F465823
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 377 | 511 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10011464|Ga0111539_1001146413 |
| Length | 444 |
| Sequence | VANVFQSSATGRRTIRIAMNGVTGRMGTNQHLVRSILAIREEGGIAVAPGEALWPVPVLVGRDERKLSALAEPHELEYTTDLAGALADCDVYFDAQVTSRREDAVRAAVEAGRHVYCEKPLTEDVASALALARAADEAGIKHGVVQDKLFLPGIRTLKRVLDSGALGRVLSVRGEFGYWVFPGPDPTPQRPSWNYRAQDGGGIVADMFAHWRYVLDELFGAVHGVFALGATHVPVRYDEQGEPYEATAEDAAYAMFELDGGVIAQLNSSWCVRVDRDELFELQVDGTEGTAVAGLRDCRLQPGAATPRSVWNPDLPDPVHHRAAWMPVPGEEPDNAFKVQWELFLRHVALDEPFPWDFRAGARGVQLSELGLRSWRERRWVEVPVLRRWRPSPCGSRGAAARSSPRTSWPIRSASQAHWTGTRRSRSGGTCGPTGSAWRRRWTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 4 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 5 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 6 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 7 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 8 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 9 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 10 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 11 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 12 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 13 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 14 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 15 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 16 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 17 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 18 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 19 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 20 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 21 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 22 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 23 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 24 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 25 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 26 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 27 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 28 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 29 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 30 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 31 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 32 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 33 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 34 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 35 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 36 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 37 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 38 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 39 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 40 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 41 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 42 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 43 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 44 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 45 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 46 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 47 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 48 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 49 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 50 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 51 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 52 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 53 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 54 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 55 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 56 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 57 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 192 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 234 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 235 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 353 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 358 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 359 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 369 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 370 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 371 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 372 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 373 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 374 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 375 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 376 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 377 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.56 |
| Metatranscriptomes | 0.69 |
| Isolates | 11.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0.17 |
| Rhizoplane | 3.45 |
| Rhizosphere | 81.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10016034 | 3300001990 | Bacteria | 2420 |
| 2 | Ga0006562J51391_1027448 | 3300003578 | Bacteria | 5880 |
| 3 | Ga0006562J51391_1027450 | 3300003578 | Bacteria | 5940 |
| 4 | Ga0006562J51391_1115102 | 3300003578 | Bacteria | 5940 |
| 5 | Ga0006562J51391_1115103 | 3300003578 | Bacteria | 2937 |
| 6 | Ga0065712_10131502 | 3300005290 | Bacteria | 1544 |
| 7 | Ga0070658_10000837 | 3300005327 | Bacteria | 26278 |
| 8 | Ga0070658_10006445 | 3300005327 | Bacteria | 9511 |
| 9 | Ga0070658_10032845 | 3300005327 | Bacteria | 4173 |
| 10 | Ga0070658_10120292 | 3300005327 | Bacteria | 2182 |
| 11 | Ga0070676_10001373 | 3300005328 | Bacteria | 12266 |
| 12 | Ga0070676_10002091 | 3300005328 | Bacteria | 10155 |
| 13 | Ga0070676_10033478 | 3300005328 | Bacteria | 2949 |
| 14 | Ga0070683_100039836 | 3300005329 | Bacteria | 4316 |
| 15 | Ga0070683_100055663 | 3300005329 | Bacteria | 3671 |
| 16 | Ga0070683_100090591 | 3300005329 | Bacteria | 2871 |
| 17 | Ga0070670_100002131 | 3300005331 | Bacteria | 16246 |
| 18 | Ga0070670_100172402 | 3300005331 | Bacteria | 1877 |
| 19 | Ga0070677_10045907 | 3300005333 | Bacteria | 1745 |
| 20 | Ga0068869_100143892 | 3300005334 | Bacteria | 1844 |
| 21 | Ga0070666_10004120 | 3300005335 | Bacteria | 8824 |
| 22 | Ga0068868_100012473 | 3300005338 | Bacteria | 6214 |
| 23 | Ga0070660_100021866 | 3300005339 | Bacteria | 4723 |
| 24 | Ga0070660_100025774 | 3300005339 | Bacteria | 4372 |
| 25 | Ga0070660_100061557 | 3300005339 | Bacteria | 2914 |
| 26 | Ga0070691_10006836 | 3300005341 | Bacteria | 5215 |
| 27 | Ga0070661_100141629 | 3300005344 | Bacteria | 1812 |
| 28 | Ga0070661_100146358 | 3300005344 | Bacteria | 1784 |
| 29 | Ga0070668_100004745 | 3300005347 | Bacteria | 10084 |
| 30 | Ga0070668_100021164 | 3300005347 | Bacteria | 4916 |
| 31 | Ga0070675_100003182 | 3300005354 | Bacteria | 12425 |
| 32 | Ga0070671_100003465 | 3300005355 | Bacteria | 12315 |
| 33 | Ga0070671_100077306 | 3300005355 | Bacteria | 2781 |
| 34 | Ga0070674_100008362 | 3300005356 | Bacteria | 6160 |
| 35 | Ga0070673_100003135 | 3300005364 | Bacteria | 10232 |
| 36 | Ga0070659_100025886 | 3300005366 | Bacteria | 4512 |
| 37 | Ga0070667_100316451 | 3300005367 | Bacteria | 1408 |
| 38 | Ga0070709_10007846 | 3300005434 | Bacteria | 5861 |
| 39 | Ga0070709_10092569 | 3300005434 | Bacteria | 1997 |
| 40 | Ga0070714_100048184 | 3300005435 | Bacteria | 3623 |
| 41 | Ga0070710_10006157 | 3300005437 | Bacteria | 5739 |
| 42 | Ga0070711_100023906 | 3300005439 | Bacteria | 3981 |
| 43 | Ga0070700_100037877 | 3300005441 | Bacteria | 2935 |
| 44 | Ga0070708_100000065 | 3300005445 | Bacteria | 69306 |
| 45 | Ga0070663_100002740 | 3300005455 | Bacteria | 9983 |
| 46 | Ga0070663_100008508 | 3300005455 | Bacteria | 6316 |
| 47 | Ga0070663_100010425 | 3300005455 | Bacteria | 5792 |
| 48 | Ga0070663_100022037 | 3300005455 | Bacteria | 4251 |
| 49 | Ga0070681_10106805 | 3300005458 | Bacteria | 2741 |
| 50 | Ga0070681_10159132 | 3300005458 | Bacteria | 2182 |
| 51 | Ga0068867_100003568 | 3300005459 | Bacteria | 10945 |
| 52 | Ga0068867_100067035 | 3300005459 | Bacteria | 2675 |
| 53 | Ga0070707_100039203 | 3300005468 | Bacteria | 4528 |
| 54 | Ga0070698_100145958 | 3300005471 | Bacteria | 2315 |
| 55 | Ga0070699_100008755 | 3300005518 | Bacteria | 8771 |
| 56 | Ga0070679_100000354 | 3300005530 | Bacteria | 39082 |
| 57 | Ga0070679_100009371 | 3300005530 | Bacteria | 9260 |
| 58 | Ga0070679_100021162 | 3300005530 | Bacteria | 6346 |
| 59 | Ga0070684_100135835 | 3300005535 | Bacteria | 2221 |
| 60 | Ga0070684_100189803 | 3300005535 | Bacteria | 1869 |
| 61 | Ga0070684_100214798 | 3300005535 | Bacteria | 1754 |
| 62 | Ga0068853_100005015 | 3300005539 | Bacteria | 10321 |
| 63 | Ga0068853_100017623 | 3300005539 | Bacteria | 5895 |
| 64 | Ga0068853_100246157 | 3300005539 | Bacteria | 1640 |
| 65 | Ga0070672_100015179 | 3300005543 | Bacteria | 5476 |
| 66 | Ga0070672_100060451 | 3300005543 | Bacteria | 2983 |
| 67 | Ga0070672_100138598 | 3300005543 | Bacteria | 2005 |
| 68 | Ga0070665_100000204 | 3300005548 | Bacteria | 103980 |
| 69 | Ga0070665_100004380 | 3300005548 | Bacteria | 14846 |
| 70 | Ga0068855_100001455 | 3300005563 | Bacteria | 29543 |
| 71 | Ga0068855_100049744 | 3300005563 | Bacteria | 4943 |
| 72 | Ga0070664_100035087 | 3300005564 | Bacteria | 4210 |
| 73 | Ga0070664_100086240 | 3300005564 | Bacteria | 2713 |
| 74 | Ga0068857_100009005 | 3300005577 | Bacteria | 8653 |
| 75 | Ga0068856_100134051 | 3300005614 | Bacteria | 2482 |
| 76 | Ga0068852_100003935 | 3300005616 | Bacteria | 10438 |
| 77 | Ga0068859_100186956 | 3300005617 | Bacteria | 2155 |
| 78 | Ga0068861_100002273 | 3300005719 | Bacteria | 12478 |
| 79 | Ga0068851_10000749 | 3300005834 | Bacteria | 13938 |
| 80 | Ga0068851_10019024 | 3300005834 | Bacteria | 3317 |
| 81 | Ga0068863_100012995 | 3300005841 | Bacteria | 8029 |
| 82 | Ga0068858_100086025 | 3300005842 | Bacteria | 2925 |
| 83 | Ga0068860_100021822 | 3300005843 | Bacteria | 6194 |
