069485 3300031249 Bacteria 1880
417 Ga0307408_100095275 3300031548 Bacteria 2256
418 Ga0307408_100198227 3300031548 Bacteria 1623
419 Ga0307408_100238807 3300031548 Bacteria 1492
420 Ga0307408_100248789 3300031548 Bacteria 1465
421 Ga0307408_100360948 3300031548 Bacteria 1236
422 Ga0307408_100368805 3300031548 Bacteria 1224
423 Ga0307408_100597885 3300031548 Bacteria 980
424 Ga0265314_10081086 3300031711 Bacteria 2139
425 Ga0307405_10304901 3300031731 Bacteria 1210
426 Ga0307406_10267863 3300031901 Bacteria 1296
427 Ga0307406_10271753 3300031901 Bacteria 1288
428 Ga0307406_10811482 3300031901 Bacteria 790
429 Ga0307412_10396380 3300031911 Bacteria 1122
430 Ga0307412_10493481 3300031911 Bacteria 1018
431 Ga0307412_10595535 3300031911 Bacteria 935
432 Ga0307409_100156840 3300031995 Bacteria 1985
433 Ga0307416_100252561 3300032002 Bacteria 1717
434 Ga0307416_100322240 3300032002 Bacteria 1548
435 Ga0307416_100568466 3300032002 Bacteria 1209
436 Ga0307416_100833397 3300032002 Bacteria 1020
437 Ga0307411_10597579 3300032005 Bacteria 948
438 Ga0373928_0071385 3300035084 Bacteria 859
439 Ga0373929_0055495 3300035085 Bacteria 915
440 Ga0373949_0023738 3300035090 Unclassified 1422
441 Ga0373941_0012088 3300035115 Bacteria 2248
442 Ga0373956_0266452 3300035119 Bacteria 815
443 Ga0373957_0223689 3300035120 Bacteria 788
444 Ga0373943_0291465 3300035170 Bacteria 925
445 Ga0373955_0057054 3300035172 Bacteria 2144
446 Ga0373961_0097542 3300035241 Bacteria 947
447 Ga0373962_0010642 3300035242 Bacteria 2297
448 Ga0373924_0007898 3300035410 Bacteria 3850
449 Ga0373931_0009772 3300035691 Bacteria 4595
450 Ga0373931_0311099 3300035691 Bacteria 975
451 Ga0373931_0371158 3300035691 Bacteria 900
452 Ga0373931_0574672 3300035691 Bacteria 734
453 Ga0373927_0086519 3300035695 Bacteria 2035
454 Ga0373927_0196449 3300035695 Bacteria 1324
455 Ga0373947_0207843 3300035725 Bacteria 1283
456 Ga0373937_0117836 3300036401 Bacteria 2473
457 Ga0373937_0188555 3300036401 Bacteria 1937
458 Ga0373925_0051113 3300037068 Bacteria 3085
459 Ga0373925_0364727 3300037068 Bacteria 1175
460 Ga0395899_0273537 3300037312 Bacteria 1151
461 Ga0395905_0186083 3300037471 Bacteria 1949
462 Ga0395901_0107553 3300038443 Bacteria 2928
463 Ga0436365_0234883 3300039437 Bacteria 9692
464 Ga0436365_0749296 3300039437 Bacteria 914
465 Ga0439447_017732 3300041407 Bacteria 1935
466 Ga0451845_0324412 3300041501 Bacteria 1005
467 Ga0439441_008321 3300042001 Bacteria 1691
468 Ga0439443_008880 3300042003 Bacteria 1429
469 Ga0439446_0027170 3300042156 Bacteria 1642
470 Ga0439460_0020812 3300042461 Bacteria 1786
471 Ga0451577_0321625 3300042876 Bacteria 1403
472 Ga0466961_0192394 3300044693 Bacteria 1264
473 Ga0453684_1034077 3300044712 Bacteria 872
474 Ga0466971_0062066 3300044719 Bacteria 1691
475 Ga0466960_0087637 3300044901 Bacteria 1581
476 Ga0466959_0125502 3300045049 Bacteria 1822
477 Ga0451576_0116245 3300045051 Bacteria 2785
478 Ga0451576_0153982 3300045051 Bacteria 2398
479 Ga0466958_0099105 3300045836 Bacteria 1810
480 Ga0495592_0010771 3300046454 Bacteria 6895
481 Ga0495653_0047820 3300046463 Bacteria 3307
482 Ga0495664_0439797 3300046477 Bacteria 781
483 Ga0495608_0034154 3300046511 Bacteria 3434
484 Ga0495628_0033977 3300046516 Bacteria 4105
485 Ga0495598_0078835 3300046537 Bacteria 1053
486 Ga0495621_0016886 3300046539 Bacteria 2350
487 Ga0495621_0031435 3300046539 Bacteria 1821
488 Ga0495621_0050641 3300046539 Bacteria 1484
489 Ga0495621_0052556 3300046539 Bacteria 1461
490 Ga0495645_0004434 3300046543 Bacteria 9587
491 Ga0495659_0134051 3300046664 Bacteria 984
492 Ga0495599_0005280 3300046678 Bacteria 7709
493 Ga0495623_0022426 3300046679 Bacteria 4079
494 Ga0495669_0093411 3300046684 Bacteria 1391
495 Ga0495604_0043216 3300047317 Bacteria 3529
496 Ga0495680_0032331 3300047322 Bacteria 4248
497 Ga0495684_0123545 3300047471 Bacteria 1948
498 Ga0496102_0129191 3300048905 Bacteria 2364
499 Ga0496104_0279210 3300048907 Bacteria 1583
500 Ga0496105_0051995 3300048908 Bacteria 3383
501 Ga0496105_0880661 3300048908 Unclassified 676
502 Ga0496106_0272286 3300048909 Bacteria 1356
503 Ga0496110_0100519 3300048913 Bacteria 2592
504 Ga0496110_0382090 3300048913 Bacteria 1283
505 Ga0501297_019309 3300049520 Bacteria 842
506 Ga0501034_0001554 3300049571 Bacteria 30039
507 Ga0501034_0028169 3300049571 Bacteria 5715
508 Ga0501034_0178834 3300049571 Bacteria 2087
509 Ga0501039_0402408 3300049575 Unclassified 1075
510 Ga0501046_0025159 3300049580 Bacteria 4875
511 Ga0501047_0039309 3300049581 Bacteria 4576
512 Ga0501048_0036384 3300049582 Bacteria 3539
513 Ga0501048_0266060 3300049582 Bacteria 1218
514 Ga0501067_0014774 3300049583 Bacteria 4320
515 Ga0501068_0008226 3300049584 Bacteria 5800
516 Ga0501069_0007055 3300049585 Bacteria 5884
517 Ga0501070_0000645 3300049586 Bacteria 32122
518 Ga0501070_0083637 3300049586 Bacteria 2642
519 Ga0501072_0008617 3300049588 Bacteria 7741
520 Ga0501073_0002029 3300049589 Bacteria 15122
521 Ga0501073_0019315 3300049589 Bacteria 4920
522 Ga0501074_0000097 3300049590 Bacteria 42311
523 Ga0501074_0024375 3300049590 Bacteria 4397
524 Ga0501075_0227323 3300049591 Bacteria 1423
525 Ga0501236_012178 3300049670 Bacteria 1155
526 Ga0501079_0057664 3300049741 Bacteria 2996
527 Ga0501079_0168548 3300049741 Bacteria 1708
528 Ga0501079_0637094 3300049741 Unclassified 839
529 Ga0501080_0002441 3300049742 Bacteria 16251
530 Ga0501080_0191385 3300049742 Bacteria 1880
531 Ga0501080_0338226 3300049742 Bacteria 1360
532 Ga0501081_0037793 3300049743 Bacteria 3295
533 Ga0501081_0157186 3300049743 Bacteria 1636
534 Ga0501083_0002426 3300049744 Bacteria 12758
535 Ga0501083_0036118 3300049744 Bacteria 3372
536 Ga0501083_0127752 3300049744 Bacteria 1666
537 Ga0501280_003541 3300049776 Bacteria 2389
538 Ga0501282_008168 3300049778 Bacteria 1121
539 Ga0501044_0026133 3300049823 Bacteria 6183
540 nmdc:mga0yw44_460155_c1 3300050492 Bacteria 862
541 nmdc:mga0k408_153227_c1 3300050493 Bacteria 1373
542 nmdc:mga0k408_16043_c1 3300050493 Bacteria 4149
543 nmdc:mga0k408_367889_c1 3300050493 Bacteria 857
544 nmdc:mga07m45_120901_c1 3300050496 Bacteria 1512
545 nmdc:mga05p37_1083389_c1 3300050507 Bacteria 841
546 nmdc:mga05p37_34342_c1 3300050507 Bacteria 6211
547 nmdc:mga05p37_634667_c1 3300050507 Bacteria 1199
548 nmdc:mga09592_152375_c1 3300050508 Bacteria 1995
549 nmdc:mga09592_345373_c1 3300050508 Bacteria 1288
550 nmdc:mga09592_548895_c1 3300050508 Bacteria 993
551 nmdc:mga0qj67_293433_c1 3300050509 Bacteria 1318
552 nmdc:mga0qj67_35567_c1 3300050509 Bacteria 3895
553 nmdc:mga06r32_281241_c1 3300050510 Bacteria 1651
554 nmdc:mga06r32_982498_c1 3300050510 Unclassified 798
555 nmdc:mga08y16_1100665_c1 3300050511 Unclassified 769
556 nmdc:mga08y16_52711_c1 3300050511 Bacteria 3505
557 nmdc:mga08y16_585_c1 3300050511 Bacteria 33898
558 nmdc:mga0n895_1811_c1 3300050512 Bacteria 16267
559 nmdc:mga0n895_74764_c1 3300050512 Bacteria 3366
560 nmdc:mga0n895_774982_c1 3300050512 Bacteria 951
561 nmdc:mga0rr50_1193_c1 3300050513 Bacteria 14104
562 nmdc:mga0rr50_22826_c1 3300050513 Bacteria 4302
563 nmdc:mga0rr50_231443_c1 3300050513 Bacteria 1529
564 nmdc:mga0rr50_331385_c1 3300050513 Bacteria 1278
565 nmdc:mga08x19_11345_c1 3300050514 Bacteria 5364
566 nmdc:mga08x19_14467_c1 3300050514 Bacteria 4785
567 nmdc:mga08x19_151057_c1 3300050514 Bacteria 1573
568 nmdc:mga08x19_56189_c1 3300050514 Bacteria 2540
569 nmdc:mga08x19_762_c1 3300050514 Bacteria 20508
570 nmdc:mga0a205_308622_c1 3300050515 Bacteria 1454
571 nmdc:mga0a205_331743_c1 3300050515 Bacteria 1391
572 nmdc:mga0a205_390300_c1 3300050515 Bacteria 1256
573 nmdc:mga0a205_393219_c1 3300050515 Bacteria 1250
574 nmdc:mga0a205_41071_c1 3300050515 Bacteria 4454
575 nmdc:mga0sz30_49409_c1 3300050516 Bacteria 1782
576 Ga0495601_0030984 3300053077 Bacteria 3324
577 Ga0495595_0067123 3300053084 Bacteria 1690
578 Ga0495619_0517778 3300053085 Bacteria 820
579 Ga0501082_0022516 3300060353 Bacteria 5427

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0749296 Ga0436365_0749296_264_872 190
2 3300048908 Ga0496105_0051995 Ga0496105_0051995_844_1443 190
3 3300035691 Ga0373931_0574672 Ga0373931_0574672_26_640 194
4 3300005328 Ga0070676_10052499 Ga0070676_100524992 195
5 3300005331 Ga0070670_100106030 Ga0070670_1001060302 195
6 3300005334 Ga0068869_100005354 Ga0068869_1000053546 195
7 3300005338 Ga0068868_100032519 Ga0068868_1000325195 195
8 3300005353 Ga0070669_100091361 Ga0070669_1000913613 195
9 3300005367 Ga0070667_100381682 Ga0070667_1003816822 195
10 3300005455 Ga0070663_100361079 Ga0070663_1003610792 195
11 3300005564 Ga0070664_100268178 Ga0070664_1002681782 195
12 3300005577 Ga0068857_100652860 Ga0068857_1006528602 195
13 3300005617 Ga0068859_100346026 Ga0068859_1003460262 195
14 3300005842 Ga0068858_100154349 Ga0068858_1001543493 195
15 3300006931 Ga0097620_100346057 Ga0097620_1003460572 195
16 3300009098 Ga0105245_10299721 Ga0105245_102997212 195
17 3300010375 Ga0105239_10762649 Ga0105239_107626492 195
18 3300013102 Ga0157371_10263841 Ga0157371_102638412 195
19 3300013306 Ga0163162_11132043 Ga0163162_111320432 195
20 3300013308 Ga0157375_10085494 Ga0157375_100854944 195
21 3300014326 Ga0157380_10838826 Ga0157380_108388262 195
22 3300014745 Ga0157377_10238744 Ga0157377_102387442 195
23 3300025925 Ga0207650_10336209 Ga0207650_103362092 195
24 3300025942 Ga0207689_10011552 Ga0207689_100115524 195
25 3300025945 Ga0207679_10241729 Ga0207679_102417292 195
26 3300025986 Ga0207658_10705635 Ga0207658_107056351 195
27 3300026035 Ga0207703_10428602 Ga0207703_104286022 195
28 3300026089 Ga0207648_10389906 Ga0207648_103899062 195
29 3300026116 Ga0207674_10264404 Ga0207674_102644042 195
30 3300026118 Ga0207675_100270444 Ga0207675_1002704443 195
31 3300048905 Ga0496102_0129191 Ga0496102_0129191_557_1210 195
32 3300048909 Ga0496106_0272286 Ga0496106_0272286_274_927 195
33 3300048913 Ga0496110_0382090 Ga0496110_0382090_87_740 195
34 3300025928 Ga0207700_10103976 Ga0207700_101039761 196
35 3300005444 Ga0070694_100218433 Ga0070694_1002184332 197
36 3300005544 Ga0070686_100144024 Ga0070686_1001440242 197
37 3300005546 Ga0070696_100188778 Ga0070696_1001887782 197
38 3300005617 Ga0068859_100020990 Ga0068859_1000209905 197
39 3300005719 Ga0068861_100184270 Ga0068861_1001842702 197
40 3300006931 Ga0097620_100020988 Ga0097620_1000209885 197
41 3300014326 Ga0157380_10103078 Ga0157380_101030781 197
42 3300026118 Ga0207675_100064181 Ga0207675_1000641814 197
43 3300044712 Ga0453684_1034077 Ga0453684_1034077_39_743 205
44 3300049742 Ga0501080_0191385 Ga0501080_0191385_738_1382 207
45 3300006051 Ga0075364_10289429 Ga0075364_102894292 209
46 3300006358 Ga0068871_100107005 Ga0068871_1001070053 209
47 3300009177 Ga0105248_10022713 Ga0105248_100227135 209
48 3300025942 Ga0207689_10060742 Ga0207689_100607422 210
49 3300042876 Ga0451577_0321625 Ga0451577_0321625_385_1038 211
50 3300005844 Ga0068862_100038228 Ga0068862_1000382282 213
51 3300028800 Ga0265338_10241669 Ga0265338_102416692 213
52 3300031249 Ga0265339_10069485 Ga0265339_100694852 213
53 3300031711 Ga0265314_10081086 Ga0265314_100810863 213
54 3300049571 Ga0501034_0178834 Ga0501034_0178834_708_1412 213
55 3300049581 Ga0501047_0039309 Ga0501047_0039309_2179_2883 213