| 84 | Ga0081455_10008019 | 3300005937 | Bacteria | 11034 |
| 85 | Ga0081455_10047944 | 3300005937 | Bacteria | 3695 |
| 86 | Ga0081538_10001934 | 3300005981 | Bacteria | 20747 |
| 87 | Ga0081540_1006447 | 3300005983 | Bacteria | 8541 |
| 88 | Ga0081540_1027095 | 3300005983 | Bacteria | 3254 |
| 89 | Ga0081539_10001070 | 3300005985 | Bacteria | 50023 |
| 90 | Ga0070717_10136867 | 3300006028 | Bacteria | 2110 |
| 91 | Ga0075370_10066998 | 3300006353 | Bacteria | 2049 |
| 92 | Ga0075428_100000289 | 3300006844 | Bacteria | 49296 |
| 93 | Ga0075428_100032142 | 3300006844 | Bacteria | 5797 |
| 94 | Ga0075428_100212173 | 3300006844 | Bacteria | 2092 |
| 95 | Ga0075428_100256468 | 3300006844 | Bacteria | 1884 |
| 96 | Ga0075430_100013280 | 3300006846 | Bacteria | 7020 |
| 97 | Ga0075431_100015347 | 3300006847 | Bacteria | 7762 |
| 98 | Ga0075431_100114206 | 3300006847 | Bacteria | 2788 |
| 99 | Ga0075434_100075672 | 3300006871 | Bacteria | 3361 |
| 100 | Ga0075434_100095835 | 3300006871 | Bacteria | 2972 |
| 101 | Ga0075429_100000402 | 3300006880 | Bacteria | 31962 |
| 102 | Ga0075429_100003160 | 3300006880 | Bacteria | 13999 |
| 103 | Ga0075429_100298423 | 3300006880 | Bacteria | 1411 |
| 104 | Ga0068865_100078854 | 3300006881 | Bacteria | 2357 |
| 105 | Ga0068865_100263345 | 3300006881 | Bacteria | 1366 |
| 106 | Ga0097620_100186948 | 3300006931 | Bacteria | 2155 |
| 107 | Ga0075435_100073666 | 3300007076 | Bacteria | 2792 |
| 108 | Ga0105240_10001673 | 3300009093 | Bacteria | 37631 |
| 109 | Ga0105240_10010403 | 3300009093 | Bacteria | 13073 |
| 110 | Ga0105240_10060886 | 3300009093 | Bacteria | 4705 |
| 111 | Ga0105240_10063734 | 3300009093 | Bacteria | 4583 |
| 112 | Ga0105240_10125892 | 3300009093 | Bacteria | 3079 |
| 113 | Ga0111539_10011464 | 3300009094 | Bacteria | 11128 |
| 114 | Ga0111539_10023670 | 3300009094 | Bacteria | 7546 |
| 115 | Ga0105245_10270456 | 3300009098 | Bacteria | 1657 |
| 116 | Ga0114129_10001926 | 3300009147 | Bacteria | 28355 |
| 117 | Ga0114129_10029362 | 3300009147 | Bacteria | 7789 |
| 118 | Ga0114129_10029903 | 3300009147 | Bacteria | 7714 |
| 119 | Ga0105241_10049319 | 3300009174 | Bacteria | 3206 |
| 120 | Ga0105248_10124423 | 3300009177 | Bacteria | 2909 |
| 121 | Ga0105248_10308780 | 3300009177 | Bacteria | 1781 |
| 122 | Ga0105237_10114640 | 3300009545 | Bacteria | 2688 |
| 123 | Ga0105238_10015806 | 3300009551 | Bacteria | 7639 |
| 124 | Ga0105238_10016367 | 3300009551 | Bacteria | 7505 |
| 125 | Ga0105238_10048034 | 3300009551 | Bacteria | 4302 |
| 126 | Ga0105238_10445834 | 3300009551 | Bacteria | 1291 |
| 127 | Ga0105249_10061024 | 3300009553 | Bacteria | 3460 |
| 128 | Ga0105239_10338411 | 3300010375 | Bacteria | 1698 |
| 129 | Ga0105239_10486185 | 3300010375 | Bacteria | 1403 |
| 130 | Ga0105246_10083451 | 3300011119 | Bacteria | 2283 |
| 131 | Ga0157373_10128977 | 3300013100 | Bacteria | 1778 |
| 132 | Ga0157370_10001669 | 3300013104 | Bacteria | 27346 |
| 133 | Ga0157370_10095233 | 3300013104 | Bacteria | 2793 |
| 134 | Ga0157370_10289729 | 3300013104 | Bacteria | 1512 |
| 135 | Ga0157369_10099980 | 3300013105 | Bacteria | 3091 |
| 136 | Ga0157374_10047770 | 3300013296 | Bacteria | 3969 |
| 137 | Ga0157372_10120473 | 3300013307 | Bacteria | 3013 |
| 138 | Ga0157372_10122566 | 3300013307 | Bacteria | 2987 |
| 139 | Ga0157372_10174719 | 3300013307 | Bacteria | 2486 |
| 140 | Ga0157372_10405462 | 3300013307 | Bacteria | 1588 |
| 141 | Ga0157375_10003512 | 3300013308 | Bacteria | 13596 |
| 142 | Ga0163163_10101808 | 3300014325 | Bacteria | 2895 |
| 143 | Ga0163163_10200074 | 3300014325 | Bacteria | 2046 |
| 144 | Ga0182008_10015751 | 3300014497 | Bacteria | 3939 |
| 145 | Ga0157376_10247514 | 3300014969 | Bacteria | 1663 |
| 146 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 147 | Ga0163161_10128810 | 3300017792 | Bacteria | 1907 |
| 148 | Ga0213876_10034090 | 3300021384 | Bacteria | 2684 |
| 149 | Ga0207426_1001238 | 3300025302 | Bacteria | 22461 |
| 150 | Ga0207426_1003918 | 3300025302 | Bacteria | 7634 |
| 151 | Ga0207697_10062524 | 3300025315 | Bacteria | 1550 |
| 152 | Ga0207656_10050037 | 3300025321 | Bacteria | 1803 |
| 153 | Ga0207682_10001577 | 3300025893 | Bacteria | 10497 |
| 154 | Ga0207682_10010885 | 3300025893 | Bacteria | 3560 |
| 155 | Ga0207692_10035126 | 3300025898 | Bacteria | 2434 |
| 156 | Ga0207647_10010093 | 3300025904 | Bacteria | 6679 |
| 157 | Ga0207685_10040725 | 3300025905 | Bacteria | 1733 |
| 158 | Ga0207699_10047663 | 3300025906 | Bacteria | 2513 |
| 159 | Ga0207645_10041189 | 3300025907 | Bacteria | 2958 |
| 160 | Ga0207643_10002947 | 3300025908 | Bacteria | 9182 |
| 161 | Ga0207705_10001995 | 3300025909 | Bacteria | 15872 |
| 162 | Ga0207705_10009902 | 3300025909 | Bacteria | 6940 |
| 163 | Ga0207705_10009948 | 3300025909 | Bacteria | 6925 |
| 164 | Ga0207705_10078283 | 3300025909 | Bacteria | 2406 |
| 165 | Ga0207705_10103367 | 3300025909 | Bacteria | 2098 |
| 166 | Ga0207705_10129915 | 3300025909 | Bacteria | 1874 |
| 167 | Ga0207707_10187349 | 3300025912 | Bacteria | 1806 |
| 168 | Ga0207695_10006092 | 3300025913 | Bacteria | 15738 |
| 169 | Ga0207695_10072759 | 3300025913 | Bacteria | 3505 |
| 170 | Ga0207695_10393437 | 3300025913 | Bacteria | 1271 |
| 171 | Ga0207671_10108826 | 3300025914 | Bacteria | 2107 |
| 172 | Ga0207662_10007297 | 3300025918 | Bacteria | 6010 |
| 173 | Ga0207662_10145707 | 3300025918 | Bacteria | 1503 |
| 174 | Ga0207657_10019568 | 3300025919 | Bacteria | 6424 |
| 175 | Ga0207657_10035164 | 3300025919 | Bacteria | 4496 |
| 176 | Ga0207649_10096825 | 3300025920 | Bacteria | 1945 |
| 177 | Ga0207652_10000964 | 3300025921 | Bacteria | 26866 |
| 178 | Ga0207652_10004503 | 3300025921 | Bacteria | 11316 |
| 179 | Ga0207652_10095879 | 3300025921 | Bacteria | 2613 |
| 180 | Ga0207681_10020937 | 3300025923 | Bacteria | 4151 |
| 181 | Ga0207681_10042369 | 3300025923 | Bacteria | 3041 |
| 182 | Ga0207694_10213221 | 3300025924 | Bacteria | 1573 |
| 183 | Ga0207659_10072839 | 3300025926 | Bacteria | 2513 |
| 184 | Ga0207687_10032836 | 3300025927 | Bacteria | 3518 |
| 185 | Ga0207664_10046789 | 3300025929 | Bacteria | 3397 |
| 186 | Ga0207664_10176570 | 3300025929 | Bacteria | 1832 |
| 187 | Ga0207644_10005243 | 3300025931 | Bacteria | 8460 |
| 188 | Ga0207644_10185878 | 3300025931 | Bacteria | 1631 |
| 189 | Ga0207690_10118545 | 3300025932 | Bacteria | 1918 |
| 190 | Ga0207669_10244596 | 3300025937 | Bacteria | 1332 |
| 191 | Ga0207704_10071369 | 3300025938 | Bacteria | 2204 |
| 192 | Ga0207691_10001445 | 3300025940 | Bacteria | 23679 |
| 193 | Ga0207691_10040127 | 3300025940 | Bacteria | 4327 |
| 194 | Ga0207711_10310787 | 3300025941 | Bacteria | 1455 |
| 195 | Ga0207679_10053486 | 3300025945 | Bacteria | 2967 |
| 196 | Ga0207667_10003334 | 3300025949 | Bacteria | 19822 |
| 197 | Ga0207667_10038455 | 3300025949 | Bacteria | 5110 |
| 198 | Ga0207651_10026090 | 3300025960 | Bacteria | 3643 |
| 199 | Ga0207712_10080674 | 3300025961 | Bacteria | 2367 |
| 200 | Ga0207668_10041511 | 3300025972 | Bacteria | 3110 |
| 201 | Ga0207668_10102500 | 3300025972 | Bacteria | 2129 |
| 202 | Ga0207658_10024913 | 3300025986 | Bacteria | 4186 |
| 203 | Ga0207703_10160743 | 3300026035 | Bacteria | 1967 |
| 204 | Ga0207639_10010336 | 3300026041 | Bacteria | 6463 |
| 205 | Ga0207678_10000523 | 3300026067 | Bacteria | 34843 |
| 206 | Ga0207678_10000702 | 3300026067 | Bacteria | 30550 |
| 207 | Ga0207678_10006690 | 3300026067 | Bacteria | 10222 |
| 208 | Ga0207678_10008308 | 3300026067 | Bacteria | 9149 |
| 209 | Ga0207678_10036630 | 3300026067 | Bacteria | 4271 |
| 210 | Ga0207678_10197338 | 3300026067 | Bacteria | 1720 |
| 211 | Ga0207708_10072776 | 3300026075 | Bacteria | 2634 |
| 212 | Ga0207708_10212000 | 3300026075 | Bacteria | 1549 |
| 213 | Ga0207641_10425955 | 3300026088 | Bacteria | 1279 |
| 214 | Ga0207648_10005115 | 3300026089 | Bacteria | 13292 |
| 215 | Ga0207648_10106447 | 3300026089 | Bacteria | 2461 |
| 216 | Ga0207676_10082429 | 3300026095 | Bacteria | 2616 |
| 217 | Ga0207674_10007107 | 3300026116 | Bacteria | 13083 |
| 218 | Ga0207674_10007750 | 3300026116 | Bacteria | 12493 |
| 219 | Ga0207674_10092027 | 3300026116 | Bacteria | 3022 |
| 220 | Ga0207675_100128387 | 3300026118 | Bacteria | 2403 |
| 221 | Ga0207683_10000005 | 3300026121 | Bacteria | 187889 |
| 222 | Ga0207683_10220127 | 3300026121 | Bacteria | 1729 |
| 223 | Ga0207683_10450279 | 3300026121 | Bacteria | 1187 |
| 224 | Ga0209371_1017176 | 3300027312 | Bacteria | 1882 |
| 225 | Ga0209967_1004815 | 3300027364 | Bacteria | 1805 |
| 226 | Ga0268266_10000475 | 3300028379 | Bacteria | 57835 |
| 227 | Ga0268266_10035506 | 3300028379 | Bacteria | 4240 |
| 228 | Ga0265326_10001407 | 3300028558 | Bacteria | 8471 |
| 229 | Ga0265319_1017168 | 3300028563 | Bacteria | 2757 |
| 230 | Ga0265319_1046943 | 3300028563 | Bacteria | 1438 |
| 231 | Ga0265334_10002258 | 3300028573 | Bacteria | 9056 |
| 232 | Ga0265323_10000925 | 3300028653 | Bacteria | 15428 |
| 233 | Ga0265336_10043776 | 3300028666 | Bacteria | 1363 |
| 234 | Ga0307517_10006019 | 3300028786 | Bacteria | 18073 |
| 235 | Ga0307515_10002074 | 3300028794 | Bacteria | 44147 |
| 236 | Ga0307515_10002741 | 3300028794 | Bacteria | 37704 |
| 237 | Ga0265338_10001044 | 3300028800 | Bacteria | 46320 |
| 238 | Ga0265338_10062022 | 3300028800 | Bacteria | 3272 |
| 239 | Ga0307511_10001661 | 3300030521 | Bacteria | 23425 |
| 240 | Ga0265332_10003899 | 3300031238 | Bacteria | 7116 |
| 241 | Ga0265320_10000130 | 3300031240 | Bacteria | 65406 |
| 242 | Ga0265325_10030176 | 3300031241 | Bacteria | 2909 |
| 243 | Ga0265340_10027586 | 3300031247 | Bacteria | 2861 |
| 244 | Ga0265339_10032022 | 3300031249 | Bacteria | 2968 |
| 245 | Ga0265327_10007543 | 3300031251 | Bacteria | 8367 |
| 246 | Ga0307513_10034866 | 3300031456 | Bacteria | 5639 |
| 247 | Ga0307509_10000403 | 3300031507 | Bacteria | 72510 |
| 248 | Ga0307508_10052444 | 3300031616 | Bacteria | 3622 |
| 249 | Ga0307508_10065536 | 3300031616 | Bacteria | 3200 |
| 250 | Ga0307514_10064088 | 3300031649 | Bacteria | 2788 |
| 251 | Ga0265314_10009598 | 3300031711 | Bacteria | 8150 |
| 252 | Ga0265342_10007811 | 3300031712 | Bacteria | 7774 |
| 253 | Ga0307516_10012545 | 3300031730 | Bacteria | 9121 |
| 254 | Ga0307516_10013517 | 3300031730 | Bacteria | 8686 |
| 255 | Ga0307405_10013241 | 3300031731 | Bacteria | 4396 |
| 256 | Ga0307406_10235762 | 3300031901 | Bacteria | 1369 |
| 257 | Ga0307409_100093238 | 3300031995 | Bacteria | 2474 |
| 258 | Ga0307409_100350143 | 3300031995 | Bacteria | 1393 |
| 259 | Ga0307416_100159559 | 3300032002 | Bacteria | 2082 |
| 260 | Ga0307411_10114783 | 3300032005 | Bacteria | 1936 |
| 261 | Ga0307415_100049807 | 3300032126 | Bacteria | 2835 |
| 262 | Ga0307415_100136133 | 3300032126 | Bacteria | 1868 |
| 263 | Ga0307507_10121676 | 3300033179 | Bacteria | 2085 |
| 264 | Ga0307510_10030634 | 3300033180 | Bacteria | 6096 |
| 265 | Ga0307510_10126827 | 3300033180 | Bacteria | 2239 |
| 266 | Ga0373949_0000112 | 3300035090 | Bacteria | 30333 |
| 267 | Ga0373954_0000090 | 3300035118 | Bacteria | 31033 |
| 268 | Ga0373962_0000297 | 3300035242 | Bacteria | 10707 |
| 269 | Ga0373927_0014701 | 3300035695 | Bacteria | 5174 |
| 270 | Ga0373937_0010803 | 3300036401 | Bacteria | 7993 |
| 271 | Ga0395899_0001796 | 3300037312 | Bacteria | 17781 |
| 272 | Ga0395900_0058638 | 3300037418 | Bacteria | 3963 |
| 273 | Ga0395898_0013633 | 3300037466 | Bacteria | 8362 |
| 274 | Ga0395898_0431675 | 3300037466 | Bacteria | 1255 |
| 275 | Ga0395905_0005226 | 3300037471 | Bacteria | 13288 |
| 276 | Ga0395905_0026083 | 3300037471 | Bacteria | 5511 |
| 277 | Ga0395905_0263534 | 3300037471 | Bacteria | 1609 |
| 278 | Ga0395905_0352474 | 3300037471 | Bacteria | 1364 |
| 279 | Ga0436364_1070120 | 3300037853 | Bacteria | 4453 |
| 280 | Ga0395901_0001705 | 3300038443 | Bacteria | 22698 |
| 281 | Ga0395901_0056735 | 3300038443 | Bacteria | 4074 |
| 282 | Ga0395901_0117792 | 3300038443 | Bacteria | 2791 |
| 283 | Ga0395901_0442802 | 3300038443 | Bacteria | 1330 |
| 284 | Ga0436365_0961376 | 3300039437 | Bacteria | 13290 |
| 285 | Ga0436365_1394498 | 3300039437 | Bacteria | 1801 |
| 286 | Ga0436363_1121410 | 3300039450 | Bacteria | 1326 |
| 287 | Ga0439465_0001095 | 3300041413 | Bacteria | 8687 |
| 288 | Ga0439448_0006681 | 3300042005 | Bacteria | 3324 |
| 289 | Ga0439449_0005470 | 3300042007 | Bacteria | 4865 |
| 290 | Ga0439455_0003241 | 3300042012 | Bacteria | 3082 |
| 291 | Ga0450903_007080 | 3300042138 | Bacteria | 1852 |
| 292 | Ga0439446_0023312 | 3300042156 | Bacteria | 1759 |
| 293 | Ga0439434_0002344 | 3300042435 | Bacteria | 5510 |
| 294 | Ga0439435_0008045 | 3300042436 | Bacteria | 2436 |
| 295 | Ga0466969_0007850 | 3300044656 | Bacteria | 5669 |
| 296 | Ga0466969_0019832 | 3300044656 | Bacteria | 3488 |
| 297 | Ga0466969_0032599 | 3300044656 | Bacteria | 2648 |
| 298 | Ga0466969_0048294 | 3300044656 | Bacteria | 2104 |
| 299 | Ga0466972_0005725 | 3300044658 | Bacteria | 6228 |
| 300 | Ga0466972_0030120 | 3300044658 | Bacteria | 2671 |
| 301 | Ga0466972_0086010 | 3300044658 | Bacteria | 1494 |
| 302 | Ga0466966_0004356 | 3300044684 | Bacteria | 9340 |
| 303 | Ga0466966_0004653 | 3300044684 | Bacteria | 9039 |
| 304 | Ga0466966_0009137 | 3300044684 | Bacteria | 6563 |
| 305 | Ga0466961_0004861 | 3300044693 | Bacteria | 8454 |
| 306 | Ga0466961_0005533 | 3300044693 | Bacteria | 7968 |
| 307 | Ga0466961_0006498 | 3300044693 | Bacteria | 7429 |
| 308 | Ga0466961_0039060 | 3300044693 | Bacteria | 3043 |
| 309 | Ga0466963_0000506 | 3300044694 | Bacteria | 18181 |
| 310 | Ga0466964_0009674 | 3300044706 | Bacteria | 3632 |
| 311 | Ga0466964_0038081 | 3300044706 | Bacteria | 1933 |
| 312 | Ga0466971_0004337 | 3300044719 | Bacteria | 6112 |
| 313 | Ga0466971_0016724 | 3300044719 | Bacteria | 3239 |
| 314 | Ga0466971_0146560 | 3300044719 | Bacteria | 1101 |
| 315 | Ga0466970_0003950 | 3300044765 | Bacteria | 7267 |
| 316 | Ga0466970_0049481 | 3300044765 | Bacteria | 2242 |
| 317 | Ga0466957_0000304 | 3300044842 | Bacteria | 24157 |
| 318 | Ga0466960_0019514 | 3300044901 | Bacteria | 2989 |
| 319 | Ga0466959_0000325 | 3300045049 | Bacteria | 28137 |
| 320 | Ga0466959_0004028 | 3300045049 | Bacteria | 9764 |
| 321 | Ga0466959_0006706 | 3300045049 | Bacteria | 8009 |
| 322 | Ga0451576_0026836 | 3300045051 | Bacteria | 6189 |
| 323 | Ga0466958_0002417 | 3300045836 | Bacteria | 9356 |
| 324 | Ga0466967_0005624 | 3300045976 | Bacteria | 8719 |
| 325 | Ga0466967_0018260 | 3300045976 | Bacteria | 5599 |
| 326 | Ga0466967_0085081 | 3300045976 | Bacteria | 2863 |
| 327 | Ga0495592_0009563 | 3300046454 | Bacteria | 7294 |
| 328 | Ga0495592_0022120 | 3300046454 | Bacteria | 4837 |
| 329 | Ga0495603_0000270 | 3300046455 | Bacteria | 27500 |
| 330 | Ga0495603_0009428 | 3300046455 | Bacteria | 5899 |
| 331 | Ga0495603_0035175 | 3300046455 | Bacteria | 3009 |
| 332 | Ga0495603_0038422 | 3300046455 | Bacteria | 2870 |
| 333 | Ga0495629_0002755 | 3300046459 | Bacteria | 13438 |
| 334 | Ga0495629_0036998 | 3300046459 | Bacteria | 3441 |
| 335 | Ga0495651_0000482 | 3300046462 | Bacteria | 30750 |
| 336 | Ga0495651_0004623 | 3300046462 | Bacteria | 10524 |
| 337 | Ga0495651_0025202 | 3300046462 | Bacteria | 4628 |
| 338 | Ga0495653_0057666 | 3300046463 | Bacteria | 2954 |
| 339 | Ga0495580_0017726 | 3300046472 | Bacteria | 5316 |
| 340 | Ga0495580_0048563 | 3300046472 | Bacteria | 3004 |
| 341 | Ga0495605_0038488 | 3300046474 | Bacteria | 2399 |
| 342 | Ga0495662_0006964 | 3300046476 | Bacteria | 5618 |
| 343 | Ga0495664_0075510 | 3300046477 | Bacteria | 2016 |
| 344 | Ga0495594_0004572 | 3300046499 | Bacteria | 7120 |
| 345 | Ga0495596_0095996 | 3300046500 | Bacteria | 1151 |
| 346 | Ga0495606_0028018 | 3300046507 | Bacteria | 3981 |
| 347 | Ga0495608_0001470 | 3300046511 | Bacteria | 16742 |
| 348 | Ga0495618_0095011 | 3300046514 | Bacteria | 1906 |
| 349 | Ga0495628_0010756 | 3300046516 | Bacteria | 7749 |
| 350 | Ga0495628_0015383 | 3300046516 | Bacteria | 6388 |
| 351 | Ga0495630_0025338 | 3300046517 | Bacteria | 4384 |
| 352 | Ga0495666_0023704 | 3300046526 | Bacteria | 3034 |
| 353 | Ga0495652_0000680 | 3300046529 | Bacteria | 39383 |
| 354 | Ga0495652_0021332 | 3300046529 | Bacteria | 5761 |
| 355 | Ga0495640_0098953 | 3300046533 | Bacteria | 1916 |
| 356 | Ga0495587_0026611 | 3300046536 | Bacteria | 3526 |
| 357 | Ga0495645_0000732 | 3300046543 | Bacteria | 22436 |
| 358 | Ga0495645_0028391 | 3300046543 | Bacteria | 4065 |
| 359 | Ga0495622_0060492 | 3300046557 | Bacteria | 1754 |
| 360 | Ga0495667_0008815 | 3300046559 | Bacteria | 6858 |
| 361 | Ga0495667_0103725 | 3300046559 | Bacteria | 1839 |
| 362 | Ga0495668_0002013 | 3300046616 | Bacteria | 17749 |
| 363 | Ga0495634_0197243 | 3300046642 | Bacteria | 1252 |
| 364 | Ga0495625_0004381 | 3300046660 | Bacteria | 13391 |
| 365 | Ga0495625_0005251 | 3300046660 | Bacteria | 11905 |
| 366 | Ga0495635_0005934 | 3300046663 | Bacteria | 8521 |
| 367 | Ga0495657_0008253 | 3300046675 | Bacteria | 7979 |
| 368 | Ga0495657_0022281 | 3300046675 | Bacteria | 4540 |
| 369 | Ga0495657_0079696 | 3300046675 | Bacteria | 2120 |
| 370 | Ga0495657_0182501 | 3300046675 | Bacteria | 1287 |
| 371 | Ga0495599_0033315 | 3300046678 | Bacteria | 3237 |
| 372 | Ga0495599_0104246 | 3300046678 | Bacteria | 1766 |
| 373 | Ga0495623_0005832 | 3300046679 | Bacteria | 8033 |
| 374 | Ga0495623_0048645 | 3300046679 | Bacteria | 2688 |
| 375 | Ga0495646_0038855 | 3300046680 | Bacteria | 2936 |
| 376 | Ga0495647_0059804 | 3300046681 | Bacteria | 1501 |
| 377 | Ga0495613_0002772 | 3300046689 | Bacteria | 13156 |
| 378 | Ga0495613_0003415 | 3300046689 | Bacteria | 11870 |
| 379 | Ga0495649_0016265 | 3300046694 | Bacteria | 4218 |
| 380 | Ga0495600_0010460 | 3300046809 | Bacteria | 5760 |
| 381 | Ga0495600_0027889 | 3300046809 | Bacteria | 3651 |
| 382 | Ga0495660_0118653 | 3300046810 | Bacteria | 1341 |
| 383 | Ga0495581_0088215 | 3300047315 | Bacteria | 1799 |
| 384 | Ga0495604_0004205 | 3300047317 | Bacteria | 11400 |
| 385 | Ga0495604_0014856 | 3300047317 | Bacteria | 6209 |
| 386 | Ga0495604_0186322 | 3300047317 | Bacteria | 1449 |
| 387 | Ga0495674_0017927 | 3300047319 | Bacteria | 6592 |
| 388 | Ga0495676_0005415 | 3300047321 | Bacteria | 11704 |
| 389 | Ga0495676_0008990 | 3300047321 | Bacteria | 9118 |
| 390 | Ga0495676_0042562 | 3300047321 | Bacteria | 3726 |
| 391 | Ga0495675_0015811 | 3300047444 | Bacteria | 4773 |
| 392 | Ga0495685_002371 | 3300047447 | Bacteria | 5899 |
| 393 | Ga0495614_0000393 | 3300048089 | Bacteria | 17752 |
| 394 | Ga0495614_0071451 | 3300048089 | Bacteria | 1496 |
| 395 | Ga0495626_0000387 | 3300048091 | Bacteria | 45484 |
| 396 | Ga0496102_0017786 | 3300048905 | Bacteria | 6233 |
| 397 | Ga0496104_0000084 | 3300048907 | Bacteria | 90868 |
| 398 | Ga0496104_0000304 | 3300048907 | Bacteria | 43780 |
| 399 | Ga0496104_0022511 | 3300048907 | Bacteria | 5788 |
| 400 | Ga0496105_0005361 | 3300048908 | Bacteria | 9722 |
| 401 | Ga0496108_0003436 | 3300048911 | Bacteria | 12700 |
| 402 | Ga0496108_0123897 | 3300048911 | Bacteria | 2218 |
| 403 | Ga0496109_0013906 | 3300048912 | Bacteria | 6997 |
| 404 | Ga0496110_0013175 | 3300048913 | Bacteria | 6827 |
| 405 | Ga0496110_0182674 | 3300048913 | Bacteria | 1905 |
| 406 | Ga0496111_0001068 | 3300048914 | Bacteria | 15097 |
| 407 | Ga0496111_0218849 | 3300048914 | Bacteria | 1415 |
| 408 | Ga0496112_0034267 | 3300048915 | Bacteria | 4940 |
| 409 | Ga0496112_0043039 | 3300048915 | Bacteria | 4420 |
| 410 | Ga0496112_0160250 | 3300048915 | Bacteria | 2216 |
| 411 | Ga0496113_0048604 | 3300048916 | Bacteria | 3157 |
| 412 | Ga0496114_0007675 | 3300048917 | Bacteria | 8530 |