56 3300049583 Ga0501067_0014774 Ga0501067_0014774_138_845 213
57 3300049585 Ga0501069_0007055 Ga0501069_0007055_3155_3859 213
58 3300049586 Ga0501070_0000645 Ga0501070_0000645_29975_30679 213
59 3300049589 Ga0501073_0002029 Ga0501073_0002029_5736_6440 213
60 3300049590 Ga0501074_0000097 Ga0501074_0000097_730_1434 213
61 3300049741 Ga0501079_0057664 Ga0501079_0057664_196_900 213
62 3300049742 Ga0501080_0338226 Ga0501080_0338226_253_957 213
63 3300049744 Ga0501083_0002426 Ga0501083_0002426_574_1278 213
64 3300049823 Ga0501044_0026133 Ga0501044_0026133_3142_3846 213
65 3300060353 Ga0501082_0022516 Ga0501082_0022516_2861_3565 213
66 3300003203 JGI25406J46586_10078424 JGI25406J46586_100784242 214
67 3300005327 Ga0070658_10001128 Ga0070658_1000112821 214
68 3300005327 Ga0070658_10045857 Ga0070658_100458574 214
69 3300005327 Ga0070658_10071603 Ga0070658_100716033 214
70 3300005327 Ga0070658_10287415 Ga0070658_102874152 214
71 3300005329 Ga0070683_100633332 Ga0070683_1006333321 214
72 3300005330 Ga0070690_100000207 Ga0070690_10000020719 214
73 3300005330 Ga0070690_100044209 Ga0070690_1000442092 214
74 3300005330 Ga0070690_100233906 Ga0070690_1002339062 214
75 3300005334 Ga0068869_100001484 Ga0068869_10000148411 214
76 3300005334 Ga0068869_100204745 Ga0068869_1002047452 214
77 3300005336 Ga0070680_100144545 Ga0070680_1001445452 214
78 3300005336 Ga0070680_100371454 Ga0070680_1003714542 214
79 3300005336 Ga0070680_100387132 Ga0070680_1003871322 214
80 3300005336 Ga0070680_100439236 Ga0070680_1004392362 214
81 3300005338 Ga0068868_100084771 Ga0068868_1000847712 214
82 3300005338 Ga0068868_100160562 Ga0068868_1001605622 214
83 3300005338 Ga0068868_100164353 Ga0068868_1001643532 214
84 3300005338 Ga0068868_100841264 Ga0068868_1008412641 214
85 3300005339 Ga0070660_100448750 Ga0070660_1004487502 214
86 3300005340 Ga0070689_100000632 Ga0070689_1000006321 214
87 3300005340 Ga0070689_100053863 Ga0070689_1000538633 214
88 3300005340 Ga0070689_100196062 Ga0070689_1001960622 214
89 3300005341 Ga0070691_10301503 Ga0070691_103015032 214
90 3300005343 Ga0070687_100051522 Ga0070687_1000515223 214
91 3300005343 Ga0070687_100090317 Ga0070687_1000903172 214
92 3300005343 Ga0070687_100279606 Ga0070687_1002796062 214
93 3300005344 Ga0070661_100098543 Ga0070661_1000985433 214
94 3300005345 Ga0070692_10000846 Ga0070692_1000084610 214
95 3300005345 Ga0070692_10167776 Ga0070692_101677762 214
96 3300005354 Ga0070675_100020756 Ga0070675_1000207566 214
97 3300005354 Ga0070675_100191734 Ga0070675_1001917342 214
98 3300005356 Ga0070674_100012416 Ga0070674_1000124165 214
99 3300005356 Ga0070674_100358624 Ga0070674_1003586242 214
100 3300005364 Ga0070673_100285170 Ga0070673_1002851701 214
101 3300005364 Ga0070673_100294769 Ga0070673_1002947692 214
102 3300005364 Ga0070673_100417945 Ga0070673_1004179452 214
103 3300005366 Ga0070659_100029685 Ga0070659_1000296853 214
104 3300005435 Ga0070714_100083896 Ga0070714_1000838963 214
105 3300005435 Ga0070714_100708320 Ga0070714_1007083202 214
106 3300005436 Ga0070713_100706303 Ga0070713_1007063032 214
107 3300005437 Ga0070710_10194251 Ga0070710_101942512 214
108 3300005438 Ga0070701_10001232 Ga0070701_1000123210 214
109 3300005438 Ga0070701_10067387 Ga0070701_100673873 214
110 3300005438 Ga0070701_10124941 Ga0070701_101249412 214
111 3300005439 Ga0070711_100683540 Ga0070711_1006835401 214
112 3300005440 Ga0070705_100013296 Ga0070705_1000132964 214
113 3300005440 Ga0070705_100262892 Ga0070705_1002628922 214
114 3300005440 Ga0070705_100451374 Ga0070705_1004513742 214
115 3300005441 Ga0070700_100000469 Ga0070700_1000004695 214
116 3300005441 Ga0070700_100001919 Ga0070700_1000019193 214
117 3300005441 Ga0070700_100498814 Ga0070700_1004988141 214
118 3300005444 Ga0070694_100053353 Ga0070694_1000533532 214
119 3300005456 Ga0070678_100003745 Ga0070678_1000037453 214
120 3300005456 Ga0070678_100555131 Ga0070678_1005551312 214
121 3300005458 Ga0070681_10008404 Ga0070681_100084049 214
122 3300005458 Ga0070681_10140371 Ga0070681_101403712 214
123 3300005458 Ga0070681_10300559 Ga0070681_103005592 214
124 3300005458 Ga0070681_10485846 Ga0070681_104858462 214
125 3300005459 Ga0068867_100005845 Ga0068867_1000058452 214
126 3300005459 Ga0068867_100268773 Ga0068867_1002687731 214
127 3300005466 Ga0070685_10017590 Ga0070685_100175902 214
128 3300005466 Ga0070685_10323348 Ga0070685_103233482 214
129 3300005467 Ga0070706_100554464 Ga0070706_1005544642 214
130 3300005471 Ga0070698_100226024 Ga0070698_1002260241 214
131 3300005471 Ga0070698_100329896 Ga0070698_1003298962 214
132 3300005471 Ga0070698_100342669 Ga0070698_1003426691 214
133 3300005518 Ga0070699_100036349 Ga0070699_1000363492 214
134 3300005518 Ga0070699_100121097 Ga0070699_1001210972 214
135 3300005530 Ga0070679_100088129 Ga0070679_1000881293 214
136 3300005530 Ga0070679_100209406 Ga0070679_1002094062 214
137 3300005530 Ga0070679_100240010 Ga0070679_1002400102 214
138 3300005535 Ga0070684_100117324 Ga0070684_1001173242 214
139 3300005535 Ga0070684_100377981 Ga0070684_1003779812 214
140 3300005536 Ga0070697_100217708 Ga0070697_1002177082 214
141 3300005536 Ga0070697_100288039 Ga0070697_1002880392 214
142 3300005536 Ga0070697_100819900 Ga0070697_1008199002 214
143 3300005539 Ga0068853_100538453 Ga0068853_1005384531 214
144 3300005544 Ga0070686_100003579 Ga0070686_1000035799 214
145 3300005544 Ga0070686_100104130 Ga0070686_1001041302 214
146 3300005544 Ga0070686_100315459 Ga0070686_1003154592 214
147 3300005545 Ga0070695_100003131 Ga0070695_1000031314 214
148 3300005545 Ga0070695_100090722 Ga0070695_1000907222 214