| 413 | Ga0496115_0017906 | 3300048918 | Bacteria | 5427 |
| 414 | Ga0496115_0093866 | 3300048918 | Bacteria | 2454 |
| 415 | Ga0496115_0183703 | 3300048918 | Bacteria | 1728 |
| 416 | Ga0496117_0017949 | 3300048920 | Bacteria | 5890 |
| 417 | Ga0496119_0012723 | 3300048922 | Bacteria | 6800 |
| 418 | Ga0496120_0044349 | 3300048923 | Bacteria | 2584 |
| 419 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 420 | Ga0496121_0073066 | 3300048924 | Bacteria | 2750 |
| 421 | Ga0496122_0016734 | 3300048925 | Bacteria | 6911 |
| 422 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 423 | Ga0496124_0097604 | 3300048927 | Bacteria | 2385 |
| 424 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 425 | Ga0496126_0000085 | 3300048929 | Bacteria | 216528 |
| 426 | Ga0501031_0010569 | 3300049568 | Bacteria | 6009 |
| 427 | Ga0501031_0035337 | 3300049568 | Bacteria | 3260 |
| 428 | Ga0501031_0045891 | 3300049568 | Bacteria | 2851 |
| 429 | Ga0501032_0035741 | 3300049569 | Bacteria | 3395 |
| 430 | Ga0501033_0249471 | 3300049570 | Bacteria | 1258 |
| 431 | Ga0501034_0000386 | 3300049571 | Bacteria | 75350 |
| 432 | Ga0501034_0030816 | 3300049571 | Bacteria | 5451 |
| 433 | Ga0501034_0114120 | 3300049571 | Bacteria | 2690 |
| 434 | Ga0501036_0038287 | 3300049572 | Bacteria | 4058 |
| 435 | Ga0501036_0048374 | 3300049572 | Bacteria | 3600 |
| 436 | Ga0501036_0141364 | 3300049572 | Bacteria | 2031 |
| 437 | Ga0501037_0003818 | 3300049573 | Bacteria | 10929 |
| 438 | Ga0501037_0013558 | 3300049573 | Bacteria | 6002 |
| 439 | Ga0501037_0048521 | 3300049573 | Bacteria | 3111 |
| 440 | Ga0501038_0000421 | 3300049574 | Bacteria | 36883 |
| 441 | Ga0501038_0101198 | 3300049574 | Bacteria | 2399 |
| 442 | Ga0501038_0163350 | 3300049574 | Bacteria | 1808 |
| 443 | Ga0501038_0339582 | 3300049574 | Bacteria | 1171 |
| 444 | Ga0501039_0161548 | 3300049575 | Bacteria | 1761 |
| 445 | Ga0501039_0170397 | 3300049575 | Bacteria | 1712 |
| 446 | Ga0501039_0201750 | 3300049575 | Bacteria | 1564 |
| 447 | Ga0501042_0019379 | 3300049578 | Bacteria | 4723 |
| 448 | Ga0501043_0005286 | 3300049579 | Bacteria | 10439 |
| 449 | Ga0501043_0066207 | 3300049579 | Bacteria | 2837 |
| 450 | Ga0501043_0066217 | 3300049579 | Bacteria | 2837 |
| 451 | Ga0501043_0211314 | 3300049579 | Bacteria | 1504 |
| 452 | Ga0501046_0009034 | 3300049580 | Bacteria | 8640 |
| 453 | Ga0501047_0001674 | 3300049581 | Bacteria | 21567 |
| 454 | Ga0501047_0038183 | 3300049581 | Bacteria | 4645 |
| 455 | Ga0501047_0064604 | 3300049581 | Bacteria | 3530 |
| 456 | Ga0501048_0082447 | 3300049582 | Bacteria | 2268 |
| 457 | Ga0501069_0009534 | 3300049585 | Bacteria | 5124 |
| 458 | Ga0501070_0000487 | 3300049586 | Bacteria | 36109 |
| 459 | Ga0501071_0007783 | 3300049587 | Bacteria | 7066 |
| 460 | Ga0501071_0108510 | 3300049587 | Bacteria | 2050 |
| 461 | Ga0501072_0068675 | 3300049588 | Bacteria | 2797 |
| 462 | Ga0501073_0049226 | 3300049589 | Bacteria | 2956 |
| 463 | Ga0501075_0193215 | 3300049591 | Bacteria | 1552 |
| 464 | Ga0501076_0024157 | 3300049592 | Bacteria | 4694 |
| 465 | Ga0501076_0112224 | 3300049592 | Bacteria | 2204 |
| 466 | Ga0501243_000820 | 3300049675 | Bacteria | 4319 |
| 467 | Ga0501079_0030094 | 3300049741 | Bacteria | 4172 |
| 468 | Ga0501080_0004877 | 3300049742 | Bacteria | 11954 |
| 469 | Ga0501081_0207026 | 3300049743 | Bacteria | 1424 |
| 470 | Ga0501035_0003514 | 3300049822 | Bacteria | 14982 |
| 471 | Ga0501035_0008042 | 3300049822 | Bacteria | 9829 |
| 472 | Ga0501035_0056722 | 3300049822 | Bacteria | 3494 |
| 473 | Ga0501035_0091231 | 3300049822 | Bacteria | 2681 |
| 474 | Ga0501044_0009499 | 3300049823 | Bacteria | 10591 |
| 475 | Ga0501044_0013416 | 3300049823 | Bacteria | 8860 |
| 476 | Ga0501044_0019873 | 3300049823 | Bacteria | 7174 |
| 477 | Ga0501044_0236618 | 3300049823 | Bacteria | 1771 |
| 478 | nmdc:mga05p37_334797_c1 | 3300050507 | Bacteria | 1787 |
| 479 | nmdc:mga09592_62245_c1 | 3300050508 | Bacteria | 3157 |
| 480 | nmdc:mga0qj67_66485_c1 | 3300050509 | Bacteria | 2871 |
| 481 | nmdc:mga06r32_16702_c1 | 3300050510 | Bacteria | 6690 |
| 482 | nmdc:mga08y16_110010_c1 | 3300050511 | Bacteria | 2869 |
| 483 | nmdc:mga08y16_182422_c1 | 3300050511 | Bacteria | 2179 |
| 484 | nmdc:mga0n895_199556_c1 | 3300050512 | Bacteria | 2032 |
| 485 | nmdc:mga0n895_285914_c1 | 3300050512 | Bacteria | 1672 |
| 486 | nmdc:mga0a205_224571_c1 | 3300050515 | Bacteria | 1763 |
| 487 | Ga0495601_0006969 | 3300053077 | Bacteria | 6618 |
| 488 | Ga0495601_0152440 | 3300053077 | Bacteria | 1509 |
| 489 | Ga0495612_0007964 | 3300053078 | Bacteria | 4319 |
| 490 | Ga0495612_0062948 | 3300053078 | Bacteria | 1538 |
| 491 | Ga0495619_0012030 | 3300053085 | Bacteria | 5452 |
| 492 | Ga0495619_0212025 | 3300053085 | Bacteria | 1341 |
| 493 | Ga0500560_000204 | 3300053107 | Bacteria | 7053 |
| 494 | Ga0500572_001954 | 3300053111 | Bacteria | 5169 |
| 495 | Ga0500618_001007 | 3300053125 | Bacteria | 14209 |
| 496 | Ga0500642_0078349 | 3300053130 | Bacteria | 1514 |
| 497 | Ga0500568_0005827 | 3300053139 | Bacteria | 6283 |
| 498 | Ga0500573_0022513 | 3300053140 | Bacteria | 3616 |
| 499 | Ga0500573_0147218 | 3300053140 | Bacteria | 1292 |
| 500 | Ga0500577_0008410 | 3300053142 | Bacteria | 2942 |
| 501 | Ga0500590_001916 | 3300053148 | Bacteria | 8896 |
| 502 | Ga0500616_0007928 | 3300053153 | Bacteria | 6672 |
| 503 | Ga0500634_0003279 | 3300053161 | Bacteria | 7149 |
| 504 | Ga0500636_0000011 | 3300053177 | Bacteria | 140769 |
| 505 | Ga0500636_0000283 | 3300053177 | Bacteria | 28087 |
| 506 | Ga0500637_0100249 | 3300053178 | Bacteria | 1680 |
| 507 | Ga0501084_0037736 | 3300054114 | Bacteria | 4038 |
| 508 | Ga0501084_0043877 | 3300054114 | Bacteria | 3741 |
| 509 | Ga0501082_0028825 | 3300060353 | Bacteria | 4783 |
| 510 | Ga0466962_0000167 | 3300061719 | Bacteria | 28033 |
| 511 | Ga0530510_0009799 | 3300061734 | Bacteria | 6723 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10047944 | Ga0081455_100479443 | 309 |
| 2 | 3300044719 | Ga0466971_0146560 | Ga0466971_0146560_18_1028 | 333 |
| 3 | 3300037466 | Ga0395898_0431675 | Ga0395898_0431675_174_1238 | 338 |
| 4 | 3300049579 | Ga0501043_0066207 | Ga0501043_0066207_36_1079 | 338 |
| 5 | 3300009551 | Ga0105238_10015806 | Ga0105238_100158064 | 339 |
| 6 | 3300026121 | Ga0207683_10450279 | Ga0207683_104502791 | 346 |
| 7 | 3300046500 | Ga0495596_0095996 | Ga0495596_0095996_70_1140 | 346 |
| 8 | 3300047317 | Ga0495604_0186322 | Ga0495604_0186322_21_1097 | 346 |
| 9 | 3300035118 | Ga0373954_0000090 | Ga0373954_0000090_25835_26977 | 351 |
| 10 | 3300049568 | Ga0501031_0035337 | Ga0501031_0035337_1557_2633 | 358 |
| 11 | 3300049568 | Ga0501031_0045891 | Ga0501031_0045891_1517_2593 | 358 |
| 12 | 3300049570 | Ga0501033_0249471 | Ga0501033_0249471_52_1128 | 358 |
| 13 | 3300049572 | Ga0501036_0141364 | Ga0501036_0141364_352_1428 | 358 |
| 14 | 3300049574 | Ga0501038_0339582 | Ga0501038_0339582_54_1130 | 358 |
| 15 | 3300049575 | Ga0501039_0161548 | Ga0501039_0161548_316_1392 | 358 |
| 16 | 3300049575 | Ga0501039_0201750 | Ga0501039_0201750_285_1361 | 358 |
| 17 | 3300049578 | Ga0501042_0019379 | Ga0501042_0019379_2589_3665 | 358 |
| 18 | 3300049587 | Ga0501071_0007783 | Ga0501071_0007783_3202_4278 | 358 |
| 19 | 3300049587 | Ga0501071_0108510 | Ga0501071_0108510_511_1587 | 358 |
| 20 | 3300049588 | Ga0501072_0068675 | Ga0501072_0068675_463_1539 | 358 |
| 21 | 3300049591 | Ga0501075_0193215 | Ga0501075_0193215_297_1373 | 358 |
| 22 | 3300049592 | Ga0501076_0024157 | Ga0501076_0024157_2426_3502 | 358 |
| 23 | 3300049741 | Ga0501079_0030094 | Ga0501079_0030094_2524_3600 | 358 |
| 24 | 3300049743 | Ga0501081_0207026 | Ga0501081_0207026_177_1253 | 358 |
| 25 | 3300054114 | Ga0501084_0037736 | Ga0501084_0037736_2798_3874 | 358 |
| 26 | 3300054114 | Ga0501084_0043877 | Ga0501084_0043877_878_1954 | 358 |
| 27 | 3300060353 | Ga0501082_0028825 | Ga0501082_0028825_2170_3246 | 358 |
| 28 | 3300061734 | Ga0530510_0009799 | Ga0530510_0009799_3818_4894 | 358 |
| 29 | 3300046455 | Ga0495603_0009428 | Ga0495603_0009428_3402_4553 | 361 |
| 30 | 3300006844 | Ga0075428_100032142 | Ga0075428_1000321423 | 363 |
| 31 | 3300025923 | Ga0207681_10042369 | Ga0207681_100423691 | 363 |
| 32 | 3300005341 | Ga0070691_10006836 | Ga0070691_100068362 | 364 |
| 33 | 3300005530 | Ga0070679_100021162 | Ga0070679_1000211624 | 364 |
| 34 | 3300025921 | Ga0207652_10095879 | Ga0207652_100958791 | 364 |
| 35 | 3300025909 | Ga0207705_10009902 | Ga0207705_100099026 | 366 |
| 36 | 3300046642 | Ga0495634_0197243 | Ga0495634_0197243_134_1237 | 366 |
| 37 | 3300049675 | Ga0501243_000820 | Ga0501243_000820_684_1832 | 366 |
| 38 | 3300044656 | Ga0466969_0048294 | Ga0466969_0048294_559_1662 | 367 |
| 39 | 3300044684 | Ga0466966_0004653 | Ga0466966_0004653_4808_5911 | 367 |
| 40 | 3300045049 | Ga0466959_0006706 | Ga0466959_0006706_4884_5987 | 367 |
| 41 | 3300053130 | Ga0500642_0078349 | Ga0500642_0078349_377_1498 | 367 |
| 42 | 3300005367 | Ga0070667_100316451 | Ga0070667_1003164511 | 368 |
| 43 | 3300006844 | Ga0075428_100256468 | Ga0075428_1002564682 | 368 |
| 44 | 3300006871 | Ga0075434_100095835 | Ga0075434_1000958352 | 368 |
| 45 | 3300006881 | Ga0068865_100263345 | Ga0068865_1002633452 | 368 |
| 46 | 3300005333 | Ga0070677_10045907 | Ga0070677_100459071 | 371 |
| 47 | 3300026075 | Ga0207708_10212000 | Ga0207708_102120002 | 371 |
| 48 | 3300046474 | Ga0495605_0038488 | Ga0495605_0038488_54_1211 | 371 |
| 49 | 3300050515 | nmdc:mga0a205_224571_c1 | nmdc:mga0a205_224571_c1_434_1600 | 372 |
| 50 | 3300035242 | Ga0373962_0000297 | Ga0373962_0000297_3651_4817 | 373 |
| 51 | 3300046455 | Ga0495603_0038422 | Ga0495603_0038422_395_1552 | 373 |
| 52 | 3300047321 | Ga0495676_0042562 | Ga0495676_0042562_2556_3713 | 373 |
| 53 | 3300047447 | Ga0495685_002371 | Ga0495685_002371_4214_5371 | 373 |
| 54 | 3300005339 | Ga0070660_100061557 | Ga0070660_1000615571 | 374 |
| 55 | 3300005347 | Ga0070668_100021164 | Ga0070668_1000211645 | 374 |
| 56 | 3300005434 | Ga0070709_10092569 | Ga0070709_100925692 | 374 |
| 57 | 3300005458 | Ga0070681_10106805 | Ga0070681_101068052 | 374 |
| 58 | 3300005459 | Ga0068867_100067035 | Ga0068867_1000670352 | 374 |
| 59 | 3300005834 | Ga0068851_10019024 | Ga0068851_100190242 | 374 |
| 60 | 3300010375 | Ga0105239_10338411 | Ga0105239_103384112 | 374 |
| 61 | 3300025321 | Ga0207656_10050037 | Ga0207656_100500371 | 374 |
| 62 | 3300025909 | Ga0207705_10009948 | Ga0207705_100099484 | 374 |
| 63 | 3300025909 | Ga0207705_10129915 | Ga0207705_101299152 | 374 |
| 64 | 3300025912 | Ga0207707_10187349 | Ga0207707_101873492 | 374 |
| 65 | 3300025927 | Ga0207687_10032836 | Ga0207687_100328362 | 374 |
| 66 | 3300031249 | Ga0265339_10032022 | Ga0265339_100320222 | 374 |
| 67 | 3300031730 | Ga0307516_10013517 | Ga0307516_100135174 | 374 |
| 68 | 3300037466 | Ga0395898_0013633 | Ga0395898_0013633_6867_7991 | 374 |
| 69 | 3300038443 | Ga0395901_0056735 | Ga0395901_0056735_1119_2243 | 374 |
| 70 | 3300044656 | Ga0466969_0007850 | Ga0466969_0007850_3741_4865 | 374 |
| 71 | 3300044656 | Ga0466969_0032599 | Ga0466969_0032599_596_1720 | 374 |
| 72 | 3300048913 | Ga0496110_0182674 | Ga0496110_0182674_716_1840 | 374 |
| 73 | 3300048915 | Ga0496112_0160250 | Ga0496112_0160250_248_1396 | 374 |
| 74 | 3300053078 | Ga0495612_0062948 | Ga0495612_0062948_12_1151 | 374 |
| 75 | 3300031456 | Ga0307513_10034866 | Ga0307513_100348664 | 375 |
| 76 | 3300039450 | Ga0436363_1121410 | Ga0436363_1121410_19_1149 | 375 |
| 77 | 3300005471 | Ga0070698_100145958 | Ga0070698_1001459582 | 376 |
| 78 | 3300042005 | Ga0439448_0006681 | Ga0439448_0006681_934_2064 | 376 |
| 79 | 3300042012 | Ga0439455_0003241 | Ga0439455_0003241_490_1620 | 376 |
| 80 | 3300046810 | Ga0495660_0118653 | Ga0495660_0118653_29_1162 | 376 |
| 81 | iso_pu_bacteria | 2929138655 | 2929142962 | 376 |
| 82 | iso_pu_bacteria | 8003314358 | 8003316221 | 376 |
| 83 | iso_pu_bacteria | 8054460903 | 8054464678 | 376 |
| 84 | iso_pu_bacteria | 2675903060 | 2676490778 | 377 |
| 85 | iso_pu_bacteria | 2887478801 | 2887480714 | 377 |
| 86 | iso_pu_bacteria | 2894817345 | 2894818907 | 377 |
| 87 | iso_pu_bacteria | 8001781756 | 8001786170 | 377 |
| 88 | iso_pu_bacteria | 2558860112 | 2558912229 | 378 |
| 89 | 3300007076 | Ga0075435_100073666 | Ga0075435_1000736662 | 379 |
| 90 | 3300009094 | Ga0111539_10023670 | Ga0111539_100236706 | 379 |
| 91 | iso_pu_bacteria | 2554235005 | 2554258475 | 379 |
| 92 | iso_pu_bacteria | 2558860112 | 2558908979 | 379 |
| 93 | iso_pu_bacteria | 2643221587 | 2643942925 | 379 |
| 94 | iso_pu_bacteria | 2643221587 | 2643944552 | 379 |
| 95 | iso_pu_bacteria | 2643221601 | 2644013945 | 379 |
| 96 | iso_pu_bacteria | 2643221601 | 2644017768 | 379 |
| 97 | iso_pu_bacteria | 2643221631 | 2644174494 | 379 |
| 98 | iso_pu_bacteria | 2643221631 | 2644178916 | 379 |
| 99 | iso_pu_bacteria | 2643221670 | 2644385518 | 379 |
| 100 | iso_pu_bacteria | 2643221677 | 2644430384 | 379 |
| 101 | iso_pu_bacteria | 2643221677 | 2644431450 | 379 |
| 102 | iso_pu_bacteria | 2643221678 | 2644436542 | 379 |
| 103 | iso_pu_bacteria | 2751185782 | 2753263753 | 379 |
| 104 | iso_pu_bacteria | 2784132148 | 2784587999 | 379 |
| 105 | iso_pu_bacteria | 2808606359 | 2808841434 | 379 |
| 106 | iso_pu_bacteria | 2808606982 | 2811848387 | 379 |
| 107 | iso_pu_bacteria | 2811994917 | 2812481104 | 379 |
| 108 | iso_pu_bacteria | 2818991472 | 2819745872 | 379 |
| 109 | iso_pu_bacteria | 2862290372 | 2862296623 | 379 |
| 110 | iso_pu_bacteria | 2862507626 | 2862512971 | 379 |
| 111 | iso_pu_bacteria | 2873151551 | 2873156450 | 379 |
| 112 | iso_pu_bacteria | 2884215851 | 2884217127 | 379 |
| 113 | iso_pu_bacteria | 2888578766 | 2888583815 | 379 |
| 114 | iso_pu_bacteria | 2889049205 | 2889055590 | 379 |
| 115 | iso_pu_bacteria | 2912715099 | 2912720729 | 379 |
| 116 | iso_pu_bacteria | 2918501144 | 2918503952 | 379 |
| 117 | iso_pu_bacteria | 2919468124 | 2919473557 | 379 |
| 118 | iso_pu_bacteria | 2990088156 | 2990093085 | 379 |
| 119 | iso_pu_bacteria | 3006493962 | 3006501500 | 379 |
| 120 | iso_pu_bacteria | 8023623736 | 8023631011 | 379 |
| 121 | iso_pu_bacteria | 8048406513 | 8048413367 | 379 |
| 122 | iso_pu_bacteria | 8056533031 | 8056538240 | 379 |
| 123 | iso_pu_bacteria | 8056667051 | 8056672416 | 379 |
| 124 | iso_pu_bacteria | 8056829672 | 8056830199 | 379 |
| 125 | 3300026067 | Ga0207678_10000523 | Ga0207678_1000052324 | 380 |
| 126 | 3300033180 | Ga0307510_10126827 | Ga0307510_101268272 | 380 |
| 127 | 3300044658 | Ga0466972_0005725 | Ga0466972_0005725_3775_4917 | 380 |
| 128 | 3300044765 | Ga0466970_0049481 | Ga0466970_0049481_564_1706 | 380 |
| 129 | 3300046459 | Ga0495629_0036998 | Ga0495629_0036998_1345_2490 | 380 |
| 130 | 3300046557 | Ga0495622_0060492 | Ga0495622_0060492_154_1299 | 380 |
| 131 | 3300046675 | Ga0495657_0079696 | Ga0495657_0079696_913_2058 | 380 |
| 132 | 3300048920 | Ga0496117_0017949 | Ga0496117_0017949_2393_3550 | 380 |
| 133 | 3300048922 | Ga0496119_0012723 | Ga0496119_0012723_1449_2606 | 380 |
| 134 | 3300048923 | Ga0496120_0044349 | Ga0496120_0044349_857_2014 | 380 |
| 135 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_913866_915023 | 380 |
| 136 | 3300048924 | Ga0496121_0073066 | Ga0496121_0073066_1239_2396 | 380 |
| 137 | 3300048925 | Ga0496122_0016734 | Ga0496122_0016734_1909_3051 | 380 |
| 138 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_110433_111575 | 380 |
| 139 | 3300048927 | Ga0496124_0097604 | Ga0496124_0097604_1202_2359 | 380 |
| 140 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_37963_39120 | 380 |
| 141 | 3300050511 | nmdc:mga08y16_182422_c1 | nmdc:mga08y16_182422_c1_730_1890 | 380 |
| 142 | 3300053077 | Ga0495601_0152440 | Ga0495601_0152440_92_1237 | 380 |
| 143 | 3300053111 | Ga0500572_001954 | Ga0500572_001954_3751_4893 | 380 |
| 144 | 3300053125 | Ga0500618_001007 | Ga0500618_001007_3831_4973 | 380 |
| 145 | 3300053140 | Ga0500573_0022513 | Ga0500573_0022513_801_1946 | 380 |
| 146 | 3300053148 | Ga0500590_001916 | Ga0500590_001916_3685_4830 | 380 |
| 147 | 3300053161 | Ga0500634_0003279 | Ga0500634_0003279_5274_6416 | 380 |
| 148 | 3300053177 | Ga0500636_0000011 | Ga0500636_0000011_132991_134133 | 380 |
| 149 | 3300053177 | Ga0500636_0000283 | Ga0500636_0000283_25470_26612 | 380 |
| 150 | 3300005543 | Ga0070672_100138598 | Ga0070672_1001385981 | 381 |
| 151 | 3300005548 | Ga0070665_100000204 | Ga0070665_10000020440 | 381 |
| 152 | 3300005937 | Ga0081455_10008019 | Ga0081455_100080193 | 381 |
| 153 | 3300006353 | Ga0075370_10066998 | Ga0075370_100669982 | 381 |
| 154 | 3300006844 | Ga0075428_100212173 | Ga0075428_1002121732 | 381 |
| 155 | 3300006846 | Ga0075430_100013280 | Ga0075430_1000132808 | 381 |
| 156 | 3300006847 | Ga0075431_100015347 | Ga0075431_1000153474 | 381 |
| 157 | 3300006847 | Ga0075431_100114206 | Ga0075431_1001142062 | 381 |
| 158 | 3300006880 | Ga0075429_100003160 | Ga0075429_10000316015 | 381 |
| 159 | 3300009098 | Ga0105245_10270456 | Ga0105245_102704561 | 381 |
| 160 | 3300009147 | Ga0114129_10001926 | Ga0114129_1000192614 | 381 |
| 161 | 3300009147 | Ga0114129_10029362 | Ga0114129_100293629 | 381 |
| 162 | 3300013307 | Ga0157372_10405462 | Ga0157372_104054622 | 381 |
| 163 | 3300025918 | Ga0207662_10145707 | Ga0207662_101457072 | 381 |
| 164 | 3300028379 | Ga0268266_10000475 | Ga0268266_1000047525 | 381 |
| 165 | 3300031251 | Ga0265327_10007543 | Ga0265327_100075432 | 381 |
| 166 | 3300037312 | Ga0395899_0001796 | Ga0395899_0001796_6499_7692 | 381 |
| 167 | 3300037418 | Ga0395900_0058638 | Ga0395900_0058638_2183_3376 | 381 |
| 168 | 3300037471 | Ga0395905_0005226 | Ga0395905_0005226_5583_6749 | 381 |
| 169 | 3300037471 | Ga0395905_0026083 | Ga0395905_0026083_2265_3458 | 381 |
| 170 | 3300037471 | Ga0395905_0263534 | Ga0395905_0263534_323_1492 | 381 |
| 171 | 3300037471 | Ga0395905_0352474 | Ga0395905_0352474_21_1190 | 381 |
| 172 | 3300038443 | Ga0395901_0001705 | Ga0395901_0001705_20243_21436 | 381 |
| 173 | 3300044706 | Ga0466964_0038081 | Ga0466964_0038081_208_1365 | 381 |
| 174 | 3300045976 | Ga0466967_0005624 | Ga0466967_0005624_6543_7700 | 381 |
| 175 | 3300046507 | Ga0495606_0028018 | Ga0495606_0028018_2590_3735 | 381 |
| 176 | 3300046616 | Ga0495668_0002013 | Ga0495668_0002013_2603_3748 | 381 |
| 177 | 3300046660 | Ga0495625_0004381 | Ga0495625_0004381_2548_3693 | 381 |
| 178 | 3300046681 | Ga0495647_0059804 | Ga0495647_0059804_12_1157 | 381 |
| 179 | 3300048091 | Ga0495626_0000387 | Ga0495626_0000387_41822_42967 | 381 |
| 180 | 3300048915 | Ga0496112_0034267 | Ga0496112_0034267_661_1818 | 381 |
| 181 | 3300049742 | Ga0501080_0004877 | Ga0501080_0004877_9878_11032 | 381 |
| 182 | 3300053139 | Ga0500568_0005827 | Ga0500568_0005827_1723_2877 | 381 |
| 183 | 3300053153 | Ga0500616_0007928 | Ga0500616_0007928_1915_3069 | 381 |
| 184 | iso_pu_bacteria | 2643221714 | 2644625612 | 381 |
| 185 | iso_pu_bacteria | 2786546132 | 2786669867 | 381 |
| 186 | iso_pu_bacteria | 2862574272 | 2862579848 | 381 |
| 187 | iso_pu_bacteria | 2867369537 | 2867371293 | 381 |
| 188 | iso_pu_bacteria | 2867428634 | 2867435966 | 381 |
| 189 | iso_pu_bacteria | 2946072368 | 2946075363 | 381 |
| 190 | iso_pu_bacteria | 2954673503 | 2954676296 | 381 |
| 191 | iso_pu_bacteria | 2954682443 | 2954687873 | 381 |
| 192 | iso_pu_bacteria | 2954711539 | 2954716848 | 381 |
| 193 | iso_pu_bacteria | 2954721474 | 2954726796 | 381 |
| 194 | iso_pu_bacteria | 2954731030 | 2954734999 | 381 |
| 195 | iso_pu_bacteria | 2954740390 | 2954745719 | 381 |
| 196 | iso_pu_bacteria | 2954749733 | 2954753871 | 381 |
| 197 | iso_pu_bacteria | 2954759201 | 2954764693 | 381 |
| 198 | iso_pu_bacteria | 3002998708 | 3002999970 | 381 |