149 3300005546 Ga0070696_100001158 Ga0070696_1000011588 214
150 3300005546 Ga0070696_100017398 Ga0070696_1000173984 214
151 3300005546 Ga0070696_100023822 Ga0070696_1000238225 214
152 3300005546 Ga0070696_100110857 Ga0070696_1001108571 214
153 3300005546 Ga0070696_100135591 Ga0070696_1001355911 214
154 3300005546 Ga0070696_100223403 Ga0070696_1002234031 214
155 3300005546 Ga0070696_100624300 Ga0070696_1006243002 214
156 3300005547 Ga0070693_100004968 Ga0070693_1000049682 214
157 3300005547 Ga0070693_100195864 Ga0070693_1001958642 214
158 3300005547 Ga0070693_100223525 Ga0070693_1002235252 214
159 3300005547 Ga0070693_100252764 Ga0070693_1002527641 214
160 3300005548 Ga0070665_100154374 Ga0070665_1001543743 214
161 3300005549 Ga0070704_100073216 Ga0070704_1000732162 214
162 3300005549 Ga0070704_100286029 Ga0070704_1002860292 214
163 3300005549 Ga0070704_100318611 Ga0070704_1003186112 214
164 3300005549 Ga0070704_100388592 Ga0070704_1003885922 214
165 3300005549 Ga0070704_100514617 Ga0070704_1005146172 214
166 3300005563 Ga0068855_100011589 Ga0068855_10001158911 214
167 3300005563 Ga0068855_100014368 Ga0068855_1000143687 214
168 3300005563 Ga0068855_100048384 Ga0068855_1000483842 214
169 3300005563 Ga0068855_100492747 Ga0068855_1004927472 214
170 3300005564 Ga0070664_100506916 Ga0070664_1005069162 214
171 3300005564 Ga0070664_100892127 Ga0070664_1008921272 214
172 3300005577 Ga0068857_100070065 Ga0068857_1000700653 214
173 3300005578 Ga0068854_100215087 Ga0068854_1002150872 214
174 3300005578 Ga0068854_100342067 Ga0068854_1003420672 214
175 3300005614 Ga0068856_100146416 Ga0068856_1001464163 214
176 3300005614 Ga0068856_101109630 Ga0068856_1011096301 214
177 3300005615 Ga0070702_100000215 Ga0070702_10000021510 214
178 3300005615 Ga0070702_100625537 Ga0070702_1006255371 214
179 3300005616 Ga0068852_100000280 Ga0068852_10000028011 214
180 3300005616 Ga0068852_100006538 Ga0068852_1000065383 214
181 3300005616 Ga0068852_100015175 Ga0068852_1000151753 214
182 3300005616 Ga0068852_100249020 Ga0068852_1002490202 214
183 3300005617 Ga0068859_100230670 Ga0068859_1002306703 214
184 3300005617 Ga0068859_100574618 Ga0068859_1005746182 214
185 3300005618 Ga0068864_100241759 Ga0068864_1002417592 214
186 3300005618 Ga0068864_100386447 Ga0068864_1003864472 214
187 3300005718 Ga0068866_10000298 Ga0068866_1000029810 214
188 3300005718 Ga0068866_10201479 Ga0068866_102014792 214
189 3300005718 Ga0068866_10317056 Ga0068866_103170562 214
190 3300005719 Ga0068861_100000393 Ga0068861_10000039316 214
191 3300005834 Ga0068851_10000350 Ga0068851_100003502 214
192 3300005840 Ga0068870_10006603 Ga0068870_100066033 214
193 3300005840 Ga0068870_10085893 Ga0068870_100858932 214
194 3300005842 Ga0068858_100000730 Ga0068858_1000007306 214
195 3300005842 Ga0068858_100046556 Ga0068858_1000465563 214
196 3300005842 Ga0068858_100095592 Ga0068858_1000955923 214
197 3300005843 Ga0068860_100006996 Ga0068860_1000069967 214
198 3300005843 Ga0068860_100264001 Ga0068860_1002640012 214
199 3300005843 Ga0068860_100786103 Ga0068860_1007861032 214
200 3300005844 Ga0068862_100009410 Ga0068862_1000094106 214
201 3300005985 Ga0081539_10001863 Ga0081539_1000186320 214
202 3300006051 Ga0075364_10095872 Ga0075364_100958723 214
203 3300006173 Ga0070716_100462728 Ga0070716_1004627282 214
204 3300006173 Ga0070716_100581596 Ga0070716_1005815962 214
205 3300006186 Ga0075369_10014355 Ga0075369_100143553 214
206 3300006195 Ga0075366_10040848 Ga0075366_100408482 214
207 3300006237 Ga0097621_100003061 Ga0097621_1000030619 214
208 3300006237 Ga0097621_100014117 Ga0097621_1000141173 214
209 3300006237 Ga0097621_100339842 Ga0097621_1003398422 214
210 3300006237 Ga0097621_100696982 Ga0097621_1006969822 214
211 3300006353 Ga0075370_10081940 Ga0075370_100819402 214
212 3300006353 Ga0075370_10226379 Ga0075370_102263792 214
213 3300006358 Ga0068871_100000782 Ga0068871_1000007827 214
214 3300006358 Ga0068871_100058527 Ga0068871_1000585275 214
215 3300006358 Ga0068871_100326139 Ga0068871_1003261392 214
216 3300006844 Ga0075428_100433961 Ga0075428_1004339612 214
217 3300006846 Ga0075430_100040553 Ga0075430_1000405534 214
218 3300006847 Ga0075431_100105958 Ga0075431_1001059583 214
219 3300006847 Ga0075431_100123489 Ga0075431_1001234892 214
220 3300006847 Ga0075431_100416855 Ga0075431_1004168552 214
221 3300006852 Ga0075433_10034242 Ga0075433_100342424 214
222 3300006852 Ga0075433_10117196 Ga0075433_101171962 214
223 3300006852 Ga0075433_10331255 Ga0075433_103312552 214
224 3300006852 Ga0075433_10428725 Ga0075433_104287252 214
225 3300006871 Ga0075434_100000002 Ga0075434_10000000277 214
226 3300006871 Ga0075434_101166549 Ga0075434_1011665491 214
227 3300006880 Ga0075429_100129748 Ga0075429_1001297482 214
228 3300006881 Ga0068865_100000084 Ga0068865_10000008436 214
229 3300006881 Ga0068865_100137910 Ga0068865_1001379102 214
230 3300006881 Ga0068865_100236911 Ga0068865_1002369112 214
231 3300006881 Ga0068865_100904477 Ga0068865_1009044771 214
232 3300006914 Ga0075436_100001674 Ga0075436_10000167414 214
233 3300006914 Ga0075436_100009216 Ga0075436_1000092163 214
234 3300006914 Ga0075436_100018295 Ga0075436_1000182952 214
235 3300006914 Ga0075436_100067072 Ga0075436_1000670722 214
236 3300006914 Ga0075436_100117776 Ga0075436_1001177761 214
237 3300006914 Ga0075436_100457544 Ga0075436_1004575441 214
238 3300006931 Ga0097620_100230684 Ga0097620_1002306843 214
239 3300006931 Ga0097620_100574641 Ga0097620_1005746412 214
240 3300007076 Ga0075435_100004018 Ga0075435_1000040183 214
241 3300007076 Ga0075435_100062365 Ga0075435_1000623652 214
242 3300007076 Ga0075435_100211769 Ga0075435_1002117692 214