| 199 | 3300005327 | Ga0070658_10120292 | Ga0070658_101202922 | 382 |
| 200 | 3300005328 | Ga0070676_10001373 | Ga0070676_100013733 | 382 |
| 201 | 3300005328 | Ga0070676_10002091 | Ga0070676_100020916 | 382 |
| 202 | 3300005328 | Ga0070676_10033478 | Ga0070676_100334782 | 382 |
| 203 | 3300005329 | Ga0070683_100039836 | Ga0070683_1000398363 | 382 |
| 204 | 3300005329 | Ga0070683_100055663 | Ga0070683_1000556632 | 382 |
| 205 | 3300005331 | Ga0070670_100002131 | Ga0070670_1000021316 | 382 |
| 206 | 3300005331 | Ga0070670_100172402 | Ga0070670_1001724022 | 382 |
| 207 | 3300005335 | Ga0070666_10004120 | Ga0070666_100041202 | 382 |
| 208 | 3300005338 | Ga0068868_100012473 | Ga0068868_1000124733 | 382 |
| 209 | 3300005339 | Ga0070660_100025774 | Ga0070660_1000257744 | 382 |
| 210 | 3300005344 | Ga0070661_100146358 | Ga0070661_1001463582 | 382 |
| 211 | 3300005347 | Ga0070668_100004745 | Ga0070668_1000047455 | 382 |
| 212 | 3300005354 | Ga0070675_100003182 | Ga0070675_1000031829 | 382 |
| 213 | 3300005355 | Ga0070671_100003465 | Ga0070671_1000034657 | 382 |
| 214 | 3300005356 | Ga0070674_100008362 | Ga0070674_1000083622 | 382 |
| 215 | 3300005364 | Ga0070673_100003135 | Ga0070673_1000031354 | 382 |
| 216 | 3300005434 | Ga0070709_10007846 | Ga0070709_100078464 | 382 |
| 217 | 3300005435 | Ga0070714_100048184 | Ga0070714_1000481842 | 382 |
| 218 | 3300005437 | Ga0070710_10006157 | Ga0070710_100061577 | 382 |
| 219 | 3300005439 | Ga0070711_100023906 | Ga0070711_1000239062 | 382 |
| 220 | 3300005441 | Ga0070700_100037877 | Ga0070700_1000378771 | 382 |
| 221 | 3300005455 | Ga0070663_100010425 | Ga0070663_1000104253 | 382 |
| 222 | 3300005455 | Ga0070663_100022037 | Ga0070663_1000220375 | 382 |
| 223 | 3300005459 | Ga0068867_100003568 | Ga0068867_1000035689 | 382 |
| 224 | 3300005518 | Ga0070699_100008755 | Ga0070699_1000087556 | 382 |
| 225 | 3300005530 | Ga0070679_100009371 | Ga0070679_1000093717 | 382 |
| 226 | 3300005535 | Ga0070684_100214798 | Ga0070684_1002147982 | 382 |
| 227 | 3300005543 | Ga0070672_100015179 | Ga0070672_1000151793 | 382 |
| 228 | 3300005548 | Ga0070665_100004380 | Ga0070665_10000438010 | 382 |
| 229 | 3300005577 | Ga0068857_100009005 | Ga0068857_1000090055 | 382 |
| 230 | 3300005616 | Ga0068852_100003935 | Ga0068852_1000039355 | 382 |
| 231 | 3300005719 | Ga0068861_100002273 | Ga0068861_1000022734 | 382 |
| 232 | 3300005834 | Ga0068851_10000749 | Ga0068851_100007495 | 382 |
| 233 | 3300005841 | Ga0068863_100012995 | Ga0068863_1000129958 | 382 |
| 234 | 3300005843 | Ga0068860_100021822 | Ga0068860_1000218225 | 382 |
| 235 | 3300005985 | Ga0081539_10001070 | Ga0081539_1000107034 | 382 |
| 236 | 3300009093 | Ga0105240_10001673 | Ga0105240_1000167337 | 382 |
| 237 | 3300009093 | Ga0105240_10063734 | Ga0105240_100637342 | 382 |
| 238 | 3300009093 | Ga0105240_10125892 | Ga0105240_101258924 | 382 |
| 239 | 3300009174 | Ga0105241_10049319 | Ga0105241_100493192 | 382 |
| 240 | 3300009545 | Ga0105237_10114640 | Ga0105237_101146402 | 382 |
| 241 | 3300009551 | Ga0105238_10048034 | Ga0105238_100480344 | 382 |
| 242 | 3300009553 | Ga0105249_10061024 | Ga0105249_100610244 | 382 |
| 243 | 3300013104 | Ga0157370_10095233 | Ga0157370_100952332 | 382 |
| 244 | 3300013104 | Ga0157370_10289729 | Ga0157370_102897292 | 382 |
| 245 | 3300013307 | Ga0157372_10120473 | Ga0157372_101204732 | 382 |
| 246 | 3300013308 | Ga0157375_10003512 | Ga0157375_100035126 | 382 |
| 247 | 3300014325 | Ga0163163_10101808 | Ga0163163_101018082 | 382 |
| 248 | 3300014325 | Ga0163163_10200074 | Ga0163163_102000742 | 382 |
| 249 | 3300017792 | Ga0163161_10128810 | Ga0163161_101288102 | 382 |
| 250 | 3300025893 | Ga0207682_10001577 | Ga0207682_100015772 | 382 |
| 251 | 3300025898 | Ga0207692_10035126 | Ga0207692_100351261 | 382 |
| 252 | 3300025906 | Ga0207699_10047663 | Ga0207699_100476632 | 382 |
| 253 | 3300025909 | Ga0207705_10001995 | Ga0207705_100019955 | 382 |
| 254 | 3300025913 | Ga0207695_10393437 | Ga0207695_103934371 | 382 |
| 255 | 3300025914 | Ga0207671_10108826 | Ga0207671_101088262 | 382 |
| 256 | 3300025919 | Ga0207657_10035164 | Ga0207657_100351644 | 382 |
| 257 | 3300025920 | Ga0207649_10096825 | Ga0207649_100968252 | 382 |
| 258 | 3300025921 | Ga0207652_10004503 | Ga0207652_100045037 | 382 |
| 259 | 3300025923 | Ga0207681_10020937 | Ga0207681_100209373 | 382 |
| 260 | 3300025929 | Ga0207664_10046789 | Ga0207664_100467893 | 382 |
| 261 | 3300025931 | Ga0207644_10005243 | Ga0207644_100052432 | 382 |
| 262 | 3300025938 | Ga0207704_10071369 | Ga0207704_100713692 | 382 |
| 263 | 3300025940 | Ga0207691_10001445 | Ga0207691_1000144512 | 382 |
| 264 | 3300025960 | Ga0207651_10026090 | Ga0207651_100260902 | 382 |
| 265 | 3300025961 | Ga0207712_10080674 | Ga0207712_100806742 | 382 |
| 266 | 3300025972 | Ga0207668_10041511 | Ga0207668_100415113 | 382 |
| 267 | 3300025986 | Ga0207658_10024913 | Ga0207658_100249132 | 382 |
| 268 | 3300026041 | Ga0207639_10010336 | Ga0207639_100103365 | 382 |
| 269 | 3300026067 | Ga0207678_10006690 | Ga0207678_100066902 | 382 |
| 270 | 3300026067 | Ga0207678_10036630 | Ga0207678_100366304 | 382 |
| 271 | 3300026075 | Ga0207708_10072776 | Ga0207708_100727763 | 382 |
| 272 | 3300026088 | Ga0207641_10425955 | Ga0207641_104259551 | 382 |
| 273 | 3300026089 | Ga0207648_10005115 | Ga0207648_100051155 | 382 |
| 274 | 3300026116 | Ga0207674_10007107 | Ga0207674_100071074 | 382 |
| 275 | 3300026116 | Ga0207674_10092027 | Ga0207674_100920272 | 382 |
| 276 | 3300026118 | Ga0207675_100128387 | Ga0207675_1001283872 | 382 |
| 277 | 3300026121 | Ga0207683_10000005 | Ga0207683_100000056 | 382 |
| 278 | 3300027364 | Ga0209967_1004815 | Ga0209967_10048152 | 382 |
| 279 | 3300028379 | Ga0268266_10035506 | Ga0268266_100355063 | 382 |
| 280 | 3300042156 | Ga0439446_0023312 | Ga0439446_0023312_247_1407 | 382 |
| 281 | 3300042435 | Ga0439434_0002344 | Ga0439434_0002344_524_1684 | 382 |
| 282 | 3300042436 | Ga0439435_0008045 | Ga0439435_0008045_137_1297 | 382 |
| 283 | 3300045976 | Ga0466967_0085081 | Ga0466967_0085081_413_1561 | 382 |
| 284 | 3300046680 | Ga0495646_0038855 | Ga0495646_0038855_1314_2477 | 382 |
| 285 | 3300048907 | Ga0496104_0022511 | Ga0496104_0022511_1830_2981 | 382 |
| 286 | 3300048914 | Ga0496111_0218849 | Ga0496111_0218849_37_1221 | 382 |
| 287 | 3300049571 | Ga0501034_0000386 | Ga0501034_0000386_13828_14988 | 382 |
| 288 | 3300049573 | Ga0501037_0003818 | Ga0501037_0003818_567_1727 | 382 |
| 289 | 3300049574 | Ga0501038_0000421 | Ga0501038_0000421_7107_8267 | 382 |
| 290 | 3300049574 | Ga0501038_0163350 | Ga0501038_0163350_289_1464 | 382 |
| 291 | 3300049575 | Ga0501039_0170397 | Ga0501039_0170397_517_1677 | 382 |
| 292 | 3300049579 | Ga0501043_0066217 | Ga0501043_0066217_632_1792 | 382 |
| 293 | 3300049581 | Ga0501047_0001674 | Ga0501047_0001674_141_1316 | 382 |
| 294 | 3300049581 | Ga0501047_0038183 | Ga0501047_0038183_3421_4578 | 382 |
| 295 | 3300049581 | Ga0501047_0064604 | Ga0501047_0064604_456_1616 | 382 |
| 296 | 3300049585 | Ga0501069_0009534 | Ga0501069_0009534_895_2070 | 382 |
| 297 | 3300049586 | Ga0501070_0000487 | Ga0501070_0000487_30785_31960 | 382 |
| 298 | 3300049589 | Ga0501073_0049226 | Ga0501073_0049226_112_1287 | 382 |
| 299 | 3300049592 | Ga0501076_0112224 | Ga0501076_0112224_936_2096 | 382 |
| 300 | 3300049822 | Ga0501035_0003514 | Ga0501035_0003514_6428_7585 | 382 |
| 301 | 3300049822 | Ga0501035_0008042 | Ga0501035_0008042_4457_5632 | 382 |
| 302 | 3300049823 | Ga0501044_0009499 | Ga0501044_0009499_2009_3166 | 382 |
| 303 | 3300049823 | Ga0501044_0013416 | Ga0501044_0013416_6671_7846 | 382 |
| 304 | 3300050509 | nmdc:mga0qj67_66485_c1 | nmdc:mga0qj67_66485_c1_394_1545 | 382 |
| 305 | 3300050511 | nmdc:mga08y16_110010_c1 | nmdc:mga08y16_110010_c1_835_1995 | 382 |
| 306 | 3300053142 | Ga0500577_0008410 | Ga0500577_0008410_626_1774 | 382 |
| 307 | iso_pu_bacteria | 2767802112 | 2768646969 | 382 |
| 308 | iso_pu_bacteria | 2866612099 | 2866615468 | 382 |
| 309 | iso_pu_bacteria | 2867346516 | 2867349290 | 382 |
| 310 | 3300003578 | Ga0006562J51391_1027448 | Ga0006562J51391_10274484 | 383 |
| 311 | 3300003578 | Ga0006562J51391_1027450 | Ga0006562J51391_10274505 | 383 |
| 312 | 3300005290 | Ga0065712_10131502 | Ga0065712_101315022 | 383 |
| 313 | 3300005327 | Ga0070658_10000837 | Ga0070658_1000083725 | 383 |
| 314 | 3300005327 | Ga0070658_10006445 | Ga0070658_100064456 | 383 |
| 315 | 3300005327 | Ga0070658_10032845 | Ga0070658_100328452 | 383 |
| 316 | 3300005329 | Ga0070683_100090591 | Ga0070683_1000905911 | 383 |
| 317 | 3300005334 | Ga0068869_100143892 | Ga0068869_1001438922 | 383 |
| 318 | 3300005339 | Ga0070660_100021866 | Ga0070660_1000218665 | 383 |
| 319 | 3300005344 | Ga0070661_100141629 | Ga0070661_1001416291 | 383 |
| 320 | 3300005355 | Ga0070671_100077306 | Ga0070671_1000773062 | 383 |
| 321 | 3300005366 | Ga0070659_100025886 | Ga0070659_1000258864 | 383 |
| 322 | 3300005445 | Ga0070708_100000065 | Ga0070708_10000006559 | 383 |
| 323 | 3300005455 | Ga0070663_100002740 | Ga0070663_1000027406 | 383 |
| 324 | 3300005455 | Ga0070663_100008508 | Ga0070663_1000085083 | 383 |
| 325 | 3300005458 | Ga0070681_10159132 | Ga0070681_101591322 | 383 |
| 326 | 3300005468 | Ga0070707_100039203 | Ga0070707_1000392034 | 383 |
| 327 | 3300005530 | Ga0070679_100000354 | Ga0070679_1000003544 | 383 |
| 328 | 3300005535 | Ga0070684_100135835 | Ga0070684_1001358351 | 383 |
| 329 | 3300005535 | Ga0070684_100189803 | Ga0070684_1001898032 | 383 |
| 330 | 3300005539 | Ga0068853_100005015 | Ga0068853_1000050156 | 383 |
| 331 | 3300005539 | Ga0068853_100017623 | Ga0068853_1000176234 | 383 |
| 332 | 3300005539 | Ga0068853_100246157 | Ga0068853_1002461571 | 383 |
| 333 | 3300005543 | Ga0070672_100060451 | Ga0070672_1000604513 | 383 |
| 334 | 3300005563 | Ga0068855_100001455 | Ga0068855_10000145511 | 383 |
| 335 | 3300005563 | Ga0068855_100049744 | Ga0068855_1000497444 | 383 |