243 3300009092 Ga0105250_10089727 Ga0105250_100897271 214
244 3300009093 Ga0105240_10004564 Ga0105240_100045649 214
245 3300009093 Ga0105240_10071448 Ga0105240_100714483 214
246 3300009093 Ga0105240_10211192 Ga0105240_102111923 214
247 3300009093 Ga0105240_11023537 Ga0105240_110235372 214
248 3300009094 Ga0111539_10003186 Ga0111539_1000318620 214
249 3300009094 Ga0111539_10802926 Ga0111539_108029262 214
250 3300009098 Ga0105245_10000063 Ga0105245_1000006389 214
251 3300009147 Ga0114129_10028894 Ga0114129_100288944 214
252 3300009147 Ga0114129_10224424 Ga0114129_102244242 214
253 3300009147 Ga0114129_10370501 Ga0114129_103705012 214
254 3300009147 Ga0114129_10660045 Ga0114129_106600452 214
255 3300009148 Ga0105243_10001155 Ga0105243_1000115516 214
256 3300009148 Ga0105243_10039765 Ga0105243_100397654 214
257 3300009148 Ga0105243_10080444 Ga0105243_100804442 214
258 3300009148 Ga0105243_10186691 Ga0105243_101866912 214
259 3300009174 Ga0105241_10005299 Ga0105241_100052999 214
260 3300009174 Ga0105241_10042764 Ga0105241_100427642 214
261 3300009174 Ga0105241_10103780 Ga0105241_101037802 214
262 3300009174 Ga0105241_10263492 Ga0105241_102634922 214
263 3300009174 Ga0105241_10335171 Ga0105241_103351712 214
264 3300009176 Ga0105242_10001356 Ga0105242_100013568 214
265 3300009176 Ga0105242_10003831 Ga0105242_100038319 214
266 3300009176 Ga0105242_10155391 Ga0105242_101553912 214
267 3300009176 Ga0105242_10535094 Ga0105242_105350942 214
268 3300009177 Ga0105248_10098292 Ga0105248_100982922 214
269 3300009177 Ga0105248_10151287 Ga0105248_101512872 214
270 3300009177 Ga0105248_10564815 Ga0105248_105648152 214
271 3300009177 Ga0105248_10841248 Ga0105248_108412482 214
272 3300009545 Ga0105237_10008404 Ga0105237_100084042 214
273 3300009551 Ga0105238_10028411 Ga0105238_100284114 214
274 3300009551 Ga0105238_10110772 Ga0105238_101107722 214
275 3300009551 Ga0105238_10637216 Ga0105238_106372162 214
276 3300009551 Ga0105238_10917566 Ga0105238_109175662 214
277 3300009551 Ga0105238_10971464 Ga0105238_109714642 214
278 3300009553 Ga0105249_10150073 Ga0105249_101500732 214
279 3300009553 Ga0105249_10156492 Ga0105249_101564922 214
280 3300010375 Ga0105239_10308196 Ga0105239_103081962 214
281 3300011119 Ga0105246_10137781 Ga0105246_101377812 214
282 3300013104 Ga0157370_10013031 Ga0157370_100130317 214
283 3300013104 Ga0157370_10697592 Ga0157370_106975922 214
284 3300013105 Ga0157369_10000349 Ga0157369_1000034911 214
285 3300013105 Ga0157369_10404989 Ga0157369_104049892 214
286 3300013296 Ga0157374_10075981 Ga0157374_100759811 214
287 3300013296 Ga0157374_10660580 Ga0157374_106605802 214
288 3300013297 Ga0157378_10001267 Ga0157378_1000126716 214
289 3300013297 Ga0157378_10060026 Ga0157378_100600263 214
290 3300013297 Ga0157378_10214428 Ga0157378_102144282 214
291 3300013306 Ga0163162_10186708 Ga0163162_101867082 214
292 3300013306 Ga0163162_10437930 Ga0163162_104379302 214
293 3300013306 Ga0163162_10766455 Ga0163162_107664552 214
294 3300013307 Ga0157372_10006727 Ga0157372_1000672712 214
295 3300013307 Ga0157372_10154709 Ga0157372_101547094 214
296 3300013307 Ga0157372_10243396 Ga0157372_102433962 214
297 3300013307 Ga0157372_10474389 Ga0157372_104743892 214
298 3300013307 Ga0157372_10883453 Ga0157372_108834531 214
299 3300013308 Ga0157375_10052169 Ga0157375_100521693 214
300 3300013308 Ga0157375_10114069 Ga0157375_101140692 214
301 3300013308 Ga0157375_10168153 Ga0157375_101681532 214
302 3300013308 Ga0157375_10475804 Ga0157375_104758041 214
303 3300014325 Ga0163163_11073296 Ga0163163_110732962 214
304 3300014326 Ga0157380_10025735 Ga0157380_100257354 214
305 3300014326 Ga0157380_10107020 Ga0157380_101070202 214
306 3300014326 Ga0157380_10552303 Ga0157380_105523032 214
307 3300014745 Ga0157377_10020294 Ga0157377_100202942 214
308 3300014968 Ga0157379_10004490 Ga0157379_100044907 214
309 3300014968 Ga0157379_10099171 Ga0157379_100991713 214
310 3300014968 Ga0157379_10277898 Ga0157379_102778982 214
311 3300014968 Ga0157379_10321606 Ga0157379_103216062 214
312 3300014969 Ga0157376_10664189 Ga0157376_106641892 214
313 3300017792 Ga0163161_10021559 Ga0163161_100215592 214
314 3300021384 Ga0213876_10017617 Ga0213876_100176173 214
315 3300025899 Ga0207642_10006974 Ga0207642_100069744 214
316 3300025905 Ga0207685_10092233 Ga0207685_100922332 214
317 3300025908 Ga0207643_10005404 Ga0207643_100054047 214
318 3300025908 Ga0207643_10013492 Ga0207643_100134925 214
319 3300025909 Ga0207705_10043075 Ga0207705_100430753 214
320 3300025909 Ga0207705_10078860 Ga0207705_100788603 214
321 3300025909 Ga0207705_10124592 Ga0207705_101245922 214
322 3300025909 Ga0207705_10778710 Ga0207705_107787101 214
323 3300025910 Ga0207684_10312989 Ga0207684_103129892 214
324 3300025911 Ga0207654_10029944 Ga0207654_100299442 214
325 3300025912 Ga0207707_10041225 Ga0207707_100412256 214
326 3300025912 Ga0207707_10285036 Ga0207707_102850362 214
327 3300025912 Ga0207707_10342560 Ga0207707_103425602 214
328 3300025912 Ga0207707_10507467 Ga0207707_105074672 214
329 3300025913 Ga0207695_10021605 Ga0207695_100216058 214
330 3300025913 Ga0207695_10059570 Ga0207695_100595703 214
331 3300025913 Ga0207695_10107222 Ga0207695_101072223 214
332 3300025913 Ga0207695_10570022 Ga0207695_105700222 214
333 3300025913 Ga0207695_10925824 Ga0207695_109258241 214
334 3300025914 Ga0207671_10113569 Ga0207671_101135692 214
335 3300025916 Ga0207663_10064278 Ga0207663_100642781 214
336 3300025916 Ga0207663_10647677 Ga0207663_106476772 214
337 3300025917 Ga0207660_10268139 Ga0207660_102681392 214
338 3300025917 Ga0207660_10273010 Ga0207660_102730102 214
339 3300025917 Ga0207660_10286458 Ga0207660_102864582 214
340 3300025918 Ga0207662_10031704 Ga0207662_100317043 214
341 3300025919 Ga0207657_10448543 Ga0207657_104485432 214
342 3300025920 Ga0207649_10121922 Ga0207649_101219222 214
343 3300025921 Ga0207652_10336340 Ga0207652_103363401 214
344 3300025921 Ga0207652_10450215 Ga0207652_104502152 214
345 3300025922 Ga0207646_10485010 Ga0207646_104850102 214
346 3300025923 Ga0207681_10330920 Ga0207681_103309202 214
347 3300025924 Ga0207694_10035293 Ga0207694_100352932 214
348 3300025924 Ga0207694_10264610 Ga0207694_102646102 214
349 3300025924 Ga0207694_10283384 Ga0207694_102833842 214
350 3300025924 Ga0207694_10719062 Ga0207694_107190621 214
351 3300025925 Ga0207650_10064294 Ga0207650_100642943 214
352 3300025926 Ga0207659_10010298 Ga0207659_100102986 214
353 3300025926 Ga0207659_10590325 Ga0207659_105903251 214
354 3300025927 Ga0207687_10005312 Ga0207687_100053122 214
355 3300025927 Ga0207687_10038895 Ga0207687_100388952 214
356 3300025928 Ga0207700_10548757 Ga0207700_105487571 214
357 3300025929 Ga0207664_10152285 Ga0207664_101522852 214
358 3300025932 Ga0207690_10015797 Ga0207690_100157973 214
359 3300025934 Ga0207686_10001462 Ga0207686_100014627 214
360 3300025934 Ga0207686_10003331 Ga0207686_100033314 214
361 3300025934 Ga0207686_10123507 Ga0207686_101235072 214
362 3300025934 Ga0207686_10226145 Ga0207686_102261452 214
363 3300025934 Ga0207686_10307077 Ga0207686_103070772 214
364 3300025935 Ga0207709_10003470 Ga0207709_100034703 214
365 3300025935 Ga0207709_10045987 Ga0207709_100459872 214
366 3300025935 Ga0207709_10110389 Ga0207709_101103892 214
367 3300025935 Ga0207709_10296818 Ga0207709_102968182 214
368 3300025935 Ga0207709_10467774 Ga0207709_104677741 214
369 3300025936 Ga0207670_10290363 Ga0207670_102903632 214
370 3300025937 Ga0207669_10070021 Ga0207669_100700212 214
371 3300025937 Ga0207669_10228658 Ga0207669_102286582 214
372 3300025938 Ga0207704_10000948 Ga0207704_100009485 214
373 3300025938 Ga0207704_10209392 Ga0207704_102093922 214
374 3300025938 Ga0207704_10317931 Ga0207704_103179312 214
375 3300025938 Ga0207704_10447928 Ga0207704_104479282 214
376 3300025938 Ga0207704_10661603 Ga0207704_106616031 214
377 3300025939 Ga0207665_10019784 Ga0207665_100197843 214
378 3300025940 Ga0207691_10016851 Ga0207691_100168517 214
379 3300025941 Ga0207711_10026199 Ga0207711_100261995 214
380 3300025941 Ga0207711_10070138 Ga0207711_100701385 214
381 3300025941 Ga0207711_10139985 Ga0207711_101399852 214
382 3300025941 Ga0207711_10677323 Ga0207711_106773232 214
383 3300025942 Ga0207689_10000152 Ga0207689_1000015242 214
384 3300025945 Ga0207679_10163736 Ga0207679_101637362 214
385 3300025945 Ga0207679_10627601 Ga0207679_106276012 214
386 3300025949 Ga0207667_10025530 Ga0207667_100255302 214
387 3300025949 Ga0207667_10027390 Ga0207667_100273904 214
388 3300025949 Ga0207667_10064821 Ga0207667_100648213 214
389 3300025949 Ga0207667_10106339 Ga0207667_101063393 214
390 3300025949 Ga0207667_10790524 Ga0207667_107905242 214
391 3300025960 Ga0207651_10355001 Ga0207651_103550012 214
392 3300025961 Ga0207712_10136756 Ga0207712_101367562 214
393 3300025961 Ga0207712_10397055 Ga0207712_103970551 214
394 3300025981 Ga0207640_10087739 Ga0207640_100877393 214
395 3300025981 Ga0207640_10133347 Ga0207640_101333471 214
396 3300025981 Ga0207640_10214788 Ga0207640_102147882 214
397 3300025986 Ga0207658_10612723 Ga0207658_106127232 214
398 3300026023 Ga0207677_10031150 Ga0207677_100311502 214
399 3300026023 Ga0207677_10076597 Ga0207677_100765973 214
400 3300026023 Ga0207677_10107202 Ga0207677_101072022 214
401 3300026023 Ga0207677_10759746 Ga0207677_107597462 214
402 3300026035 Ga0207703_10016607 Ga0207703_100166075 214
403 3300026035 Ga0207703_10121781 Ga0207703_101217812 214
404 3300026041 Ga0207639_10038467 Ga0207639_100384674 214
405 3300026075 Ga0207708_10000166 Ga0207708_1000016635 214
406 3300026075 Ga0207708_10017322 Ga0207708_100173225 214
407 3300026075 Ga0207708_10095882 Ga0207708_100958822 214
408 3300026078 Ga0207702_10142159 Ga0207702_101421592 214
409 3300026078 Ga0207702_10208666 Ga0207702_102086662 214
410 3300026078 Ga0207702_10228588 Ga0207702_102285882 214
411 3300026078 Ga0207702_10669465 Ga0207702_106694652 214
412 3300026089 Ga0207648_10000131 Ga0207648_1000013115 214
413 3300026089 Ga0207648_10062166 Ga0207648_100621661 214
414 3300026089 Ga0207648_10318485 Ga0207648_103184852 214
415 3300026089 Ga0207648_10322147 Ga0207648_103221471 214
416 3300026089 Ga0207648_10395975 Ga0207648_103959752 214
417 3300026089 Ga0207648_10545680 Ga0207648_105456802 214
418 3300026095 Ga0207676_10465945 Ga0207676_104659452 214
419 3300026116 Ga0207674_10008824 Ga0207674_100088244 214
420 3300026118 Ga0207675_100001354 Ga0207675_10000135411 214
421 3300026118 Ga0207675_101138126 Ga0207675_1011381262 214
422 3300026121 Ga0207683_10009460 Ga0207683_100094603 214
423 3300026121 Ga0207683_10012340 Ga0207683_100123403 214
424 3300026121 Ga0207683_10166274 Ga0207683_101662742 214
425 3300026121 Ga0207683_10423221 Ga0207683_104232212 214
426 3300026121 Ga0207683_10528326 Ga0207683_105283262 214
427 3300026142 Ga0207698_10003270 Ga0207698_100032708 214
428 3300026142 Ga0207698_10004206 Ga0207698_100042062 214
429 3300027360 Ga0209969_1029982 Ga0209969_10299822 214
430 3300027462 Ga0210000_1005848 Ga0210000_10058482 214
431 3300027614 Ga0209970_1008266 Ga0209970_10082662 214
432 3300027695 Ga0209966_1001918 Ga0209966_10019182 214
433 3300027695 Ga0209966_1012280 Ga0209966_10122802 214
434 3300027717 Ga0209998_10064217 Ga0209998_100642172 214
435 3300027876 Ga0209974_10023228 Ga0209974_100232282 214