| 336 | 3300005564 | Ga0070664_100086240 | Ga0070664_1000862402 | 383 |
| 337 | 3300005614 | Ga0068856_100134051 | Ga0068856_1001340512 | 383 |
| 338 | 3300005617 | Ga0068859_100186956 | Ga0068859_1001869562 | 383 |
| 339 | 3300005842 | Ga0068858_100086025 | Ga0068858_1000860252 | 383 |
| 340 | 3300005983 | Ga0081540_1027095 | Ga0081540_10270954 | 383 |
| 341 | 3300006028 | Ga0070717_10136867 | Ga0070717_101368672 | 383 |
| 342 | 3300006871 | Ga0075434_100075672 | Ga0075434_1000756723 | 383 |
| 343 | 3300006880 | Ga0075429_100000402 | Ga0075429_1000004024 | 383 |
| 344 | 3300006881 | Ga0068865_100078854 | Ga0068865_1000788542 | 383 |
| 345 | 3300006931 | Ga0097620_100186948 | Ga0097620_1001869482 | 383 |
| 346 | 3300009093 | Ga0105240_10010403 | Ga0105240_100104033 | 383 |
| 347 | 3300009093 | Ga0105240_10060886 | Ga0105240_100608862 | 383 |
| 348 | 3300009147 | Ga0114129_10029903 | Ga0114129_100299034 | 383 |
| 349 | 3300009177 | Ga0105248_10124423 | Ga0105248_101244232 | 383 |
| 350 | 3300009177 | Ga0105248_10308780 | Ga0105248_103087802 | 383 |
| 351 | 3300009551 | Ga0105238_10016367 | Ga0105238_100163673 | 383 |
| 352 | 3300009551 | Ga0105238_10445834 | Ga0105238_104458341 | 383 |
| 353 | 3300010375 | Ga0105239_10486185 | Ga0105239_104861851 | 383 |
| 354 | 3300011119 | Ga0105246_10083451 | Ga0105246_100834512 | 383 |
| 355 | 3300013100 | Ga0157373_10128977 | Ga0157373_101289772 | 383 |
| 356 | 3300013104 | Ga0157370_10001669 | Ga0157370_100016699 | 383 |
| 357 | 3300013105 | Ga0157369_10099980 | Ga0157369_100999803 | 383 |
| 358 | 3300013296 | Ga0157374_10047770 | Ga0157374_100477702 | 383 |
| 359 | 3300013307 | Ga0157372_10122566 | Ga0157372_101225662 | 383 |
| 360 | 3300013307 | Ga0157372_10174719 | Ga0157372_101747192 | 383 |
| 361 | 3300014969 | Ga0157376_10247514 | Ga0157376_102475142 | 383 |
| 362 | 3300021384 | Ga0213876_10034090 | Ga0213876_100340902 | 383 |
| 363 | 3300025302 | Ga0207426_1001238 | Ga0207426_100123810 | 383 |
| 364 | 3300025302 | Ga0207426_1003918 | Ga0207426_10039182 | 383 |
| 365 | 3300025315 | Ga0207697_10062524 | Ga0207697_100625242 | 383 |
| 366 | 3300025893 | Ga0207682_10010885 | Ga0207682_100108853 | 383 |
| 367 | 3300025904 | Ga0207647_10010093 | Ga0207647_100100934 | 383 |
| 368 | 3300025905 | Ga0207685_10040725 | Ga0207685_100407251 | 383 |
| 369 | 3300025907 | Ga0207645_10041189 | Ga0207645_100411892 | 383 |
| 370 | 3300025908 | Ga0207643_10002947 | Ga0207643_100029475 | 383 |
| 371 | 3300025909 | Ga0207705_10078283 | Ga0207705_100782831 | 383 |
| 372 | 3300025909 | Ga0207705_10103367 | Ga0207705_101033672 | 383 |
| 373 | 3300025913 | Ga0207695_10006092 | Ga0207695_100060925 | 383 |
| 374 | 3300025913 | Ga0207695_10072759 | Ga0207695_100727592 | 383 |
| 375 | 3300025918 | Ga0207662_10007297 | Ga0207662_100072972 | 383 |
| 376 | 3300025919 | Ga0207657_10019568 | Ga0207657_100195684 | 383 |
| 377 | 3300025921 | Ga0207652_10000964 | Ga0207652_100009643 | 383 |
| 378 | 3300025924 | Ga0207694_10213221 | Ga0207694_102132212 | 383 |
| 379 | 3300025926 | Ga0207659_10072839 | Ga0207659_100728392 | 383 |
| 380 | 3300025929 | Ga0207664_10176570 | Ga0207664_101765702 | 383 |
| 381 | 3300025931 | Ga0207644_10185878 | Ga0207644_101858782 | 383 |
| 382 | 3300025932 | Ga0207690_10118545 | Ga0207690_101185452 | 383 |
| 383 | 3300025937 | Ga0207669_10244596 | Ga0207669_102445962 | 383 |
| 384 | 3300025940 | Ga0207691_10040127 | Ga0207691_100401272 | 383 |
| 385 | 3300025941 | Ga0207711_10310787 | Ga0207711_103107871 | 383 |
| 386 | 3300025945 | Ga0207679_10053486 | Ga0207679_100534862 | 383 |
| 387 | 3300025949 | Ga0207667_10003334 | Ga0207667_100033346 | 383 |
| 388 | 3300025949 | Ga0207667_10038455 | Ga0207667_100384553 | 383 |
| 389 | 3300025972 | Ga0207668_10102500 | Ga0207668_101025001 | 383 |
| 390 | 3300026035 | Ga0207703_10160743 | Ga0207703_101607432 | 383 |
| 391 | 3300026067 | Ga0207678_10000702 | Ga0207678_1000070212 | 383 |
| 392 | 3300026067 | Ga0207678_10008308 | Ga0207678_100083084 | 383 |
| 393 | 3300026067 | Ga0207678_10197338 | Ga0207678_101973382 | 383 |
| 394 | 3300026089 | Ga0207648_10106447 | Ga0207648_101064472 | 383 |
| 395 | 3300026095 | Ga0207676_10082429 | Ga0207676_100824292 | 383 |
| 396 | 3300026116 | Ga0207674_10007750 | Ga0207674_100077508 | 383 |
| 397 | 3300027312 | Ga0209371_1017176 | Ga0209371_10171762 | 383 |
| 398 | 3300028558 | Ga0265326_10001407 | Ga0265326_100014072 | 383 |
| 399 | 3300028563 | Ga0265319_1046943 | Ga0265319_10469432 | 383 |
| 400 | 3300028573 | Ga0265334_10002258 | Ga0265334_100022582 | 383 |
| 401 | 3300028653 | Ga0265323_10000925 | Ga0265323_100009252 | 383 |
| 402 | 3300028666 | Ga0265336_10043776 | Ga0265336_100437762 | 383 |
| 403 | 3300028794 | Ga0307515_10002741 | Ga0307515_1000274111 | 383 |
| 404 | 3300028800 | Ga0265338_10001044 | Ga0265338_1000104429 | 383 |
| 405 | 3300028800 | Ga0265338_10062022 | Ga0265338_100620222 | 383 |
| 406 | 3300030521 | Ga0307511_10001661 | Ga0307511_1000166111 | 383 |
| 407 | 3300031238 | Ga0265332_10003899 | Ga0265332_100038995 | 383 |
| 408 | 3300031241 | Ga0265325_10030176 | Ga0265325_100301762 | 383 |
| 409 | 3300031247 | Ga0265340_10027586 | Ga0265340_100275862 | 383 |
| 410 | 3300031507 | Ga0307509_10000403 | Ga0307509_1000040333 | 383 |
| 411 | 3300031616 | Ga0307508_10065536 | Ga0307508_100655362 | 383 |
| 412 | 3300031711 | Ga0265314_10009598 | Ga0265314_100095982 | 383 |
| 413 | 3300031712 | Ga0265342_10007811 | Ga0265342_100078112 | 383 |
| 414 | 3300031731 | Ga0307405_10013241 | Ga0307405_100132412 | 383 |
| 415 | 3300031901 | Ga0307406_10235762 | Ga0307406_102357622 | 383 |
| 416 | 3300031995 | Ga0307409_100093238 | Ga0307409_1000932382 | 383 |
| 417 | 3300031995 | Ga0307409_100350143 | Ga0307409_1003501432 | 383 |
| 418 | 3300032002 | Ga0307416_100159559 | Ga0307416_1001595592 | 383 |
| 419 | 3300032005 | Ga0307411_10114783 | Ga0307411_101147832 | 383 |
| 420 | 3300032126 | Ga0307415_100049807 | Ga0307415_1000498072 | 383 |
| 421 | 3300032126 | Ga0307415_100136133 | Ga0307415_1001361332 | 383 |
| 422 | 3300033179 | Ga0307507_10121676 | Ga0307507_101216762 | 383 |
| 423 | 3300033180 | Ga0307510_10030634 | Ga0307510_100306347 | 383 |
| 424 | 3300035090 | Ga0373949_0000112 | Ga0373949_0000112_7801_8970 | 383 |
| 425 | 3300035695 | Ga0373927_0014701 | Ga0373927_0014701_1299_2459 | 383 |
| 426 | 3300036401 | Ga0373937_0010803 | Ga0373937_0010803_685_1872 | 383 |
| 427 | 3300037853 | Ga0436364_1070120 | Ga0436364_1070120_2903_4054 | 383 |
| 428 | 3300039437 | Ga0436365_0961376 | Ga0436365_0961376_646_1878 | 383 |
| 429 | 3300039437 | Ga0436365_1394498 | Ga0436365_1394498_68_1219 | 383 |
| 430 | 3300041413 | Ga0439465_0001095 | Ga0439465_0001095_6466_7629 | 383 |
| 431 | 3300042007 | Ga0439449_0005470 | Ga0439449_0005470_1493_2644 | 383 |
| 432 | 3300044656 | Ga0466969_0019832 | Ga0466969_0019832_2324_3475 | 383 |
| 433 | 3300044658 | Ga0466972_0030120 | Ga0466972_0030120_1459_2610 | 383 |
| 434 | 3300044658 | Ga0466972_0086010 | Ga0466972_0086010_223_1374 | 383 |
| 435 | 3300044684 | Ga0466966_0004356 | Ga0466966_0004356_3302_4453 | 383 |
| 436 | 3300044684 | Ga0466966_0009137 | Ga0466966_0009137_4545_5696 | 383 |
| 437 | 3300044693 | Ga0466961_0004861 | Ga0466961_0004861_1862_3013 | 383 |
| 438 | 3300044693 | Ga0466961_0005533 | Ga0466961_0005533_4602_5753 | 383 |
| 439 | 3300044693 | Ga0466961_0039060 | Ga0466961_0039060_753_1904 | 383 |
| 440 | 3300044694 | Ga0466963_0000506 | Ga0466963_0000506_1332_2483 | 383 |
| 441 | 3300044706 | Ga0466964_0009674 | Ga0466964_0009674_89_1240 | 383 |
| 442 | 3300044719 | Ga0466971_0016724 | Ga0466971_0016724_2070_3221 | 383 |
| 443 | 3300044765 | Ga0466970_0003950 | Ga0466970_0003950_4516_5667 | 383 |
| 444 | 3300044842 | Ga0466957_0000304 | Ga0466957_0000304_20716_21867 | 383 |
| 445 | 3300044901 | Ga0466960_0019514 | Ga0466960_0019514_1375_2526 | 383 |
| 446 | 3300045049 | Ga0466959_0004028 | Ga0466959_0004028_1749_2900 | 383 |
| 447 | 3300045051 | Ga0451576_0026836 | Ga0451576_0026836_2764_4002 | 383 |
| 448 | 3300045836 | Ga0466958_0002417 | Ga0466958_0002417_8059_9210 | 383 |
| 449 | 3300045976 | Ga0466967_0018260 | Ga0466967_0018260_2191_3342 | 383 |
| 450 | 3300046454 | Ga0495592_0009563 | Ga0495592_0009563_3293_4444 | 383 |
| 451 | 3300046454 | Ga0495592_0022120 | Ga0495592_0022120_1554_2720 | 383 |
| 452 | 3300046455 | Ga0495603_0000270 | Ga0495603_0000270_17920_19071 | 383 |
| 453 | 3300046455 | Ga0495603_0035175 | Ga0495603_0035175_1399_2550 | 383 |
| 454 | 3300046459 | Ga0495629_0002755 | Ga0495629_0002755_8090_9241 | 383 |
| 455 | 3300046462 | Ga0495651_0004623 | Ga0495651_0004623_7999_9150 | 383 |
| 456 | 3300046462 | Ga0495651_0025202 | Ga0495651_0025202_2265_3431 | 383 |
| 457 | 3300046463 | Ga0495653_0057666 | Ga0495653_0057666_1628_2779 | 383 |
| 458 | 3300046472 | Ga0495580_0017726 | Ga0495580_0017726_2204_3364 | 383 |
| 459 | 3300046472 | Ga0495580_0048563 | Ga0495580_0048563_687_1838 | 383 |
| 460 | 3300046476 | Ga0495662_0006964 | Ga0495662_0006964_176_1327 | 383 |
| 461 | 3300046477 | Ga0495664_0075510 | Ga0495664_0075510_475_1626 | 383 |
| 462 | 3300046499 | Ga0495594_0004572 | Ga0495594_0004572_2233_3393 | 383 |
| 463 | 3300046511 | Ga0495608_0001470 | Ga0495608_0001470_9714_10865 | 383 |
| 464 | 3300046516 | Ga0495628_0015383 | Ga0495628_0015383_3834_4985 | 383 |
| 465 | 3300046517 | Ga0495630_0025338 | Ga0495630_0025338_2965_4116 | 383 |
| 466 | 3300046526 | Ga0495666_0023704 | Ga0495666_0023704_685_1836 | 383 |
| 467 | 3300046529 | Ga0495652_0000680 | Ga0495652_0000680_21572_22738 | 383 |
| 468 | 3300046529 | Ga0495652_0021332 | Ga0495652_0021332_3923_5074 | 383 |
| 469 | 3300046533 | Ga0495640_0098953 | Ga0495640_0098953_590_1741 | 383 |
| 470 | 3300046536 | Ga0495587_0026611 | Ga0495587_0026611_154_1305 | 383 |