436 3300027907 Ga0207428_10002577 Ga0207428_1000257720 214
437 3300028380 Ga0268265_10021816 Ga0268265_100218165 214
438 3300028381 Ga0268264_10016844 Ga0268264_100168445 214
439 3300031548 Ga0307408_100095275 Ga0307408_1000952753 214
440 3300031548 Ga0307408_100198227 Ga0307408_1001982272 214
441 3300031548 Ga0307408_100238807 Ga0307408_1002388072 214
442 3300031548 Ga0307408_100248789 Ga0307408_1002487892 214
443 3300031548 Ga0307408_100360948 Ga0307408_1003609482 214
444 3300031548 Ga0307408_100368805 Ga0307408_1003688052 214
445 3300031548 Ga0307408_100597885 Ga0307408_1005978851 214
446 3300031731 Ga0307405_10304901 Ga0307405_103049011 214
447 3300031901 Ga0307406_10267863 Ga0307406_102678632 214
448 3300031901 Ga0307406_10271753 Ga0307406_102717532 214
449 3300031901 Ga0307406_10811482 Ga0307406_108114822 214
450 3300031911 Ga0307412_10396380 Ga0307412_103963801 214
451 3300031911 Ga0307412_10493481 Ga0307412_104934812 214
452 3300031911 Ga0307412_10595535 Ga0307412_105955352 214
453 3300031995 Ga0307409_100156840 Ga0307409_1001568403 214
454 3300032002 Ga0307416_100252561 Ga0307416_1002525612 214
455 3300032002 Ga0307416_100322240 Ga0307416_1003222402 214
456 3300032002 Ga0307416_100568466 Ga0307416_1005684662 214
457 3300032002 Ga0307416_100833397 Ga0307416_1008333972 214
458 3300032005 Ga0307411_10597579 Ga0307411_105975791 214
459 3300035084 Ga0373928_0071385 Ga0373928_0071385_12_656 214
460 3300035085 Ga0373929_0055495 Ga0373929_0055495_220_897 214
461 3300035090 Ga0373949_0023738 Ga0373949_0023738_538_1182 214
462 3300035115 Ga0373941_0012088 Ga0373941_0012088_21_665 214
463 3300035119 Ga0373956_0266452 Ga0373956_0266452_112_792 214
464 3300035120 Ga0373957_0223689 Ga0373957_0223689_108_758 214
465 3300035170 Ga0373943_0291465 Ga0373943_0291465_251_895 214
466 3300035172 Ga0373955_0057054 Ga0373955_0057054_1243_1923 214
467 3300035241 Ga0373961_0097542 Ga0373961_0097542_250_894 214
468 3300035242 Ga0373962_0010642 Ga0373962_0010642_324_968 214
469 3300035410 Ga0373924_0007898 Ga0373924_0007898_216_896 214
470 3300035691 Ga0373931_0009772 Ga0373931_0009772_2698_3375 214
471 3300035691 Ga0373931_0311099 Ga0373931_0311099_294_938 214
472 3300035691 Ga0373931_0371158 Ga0373931_0371158_147_791 214
473 3300035695 Ga0373927_0086519 Ga0373927_0086519_1105_1785 214
474 3300035695 Ga0373927_0196449 Ga0373927_0196449_644_1288 214
475 3300035725 Ga0373947_0207843 Ga0373947_0207843_383_1060 214
476 3300036401 Ga0373937_0117836 Ga0373937_0117836_62_742 214
477 3300036401 Ga0373937_0188555 Ga0373937_0188555_841_1521 214
478 3300037068 Ga0373925_0051113 Ga0373925_0051113_1822_2502 214
479 3300037068 Ga0373925_0364727 Ga0373925_0364727_81_761 214
480 3300037312 Ga0395899_0273537 Ga0395899_0273537_309_986 214
481 3300037471 Ga0395905_0186083 Ga0395905_0186083_1091_1768 214
482 3300038443 Ga0395901_0107553 Ga0395901_0107553_740_1417 214
483 3300039437 Ga0436365_0234883 Ga0436365_0234883_5358_6035 214
484 3300041407 Ga0439447_017732 Ga0439447_017732_540_1244 214
485 3300041501 Ga0451845_0324412 Ga0451845_0324412_242_919 214
486 3300042001 Ga0439441_008321 Ga0439441_008321_615_1295 214
487 3300042003 Ga0439443_008880 Ga0439443_008880_747_1391 214
488 3300042156 Ga0439446_0027170 Ga0439446_0027170_299_943 214
489 3300042461 Ga0439460_0020812 Ga0439460_0020812_161_805 214
490 3300044693 Ga0466961_0192394 Ga0466961_0192394_178_855 214
491 3300044719 Ga0466971_0062066 Ga0466971_0062066_608_1285 214
492 3300044901 Ga0466960_0087637 Ga0466960_0087637_621_1265 214
493 3300045049 Ga0466959_0125502 Ga0466959_0125502_764_1441 214
494 3300045051 Ga0451576_0116245 Ga0451576_0116245_868_1512 214
495 3300045051 Ga0451576_0153982 Ga0451576_0153982_1473_2150 214
496 3300045836 Ga0466958_0099105 Ga0466958_0099105_505_1182 214
497 3300046454 Ga0495592_0010771 Ga0495592_0010771_3921_4601 214
498 3300046463 Ga0495653_0047820 Ga0495653_0047820_1498_2178 214
499 3300046477 Ga0495664_0439797 Ga0495664_0439797_81_761 214
500 3300046511 Ga0495608_0034154 Ga0495608_0034154_2417_3097 214
501 3300046516 Ga0495628_0033977 Ga0495628_0033977_1745_2425 214
502 3300046537 Ga0495598_0078835 Ga0495598_0078835_119_793 214
503 3300046539 Ga0495621_0016886 Ga0495621_0016886_665_1345 214
504 3300046539 Ga0495621_0031435 Ga0495621_0031435_264_944 214
505 3300046539 Ga0495621_0050641 Ga0495621_0050641_777_1421 214
506 3300046539 Ga0495621_0052556 Ga0495621_0052556_631_1275 214
507 3300046543 Ga0495645_0004434 Ga0495645_0004434_5745_6425 214
508 3300046664 Ga0495659_0134051 Ga0495659_0134051_83_727 214
509 3300046678 Ga0495599_0005280 Ga0495599_0005280_5092_5772 214
510 3300046679 Ga0495623_0022426 Ga0495623_0022426_2852_3529 214
511 3300046684 Ga0495669_0093411 Ga0495669_0093411_380_1024 214
512 3300047317 Ga0495604_0043216 Ga0495604_0043216_272_949 214
513 3300047322 Ga0495680_0032331 Ga0495680_0032331_488_1168 214
514 3300047471 Ga0495684_0123545 Ga0495684_0123545_587_1267 214
515 3300048907 Ga0496104_0279210 Ga0496104_0279210_342_1019 214
516 3300048908 Ga0496105_0880661 Ga0496105_0880661_10_660 214
517 3300048913 Ga0496110_0100519 Ga0496110_0100519_1758_2435 214
518 3300049520 Ga0501297_019309 Ga0501297_019309_69_749 214
519 3300049571 Ga0501034_0001554 Ga0501034_0001554_17361_18005 214
520 3300049571 Ga0501034_0028169 Ga0501034_0028169_3172_3816 214
521 3300049575 Ga0501039_0402408 Ga0501039_0402408_82_726 214
522 3300049580 Ga0501046_0025159 Ga0501046_0025159_1532_2176 214
523 3300049582 Ga0501048_0036384 Ga0501048_0036384_2492_3136 214
524 3300049582 Ga0501048_0266060 Ga0501048_0266060_48_713 214
525 3300049584 Ga0501068_0008226 Ga0501068_0008226_2904_3548 214
526 3300049586 Ga0501070_0083637 Ga0501070_0083637_951_1595 214
527 3300049588 Ga0501072_0008617 Ga0501072_0008617_1127_1771 214
528 3300049589 Ga0501073_0019315 Ga0501073_0019315_2918_3562 214
529 3300049590 Ga0501074_0024375 Ga0501074_0024375_410_1054 214
530 3300049591 Ga0501075_0227323 Ga0501075_0227323_611_1255 214
531 3300049670 Ga0501236_012178 Ga0501236_012178_208_852 214
532 3300049741 Ga0501079_0168548 Ga0501079_0168548_921_1565 214
533 3300049741 Ga0501079_0637094 Ga0501079_0637094_134_778 214
534 3300049742 Ga0501080_0002441 Ga0501080_0002441_9862_10506 214
535 3300049743 Ga0501081_0037793 Ga0501081_0037793_1805_2449 214
536 3300049743 Ga0501081_0157186 Ga0501081_0157186_84_749 214
537 3300049744 Ga0501083_0036118 Ga0501083_0036118_1075_1719 214
538 3300049744 Ga0501083_0127752 Ga0501083_0127752_175_831 214
539 3300049776 Ga0501280_003541 Ga0501280_003541_752_1402 214
540 3300049778 Ga0501282_008168 Ga0501282_008168_430_1080 214
541 3300050492 nmdc:mga0yw44_460155_c1 nmdc:mga0yw44_460155_c1_62_742 214
542 3300050493 nmdc:mga0k408_153227_c1 nmdc:mga0k408_153227_c1_392_1087 214
543 3300050493 nmdc:mga0k408_16043_c1 nmdc:mga0k408_16043_c1_2458_3135 214
544 3300050493 nmdc:mga0k408_367889_c1 nmdc:mga0k408_367889_c1_114_794 214
545 3300050496 nmdc:mga07m45_120901_c1 nmdc:mga07m45_120901_c1_700_1377 214
546 3300050507 nmdc:mga05p37_1083389_c1 nmdc:mga05p37_1083389_c1_170_814 214
547 3300050507 nmdc:mga05p37_34342_c1 nmdc:mga05p37_34342_c1_3532_4176 214
548 3300050507 nmdc:mga05p37_634667_c1 nmdc:mga05p37_634667_c1_506_1150 214
549 3300050508 nmdc:mga09592_152375_c1 nmdc:mga09592_152375_c1_453_1127 214
550 3300050508 nmdc:mga09592_345373_c1 nmdc:mga09592_345373_c1_90_734 214
551 3300050508 nmdc:mga09592_548895_c1 nmdc:mga09592_548895_c1_199_843 214
552 3300050509 nmdc:mga0qj67_293433_c1 nmdc:mga0qj67_293433_c1_425_1069 214
553 3300050509 nmdc:mga0qj67_35567_c1 nmdc:mga0qj67_35567_c1_2619_3263 214
554 3300050510 nmdc:mga06r32_281241_c1 nmdc:mga06r32_281241_c1_751_1395 214
555 3300050510 nmdc:mga06r32_982498_c1 nmdc:mga06r32_982498_c1_23_667 214
556 3300050511 nmdc:mga08y16_1100665_c1 nmdc:mga08y16_1100665_c1_31_681 214
557 3300050511 nmdc:mga08y16_52711_c1 nmdc:mga08y16_52711_c1_1326_1970 214
558 3300050511 nmdc:mga08y16_585_c1 nmdc:mga08y16_585_c1_26680_27354 214
559 3300050512 nmdc:mga0n895_1811_c1 nmdc:mga0n895_1811_c1_2316_2960 214
560 3300050512 nmdc:mga0n895_74764_c1 nmdc:mga0n895_74764_c1_2571_3251 214
561 3300050512 nmdc:mga0n895_774982_c1 nmdc:mga0n895_774982_c1_244_888 214
562 3300050513 nmdc:mga0rr50_1193_c1 nmdc:mga0rr50_1193_c1_2074_2718 214
563 3300050513 nmdc:mga0rr50_22826_c1 nmdc:mga0rr50_22826_c1_1221_1865 214
564 3300050513 nmdc:mga0rr50_231443_c1 nmdc:mga0rr50_231443_c1_790_1470 214
565 3300050513 nmdc:mga0rr50_331385_c1 nmdc:mga0rr50_331385_c1_382_1026 214
566 3300050514 nmdc:mga08x19_11345_c1 nmdc:mga08x19_11345_c1_3550_4245 214
567 3300050514 nmdc:mga08x19_14467_c1 nmdc:mga08x19_14467_c1_1106_1750 214
568 3300050514 nmdc:mga08x19_151057_c1 nmdc:mga08x19_151057_c1_810_1454 214
569 3300050514 nmdc:mga08x19_56189_c1 nmdc:mga08x19_56189_c1_1810_2454 214
570 3300050514 nmdc:mga08x19_762_c1 nmdc:mga08x19_762_c1_1310_1954 214
571 3300050515 nmdc:mga0a205_308622_c1 nmdc:mga0a205_308622_c1_493_1140 214
572 3300050515 nmdc:mga0a205_331743_c1 nmdc:mga0a205_331743_c1_153_833 214
573 3300050515 nmdc:mga0a205_390300_c1 nmdc:mga0a205_390300_c1_348_1031 214
574 3300050515 nmdc:mga0a205_393219_c1 nmdc:mga0a205_393219_c1_98_742 214
575 3300050515 nmdc:mga0a205_41071_c1 nmdc:mga0a205_41071_c1_1109_1753 214
576 3300050516 nmdc:mga0sz30_49409_c1 nmdc:mga0sz30_49409_c1_495_1190 214
577 3300053077 Ga0495601_0030984 Ga0495601_0030984_318_998 214
578 3300053084 Ga0495595_0067123 Ga0495595_0067123_159_839 214
579 3300053085 Ga0495619_0517778 Ga0495619_0517778_30_710 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04340

DUF484

Protein of unknown function, DUF484

18

239

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e98-assembly1.cif.gz_B crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution 0.7757 40 214
3e98-assembly1.cif.gz_B crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution 0.7564 40 214
3trc-assembly1.cif.gz_A-2 structure of the gaf domain from a phosphoenolpyruvate-protein phosphotransferase (ptsp) from coxiella burnetii 0.7476 74 212
3oov-assembly2.cif.gz_A crystal structure of a methyl-accepting chemotaxis protein, residues 122 to 287 0.7053 79 212
3cit-assembly1.cif.gz_B-2 crystal structure of the gaf domain of a putative sensor histidine kinase from pseudomonas syringae pv. tomato 0.699 65 212
ID Description Score Start End Superfamily
af_P23305_50_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8275 38 213 3.30.450.40
af_C0P685_1_140_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8067 73 100 1.25.40.10
af_P23305_50_233_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7906 38 213 3.30.450.40
af_P37013_4_170_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7862 73 213 3.30.450.40
3e98B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7575 40 214 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A080LYV1-F1-model_v4 DUF484 family protein 0.9525 60 211
AF-A0A4Q5VHV1-F1-model_v4 deleted 0.9445 53 213
AF-A0A522BTZ7-F1-model_v4 DUF484 family protein 0.9402 79 212
AF-A0A1G0DQ50-F1-model_v4 deleted 0.9401 57 213
AF-A0A679HW17-F1-model_v4 Uncharacterized protein 0.9326 2 211

Feature Viewer

pLDDT pTM Quality
93.56 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map