| 471 | 3300046543 | Ga0495645_0000732 | Ga0495645_0000732_938_2089 | 383 |
| 472 | 3300046543 | Ga0495645_0028391 | Ga0495645_0028391_2462_3613 | 383 |
| 473 | 3300046559 | Ga0495667_0008815 | Ga0495667_0008815_1126_2277 | 383 |
| 474 | 3300046559 | Ga0495667_0103725 | Ga0495667_0103725_242_1405 | 383 |
| 475 | 3300046663 | Ga0495635_0005934 | Ga0495635_0005934_3751_4917 | 383 |
| 476 | 3300046675 | Ga0495657_0008253 | Ga0495657_0008253_4680_5831 | 383 |
| 477 | 3300046675 | Ga0495657_0022281 | Ga0495657_0022281_1126_2277 | 383 |
| 478 | 3300046675 | Ga0495657_0182501 | Ga0495657_0182501_60_1247 | 383 |
| 479 | 3300046678 | Ga0495599_0033315 | Ga0495599_0033315_555_1721 | 383 |
| 480 | 3300046678 | Ga0495599_0104246 | Ga0495599_0104246_590_1741 | 383 |
| 481 | 3300046679 | Ga0495623_0005832 | Ga0495623_0005832_1003_2169 | 383 |
| 482 | 3300046679 | Ga0495623_0048645 | Ga0495623_0048645_412_1563 | 383 |
| 483 | 3300046689 | Ga0495613_0002772 | Ga0495613_0002772_2893_4044 | 383 |
| 484 | 3300046689 | Ga0495613_0003415 | Ga0495613_0003415_3423_4574 | 383 |
| 485 | 3300046809 | Ga0495600_0027889 | Ga0495600_0027889_1375_2526 | 383 |
| 486 | 3300047315 | Ga0495581_0088215 | Ga0495581_0088215_291_1451 | 383 |
| 487 | 3300047317 | Ga0495604_0004205 | Ga0495604_0004205_8393_9544 | 383 |
| 488 | 3300047317 | Ga0495604_0014856 | Ga0495604_0014856_2094_3245 | 383 |
| 489 | 3300047319 | Ga0495674_0017927 | Ga0495674_0017927_4635_5786 | 383 |
| 490 | 3300047321 | Ga0495676_0005415 | Ga0495676_0005415_2916_4067 | 383 |
| 491 | 3300047321 | Ga0495676_0008990 | Ga0495676_0008990_2485_3636 | 383 |
| 492 | 3300047444 | Ga0495675_0015811 | Ga0495675_0015811_2248_3399 | 383 |
| 493 | 3300048089 | Ga0495614_0000393 | Ga0495614_0000393_8662_9813 | 383 |
| 494 | 3300048089 | Ga0495614_0071451 | Ga0495614_0071451_17_1168 | 383 |
| 495 | 3300048905 | Ga0496102_0017786 | Ga0496102_0017786_5053_6216 | 383 |
| 496 | 3300048907 | Ga0496104_0000084 | Ga0496104_0000084_78108_79283 | 383 |
| 497 | 3300048907 | Ga0496104_0000304 | Ga0496104_0000304_11806_12969 | 383 |
| 498 | 3300048908 | Ga0496105_0005361 | Ga0496105_0005361_3452_4615 | 383 |
| 499 | 3300048911 | Ga0496108_0003436 | Ga0496108_0003436_1986_3149 | 383 |
| 500 | 3300048911 | Ga0496108_0123897 | Ga0496108_0123897_534_1721 | 383 |
| 501 | 3300048912 | Ga0496109_0013906 | Ga0496109_0013906_2417_3580 | 383 |
| 502 | 3300048913 | Ga0496110_0013175 | Ga0496110_0013175_1402_2565 | 383 |
| 503 | 3300048914 | Ga0496111_0001068 | Ga0496111_0001068_12702_13865 | 383 |
| 504 | 3300048915 | Ga0496112_0043039 | Ga0496112_0043039_2176_3363 | 383 |
| 505 | 3300048916 | Ga0496113_0048604 | Ga0496113_0048604_1097_2284 | 383 |
| 506 | 3300048917 | Ga0496114_0007675 | Ga0496114_0007675_4481_5647 | 383 |
| 507 | 3300048918 | Ga0496115_0017906 | Ga0496115_0017906_2285_3445 | 383 |
| 508 | 3300048918 | Ga0496115_0093866 | Ga0496115_0093866_164_1327 | 383 |
| 509 | 3300048918 | Ga0496115_0183703 | Ga0496115_0183703_317_1480 | 383 |
| 510 | 3300048929 | Ga0496126_0000085 | Ga0496126_0000085_136253_137428 | 383 |
| 511 | 3300049568 | Ga0501031_0010569 | Ga0501031_0010569_4604_5755 | 383 |
| 512 | 3300049569 | Ga0501032_0035741 | Ga0501032_0035741_840_1991 | 383 |
| 513 | 3300049571 | Ga0501034_0114120 | Ga0501034_0114120_1265_2416 | 383 |
| 514 | 3300049572 | Ga0501036_0038287 | Ga0501036_0038287_1540_2691 | 383 |
| 515 | 3300049572 | Ga0501036_0048374 | Ga0501036_0048374_720_1871 | 383 |
| 516 | 3300049573 | Ga0501037_0013558 | Ga0501037_0013558_3085_4236 | 383 |
| 517 | 3300049573 | Ga0501037_0048521 | Ga0501037_0048521_1442_2602 | 383 |
| 518 | 3300049574 | Ga0501038_0101198 | Ga0501038_0101198_881_2032 | 383 |
| 519 | 3300049579 | Ga0501043_0005286 | Ga0501043_0005286_4719_5870 | 383 |
| 520 | 3300049579 | Ga0501043_0211314 | Ga0501043_0211314_330_1490 | 383 |
| 521 | 3300049580 | Ga0501046_0009034 | Ga0501046_0009034_2890_4041 | 383 |
| 522 | 3300049582 | Ga0501048_0082447 | Ga0501048_0082447_403_1554 | 383 |
| 523 | 3300049822 | Ga0501035_0056722 | Ga0501035_0056722_799_1950 | 383 |
| 524 | 3300049822 | Ga0501035_0091231 | Ga0501035_0091231_160_1311 | 383 |
| 525 | 3300049823 | Ga0501044_0019873 | Ga0501044_0019873_2975_4159 | 383 |
| 526 | 3300049823 | Ga0501044_0236618 | Ga0501044_0236618_31_1182 | 383 |
| 527 | 3300050507 | nmdc:mga05p37_334797_c1 | nmdc:mga05p37_334797_c1_441_1604 | 383 |
| 528 | 3300050508 | nmdc:mga09592_62245_c1 | nmdc:mga09592_62245_c1_1125_2288 | 383 |
| 529 | 3300050512 | nmdc:mga0n895_199556_c1 | nmdc:mga0n895_199556_c1_749_1987 | 383 |
| 530 | 3300050512 | nmdc:mga0n895_285914_c1 | nmdc:mga0n895_285914_c1_166_1407 | 383 |
| 531 | 3300053078 | Ga0495612_0007964 | Ga0495612_0007964_1829_2995 | 383 |
| 532 | 3300053085 | Ga0495619_0012030 | Ga0495619_0012030_2779_3930 | 383 |
| 533 | 3300053085 | Ga0495619_0212025 | Ga0495619_0212025_28_1194 | 383 |
| 534 | 3300053178 | Ga0500637_0100249 | Ga0500637_0100249_481_1641 | 383 |
| 535 | 3300009094 | Ga0111539_10011464 | Ga0111539_1001146413 | 384 |
| 536 | 3300026121 | Ga0207683_10220127 | Ga0207683_102201272 | 384 |
| 537 | 3300028794 | Ga0307515_10002074 | Ga0307515_1000207416 | 384 |
| 538 | 3300044693 | Ga0466961_0006498 | Ga0466961_0006498_4258_5430 | 384 |
| 539 | 3300044719 | Ga0466971_0004337 | Ga0466971_0004337_2657_3829 | 384 |
| 540 | 3300045049 | Ga0466959_0000325 | Ga0466959_0000325_20309_21481 | 384 |
| 541 | 3300046462 | Ga0495651_0000482 | Ga0495651_0000482_11371_12540 | 384 |
| 542 | 3300046514 | Ga0495618_0095011 | Ga0495618_0095011_528_1697 | 384 |
| 543 | 3300046516 | Ga0495628_0010756 | Ga0495628_0010756_6431_7600 | 384 |
| 544 | 3300046809 | Ga0495600_0010460 | Ga0495600_0010460_1986_3155 | 384 |
| 545 | 3300053077 | Ga0495601_0006969 | Ga0495601_0006969_3597_4766 | 384 |
| 546 | 3300061719 | Ga0466962_0000167 | Ga0466962_0000167_6840_8012 | 384 |
| 547 | 3300028563 | Ga0265319_1017168 | Ga0265319_10171682 | 385 |
| 548 | 3300031240 | Ga0265320_10000130 | Ga0265320_1000013058 | 385 |
| 549 | 3300031616 | Ga0307508_10052444 | Ga0307508_100524443 | 385 |
| 550 | 3300031730 | Ga0307516_10012545 | Ga0307516_100125452 | 385 |
| 551 | 3300046694 | Ga0495649_0016265 | Ga0495649_0016265_1221_2378 | 385 |
| 552 | 3300053140 | Ga0500573_0147218 | Ga0500573_0147218_69_1229 | 385 |
| 553 | 3300053107 | Ga0500560_000204 | Ga0500560_000204_2148_3341 | 387 |
| 554 | iso_pu_bacteria | 2862705112 | 2862708724 | 387 |
| 555 | iso_pu_bacteria | 2990044586 | 2990048569 | 387 |
| 556 | iso_pu_bacteria | 8008485437 | 8008487882 | 387 |
| 557 | iso_pu_bacteria | 8025524527 | 8025526599 | 387 |
| 558 | 3300038443 | Ga0395901_0442802 | Ga0395901_0442802_53_1246 | 389 |
| 559 | iso_pu_bacteria | 2954002825 | 2954003391 | 389 |
| 560 | 3300005983 | Ga0081540_1006447 | Ga0081540_10064475 | 390 |
| 561 | 3300046660 | Ga0495625_0005251 | Ga0495625_0005251_3449_4624 | 391 |
| 562 | 3300049571 | Ga0501034_0030816 | Ga0501034_0030816_3851_5041 | 391 |
| 563 | 3300050510 | nmdc:mga06r32_16702_c1 | nmdc:mga06r32_16702_c1_2034_3212 | 392 |
| 564 | 3300038443 | Ga0395901_0117792 | Ga0395901_0117792_1314_2495 | 393 |
| 565 | 3300028786 | Ga0307517_10006019 | Ga0307517_100060197 | 395 |
| 566 | iso_pu_bacteria | 2751185734 | 2753074821 | 395 |
| 567 | 3300005981 | Ga0081538_10001934 | Ga0081538_1000193410 | 397 |
| 568 | 3300015688 | Ga0183367_1006 | Ga0183367_1006306 | 397 |
| 569 | 3300003578 | Ga0006562J51391_1115102 | Ga0006562J51391_11151025 | 398 |
| 570 | 3300003578 | Ga0006562J51391_1115103 | Ga0006562J51391_11151032 | 398 |
| 571 | 3300006844 | Ga0075428_100000289 | Ga0075428_10000028940 | 398 |
| 572 | 3300006880 | Ga0075429_100298423 | Ga0075429_1002984232 | 398 |
| 573 | iso_pu_bacteria | 2808606448 | 2809231604 | 399 |
| 574 | iso_pu_bacteria | 2946064051 | 2946067067 | 402 |
| 575 | 3300014497 | Ga0182008_10015751 | Ga0182008_100157512 | 406 |
| 576 | 3300042138 | Ga0450903_007080 | Ga0450903_007080_515_1735 | 406 |
| 577 | 3300031649 | Ga0307514_10064088 | Ga0307514_100640882 | 407 |
| 578 | 3300005564 | Ga0070664_100035087 | Ga0070664_1000350874 | 408 |
| 579 | 3300001990 | JGI24737J22298_10016034 | JGI24737J22298_100160342 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oqb-assembly1.cif.gz_C | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9903 | 26 | 407 |
| 3oqb-assembly1.cif.gz_H | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9883 | 26 | 407 |
| 3oqb-assembly1.cif.gz_C | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9877 | 26 | 407 |
| 3oqb-assembly1.cif.gz_H | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9856 | 26 | 407 |
| 3oqb-assembly1.cif.gz_A | crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 | 0.9853 | 26 | 407 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oqbH02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9907 | 168 | 407 | 3.30.360.10 |
| 3oqbH02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9823 | 168 | 407 | 3.30.360.10 |
| 3oqbF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9787 | 26 | 166 | 3.40.50.720 |
| 3oqbF01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9716 | 26 | 166 | 3.40.50.720 |
| 1xeaB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8907 | 30 | 165 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535CEX2-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9922 | 85 | 406 |
GO:0000166
GO:0016491 |
| AF-A0A535CEX2-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9681 | 85 | 406 |
GO:0000166
GO:0016491 |
| AF-A0A060XI41-F1-model_v4 | Uncharacterized protein | 0.9377 | 97 | 183 |
GO:0000166
GO:0004074 GO:0008270 GO:0042167 |
| AF-A0A7X8MEI1-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9103 | 26 | 403 |
|
| AF-A0A7C2VWT6-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9072 | 28 | 403 |
GO:0000166
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar