F465823

General Info

Members Datasets Scaffolds Average Seq Length
579 377 511 384

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10011464|Ga0111539_1001146413
Length 444
Sequence VANVFQSSATGRRTIRIAMNGVTGRMGTNQHLVRSILAIREEGGIAVAPGEALWPVPVLVGRDERKLSALAEPHELEYTTDLAGALADCDVYFDAQVTSRREDAVRAAVEAGRHVYCEKPLTEDVASALALARAADEAGIKHGVVQDKLFLPGIRTLKRVLDSGALGRVLSVRGEFGYWVFPGPDPTPQRPSWNYRAQDGGGIVADMFAHWRYVLDELFGAVHGVFALGATHVPVRYDEQGEPYEATAEDAAYAMFELDGGVIAQLNSSWCVRVDRDELFELQVDGTEGTAVAGLRDCRLQPGAATPRSVWNPDLPDPVHHRAAWMPVPGEEPDNAFKVQWELFLRHVALDEPFPWDFRAGARGVQLSELGLRSWRERRWVEVPVLRRWRPSPCGSRGAAARSSPRTSWPIRSASQAHWTGTRRSRSGGTCGPTGSAWRRRWTS

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221670 Streptomyces sp. Root431 Isolate Unclassified
7 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
11 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
12 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
13 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
17 2808606448 Streptomyces sp. 193411 Isolate Unclassified
18 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
19 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
20 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
21 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
22 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
23 2862574272 Streptomyces sp. AcE210 Isolate Nodule
24 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
25 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
26 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
27 2867369537 Streptomyces sp. Z26 Isolate Unclassified
28 2867428634 Streptomyces sp. RP5T Isolate Unclassified
29 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
30 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
31 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
32 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
33 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
34 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
37 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
38 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
39 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
40 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
41 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
42 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
43 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
44 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
45 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
46 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
47 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
48 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
49 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
50 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
51 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
52 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
53 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
54 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
192 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
235 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
295 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
355 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
358 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
359 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
369 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
370 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
371 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
372 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
373 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
374 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
375 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
376 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
377 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0.69
Isolates 11.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.17
Rhizoplane 3.45
Rhizosphere 81.52
Stem 0
Stem Tuber 0
Unclassified 11.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016034 3300001990 Bacteria 2420
2 Ga0006562J51391_1027448 3300003578 Bacteria 5880
3 Ga0006562J51391_1027450 3300003578 Bacteria 5940
4 Ga0006562J51391_1115102 3300003578 Bacteria 5940
5 Ga0006562J51391_1115103 3300003578 Bacteria 2937
6 Ga0065712_10131502 3300005290 Bacteria 1544
7 Ga0070658_10000837 3300005327 Bacteria 26278
8 Ga0070658_10006445 3300005327 Bacteria 9511
9 Ga0070658_10032845 3300005327 Bacteria 4173
10 Ga0070658_10120292 3300005327 Bacteria 2182
11 Ga0070676_10001373 3300005328 Bacteria 12266
12 Ga0070676_10002091 3300005328 Bacteria 10155
13 Ga0070676_10033478 3300005328 Bacteria 2949
14 Ga0070683_100039836 3300005329 Bacteria 4316
15 Ga0070683_100055663 3300005329 Bacteria 3671
16 Ga0070683_100090591 3300005329 Bacteria 2871
17 Ga0070670_100002131 3300005331 Bacteria 16246
18 Ga0070670_100172402 3300005331 Bacteria 1877
19 Ga0070677_10045907 3300005333 Bacteria 1745
20 Ga0068869_100143892 3300005334 Bacteria 1844
21 Ga0070666_10004120 3300005335 Bacteria 8824
22 Ga0068868_100012473 3300005338 Bacteria 6214
23 Ga0070660_100021866 3300005339 Bacteria 4723
24 Ga0070660_100025774 3300005339 Bacteria 4372
25 Ga0070660_100061557 3300005339 Bacteria 2914
26 Ga0070691_10006836 3300005341 Bacteria 5215
27 Ga0070661_100141629 3300005344 Bacteria 1812
28 Ga0070661_100146358 3300005344 Bacteria 1784
29 Ga0070668_100004745 3300005347 Bacteria 10084
30 Ga0070668_100021164 3300005347 Bacteria 4916
31 Ga0070675_100003182 3300005354 Bacteria 12425
32 Ga0070671_100003465 3300005355 Bacteria 12315
33 Ga0070671_100077306 3300005355 Bacteria 2781
34 Ga0070674_100008362 3300005356 Bacteria 6160
35 Ga0070673_100003135 3300005364 Bacteria 10232
36 Ga0070659_100025886 3300005366 Bacteria 4512
37 Ga0070667_100316451 3300005367 Bacteria 1408
38 Ga0070709_10007846 3300005434 Bacteria 5861
39 Ga0070709_10092569 3300005434 Bacteria 1997
40 Ga0070714_100048184 3300005435 Bacteria 3623
41 Ga0070710_10006157 3300005437 Bacteria 5739
42 Ga0070711_100023906 3300005439 Bacteria 3981
43 Ga0070700_100037877 3300005441 Bacteria 2935
44 Ga0070708_100000065 3300005445 Bacteria 69306
45 Ga0070663_100002740 3300005455 Bacteria 9983
46 Ga0070663_100008508 3300005455 Bacteria 6316
47 Ga0070663_100010425 3300005455 Bacteria 5792
48 Ga0070663_100022037 3300005455 Bacteria 4251
49 Ga0070681_10106805 3300005458 Bacteria 2741
50 Ga0070681_10159132 3300005458 Bacteria 2182
51 Ga0068867_100003568 3300005459 Bacteria 10945
52 Ga0068867_100067035 3300005459 Bacteria 2675
53 Ga0070707_100039203 3300005468 Bacteria 4528
54 Ga0070698_100145958 3300005471 Bacteria 2315
55 Ga0070699_100008755 3300005518 Bacteria 8771
56 Ga0070679_100000354 3300005530 Bacteria 39082
57 Ga0070679_100009371 3300005530 Bacteria 9260
58 Ga0070679_100021162 3300005530 Bacteria 6346
59 Ga0070684_100135835 3300005535 Bacteria 2221
60 Ga0070684_100189803 3300005535 Bacteria 1869
61 Ga0070684_100214798 3300005535 Bacteria 1754
62 Ga0068853_100005015 3300005539 Bacteria 10321
63 Ga0068853_100017623 3300005539 Bacteria 5895
64 Ga0068853_100246157 3300005539 Bacteria 1640
65 Ga0070672_100015179 3300005543 Bacteria 5476
66 Ga0070672_100060451 3300005543 Bacteria 2983
67 Ga0070672_100138598 3300005543 Bacteria 2005
68 Ga0070665_100000204 3300005548 Bacteria 103980
69 Ga0070665_100004380 3300005548 Bacteria 14846
70 Ga0068855_100001455 3300005563 Bacteria 29543
71 Ga0068855_100049744 3300005563 Bacteria 4943
72 Ga0070664_100035087 3300005564 Bacteria 4210
73 Ga0070664_100086240 3300005564 Bacteria 2713
74 Ga0068857_100009005 3300005577 Bacteria 8653
75 Ga0068856_100134051 3300005614 Bacteria 2482
76 Ga0068852_100003935 3300005616 Bacteria 10438
77 Ga0068859_100186956 3300005617 Bacteria 2155
78 Ga0068861_100002273 3300005719 Bacteria 12478
79 Ga0068851_10000749 3300005834 Bacteria 13938
80 Ga0068851_10019024 3300005834 Bacteria 3317
81 Ga0068863_100012995 3300005841 Bacteria 8029
82 Ga0068858_100086025 3300005842 Bacteria 2925
83 Ga0068860_100021822 3300005843 Bacteria 6194
84 Ga0081455_10008019 3300005937 Bacteria 11034
85 Ga0081455_10047944 3300005937 Bacteria 3695
86 Ga0081538_10001934 3300005981 Bacteria 20747
87 Ga0081540_1006447 3300005983 Bacteria 8541
88 Ga0081540_1027095 3300005983 Bacteria 3254
89 Ga0081539_10001070 3300005985 Bacteria 50023
90 Ga0070717_10136867 3300006028 Bacteria 2110
91 Ga0075370_10066998 3300006353 Bacteria 2049
92 Ga0075428_100000289 3300006844 Bacteria 49296
93 Ga0075428_100032142 3300006844 Bacteria 5797
94 Ga0075428_100212173 3300006844 Bacteria 2092
95 Ga0075428_100256468 3300006844 Bacteria 1884
96 Ga0075430_100013280 3300006846 Bacteria 7020
97 Ga0075431_100015347 3300006847 Bacteria 7762
98 Ga0075431_100114206 3300006847 Bacteria 2788
99 Ga0075434_100075672 3300006871 Bacteria 3361
100 Ga0075434_100095835 3300006871 Bacteria 2972
101 Ga0075429_100000402 3300006880 Bacteria 31962
102 Ga0075429_100003160 3300006880 Bacteria 13999
103 Ga0075429_100298423 3300006880 Bacteria 1411
104 Ga0068865_100078854 3300006881 Bacteria 2357
105 Ga0068865_100263345 3300006881 Bacteria 1366
106 Ga0097620_100186948 3300006931 Bacteria 2155
107 Ga0075435_100073666 3300007076 Bacteria 2792
108 Ga0105240_10001673 3300009093 Bacteria 37631
109 Ga0105240_10010403 3300009093 Bacteria 13073
110 Ga0105240_10060886 3300009093 Bacteria 4705
111 Ga0105240_10063734 3300009093 Bacteria 4583
112 Ga0105240_10125892 3300009093 Bacteria 3079
113 Ga0111539_10011464 3300009094 Bacteria 11128
114 Ga0111539_10023670 3300009094 Bacteria 7546
115 Ga0105245_10270456 3300009098 Bacteria 1657
116 Ga0114129_10001926 3300009147 Bacteria 28355
117 Ga0114129_10029362 3300009147 Bacteria 7789
118 Ga0114129_10029903 3300009147 Bacteria 7714
119 Ga0105241_10049319 3300009174 Bacteria 3206
120 Ga0105248_10124423 3300009177 Bacteria 2909
121 Ga0105248_10308780 3300009177 Bacteria 1781
122 Ga0105237_10114640 3300009545 Bacteria 2688
123 Ga0105238_10015806 3300009551 Bacteria 7639
124 Ga0105238_10016367 3300009551 Bacteria 7505
125 Ga0105238_10048034 3300009551 Bacteria 4302
126 Ga0105238_10445834 3300009551 Bacteria 1291
127 Ga0105249_10061024 3300009553 Bacteria 3460
128 Ga0105239_10338411 3300010375 Bacteria 1698
129 Ga0105239_10486185 3300010375 Bacteria 1403
130 Ga0105246_10083451 3300011119 Bacteria 2283
131 Ga0157373_10128977 3300013100 Bacteria 1778
132 Ga0157370_10001669 3300013104 Bacteria 27346
133 Ga0157370_10095233 3300013104 Bacteria 2793
134 Ga0157370_10289729 3300013104 Bacteria 1512
135 Ga0157369_10099980 3300013105 Bacteria 3091
136 Ga0157374_10047770 3300013296 Bacteria 3969
137 Ga0157372_10120473 3300013307 Bacteria 3013
138 Ga0157372_10122566 3300013307 Bacteria 2987
139 Ga0157372_10174719 3300013307 Bacteria 2486
140 Ga0157372_10405462 3300013307 Bacteria 1588
141 Ga0157375_10003512 3300013308 Bacteria 13596
142 Ga0163163_10101808 3300014325 Bacteria 2895
143 Ga0163163_10200074 3300014325 Bacteria 2046
144 Ga0182008_10015751 3300014497 Bacteria 3939
145 Ga0157376_10247514 3300014969 Bacteria 1663
146 Ga0183367_1006 3300015688 Bacteria 648044
147 Ga0163161_10128810 3300017792 Bacteria 1907
148 Ga0213876_10034090 3300021384 Bacteria 2684
149 Ga0207426_1001238 3300025302 Bacteria 22461
150 Ga0207426_1003918 3300025302 Bacteria 7634
151 Ga0207697_10062524 3300025315 Bacteria 1550
152 Ga0207656_10050037 3300025321 Bacteria 1803
153 Ga0207682_10001577 3300025893 Bacteria 10497
154 Ga0207682_10010885 3300025893 Bacteria 3560
155 Ga0207692_10035126 3300025898 Bacteria 2434
156 Ga0207647_10010093 3300025904 Bacteria 6679
157 Ga0207685_10040725 3300025905 Bacteria 1733
158 Ga0207699_10047663 3300025906 Bacteria 2513
159 Ga0207645_10041189 3300025907 Bacteria 2958
160 Ga0207643_10002947 3300025908 Bacteria 9182
161 Ga0207705_10001995 3300025909 Bacteria 15872
162 Ga0207705_10009902 3300025909 Bacteria 6940
163 Ga0207705_10009948 3300025909 Bacteria 6925
164 Ga0207705_10078283 3300025909 Bacteria 2406
165 Ga0207705_10103367 3300025909 Bacteria 2098
166 Ga0207705_10129915 3300025909 Bacteria 1874
167 Ga0207707_10187349 3300025912 Bacteria 1806
168 Ga0207695_10006092 3300025913 Bacteria 15738
169 Ga0207695_10072759 3300025913 Bacteria 3505
170 Ga0207695_10393437 3300025913 Bacteria 1271
171 Ga0207671_10108826 3300025914 Bacteria 2107
172 Ga0207662_10007297 3300025918 Bacteria 6010
173 Ga0207662_10145707 3300025918 Bacteria 1503
174 Ga0207657_10019568 3300025919 Bacteria 6424
175 Ga0207657_10035164 3300025919 Bacteria 4496
176 Ga0207649_10096825 3300025920 Bacteria 1945
177 Ga0207652_10000964 3300025921 Bacteria 26866
178 Ga0207652_10004503 3300025921 Bacteria 11316
179 Ga0207652_10095879 3300025921 Bacteria 2613
180 Ga0207681_10020937 3300025923 Bacteria 4151
181 Ga0207681_10042369 3300025923 Bacteria 3041
182 Ga0207694_10213221 3300025924 Bacteria 1573
183 Ga0207659_10072839 3300025926 Bacteria 2513
184 Ga0207687_10032836 3300025927 Bacteria 3518
185 Ga0207664_10046789 3300025929 Bacteria 3397
186 Ga0207664_10176570 3300025929 Bacteria 1832
187 Ga0207644_10005243 3300025931 Bacteria 8460
188 Ga0207644_10185878 3300025931 Bacteria 1631
189 Ga0207690_10118545 3300025932 Bacteria 1918
190 Ga0207669_10244596 3300025937 Bacteria 1332
191 Ga0207704_10071369 3300025938 Bacteria 2204
192 Ga0207691_10001445 3300025940 Bacteria 23679
193 Ga0207691_10040127 3300025940 Bacteria 4327
194 Ga0207711_10310787 3300025941 Bacteria 1455
195 Ga0207679_10053486 3300025945 Bacteria 2967
196 Ga0207667_10003334 3300025949 Bacteria 19822
197 Ga0207667_10038455 3300025949 Bacteria 5110
198 Ga0207651_10026090 3300025960 Bacteria 3643
199 Ga0207712_10080674 3300025961 Bacteria 2367
200 Ga0207668_10041511 3300025972 Bacteria 3110
201 Ga0207668_10102500 3300025972 Bacteria 2129
202 Ga0207658_10024913 3300025986 Bacteria 4186
203 Ga0207703_10160743 3300026035 Bacteria 1967
204 Ga0207639_10010336 3300026041 Bacteria 6463
205 Ga0207678_10000523 3300026067 Bacteria 34843
206 Ga0207678_10000702 3300026067 Bacteria 30550
207 Ga0207678_10006690 3300026067 Bacteria 10222
208 Ga0207678_10008308 3300026067 Bacteria 9149
209 Ga0207678_10036630 3300026067 Bacteria 4271
210 Ga0207678_10197338 3300026067 Bacteria 1720
211 Ga0207708_10072776 3300026075 Bacteria 2634
212 Ga0207708_10212000 3300026075 Bacteria 1549
213 Ga0207641_10425955 3300026088 Bacteria 1279
214 Ga0207648_10005115 3300026089 Bacteria 13292
215 Ga0207648_10106447 3300026089 Bacteria 2461
216 Ga0207676_10082429 3300026095 Bacteria 2616
217 Ga0207674_10007107 3300026116 Bacteria 13083
218 Ga0207674_10007750 3300026116 Bacteria 12493
219 Ga0207674_10092027 3300026116 Bacteria 3022
220 Ga0207675_100128387 3300026118 Bacteria 2403
221 Ga0207683_10000005 3300026121 Bacteria 187889
222 Ga0207683_10220127 3300026121 Bacteria 1729
223 Ga0207683_10450279 3300026121 Bacteria 1187
224 Ga0209371_1017176 3300027312 Bacteria 1882
225 Ga0209967_1004815 3300027364 Bacteria 1805
226 Ga0268266_10000475 3300028379 Bacteria 57835
227 Ga0268266_10035506 3300028379 Bacteria 4240
228 Ga0265326_10001407 3300028558 Bacteria 8471
229 Ga0265319_1017168 3300028563 Bacteria 2757
230 Ga0265319_1046943 3300028563 Bacteria 1438
231 Ga0265334_10002258 3300028573 Bacteria 9056
232 Ga0265323_10000925 3300028653 Bacteria 15428
233 Ga0265336_10043776 3300028666 Bacteria 1363
234 Ga0307517_10006019 3300028786 Bacteria 18073
235 Ga0307515_10002074 3300028794 Bacteria 44147
236 Ga0307515_10002741 3300028794 Bacteria 37704
237 Ga0265338_10001044 3300028800 Bacteria 46320
238 Ga0265338_10062022 3300028800 Bacteria 3272
239 Ga0307511_10001661 3300030521 Bacteria 23425
240 Ga0265332_10003899 3300031238 Bacteria 7116
241 Ga0265320_10000130 3300031240 Bacteria 65406
242 Ga0265325_10030176 3300031241 Bacteria 2909
243 Ga0265340_10027586 3300031247 Bacteria 2861
244 Ga0265339_10032022 3300031249 Bacteria 2968
245 Ga0265327_10007543 3300031251 Bacteria 8367
246 Ga0307513_10034866 3300031456 Bacteria 5639
247 Ga0307509_10000403 3300031507 Bacteria 72510
248 Ga0307508_10052444 3300031616 Bacteria 3622
249 Ga0307508_10065536 3300031616 Bacteria 3200
250 Ga0307514_10064088 3300031649 Bacteria 2788
251 Ga0265314_10009598 3300031711 Bacteria 8150
252 Ga0265342_10007811 3300031712 Bacteria 7774
253 Ga0307516_10012545 3300031730 Bacteria 9121
254 Ga0307516_10013517 3300031730 Bacteria 8686
255 Ga0307405_10013241 3300031731 Bacteria 4396
256 Ga0307406_10235762 3300031901 Bacteria 1369
257 Ga0307409_100093238 3300031995 Bacteria 2474
258 Ga0307409_100350143 3300031995 Bacteria 1393
259 Ga0307416_100159559 3300032002 Bacteria 2082
260 Ga0307411_10114783 3300032005 Bacteria 1936
261 Ga0307415_100049807 3300032126 Bacteria 2835
262 Ga0307415_100136133 3300032126 Bacteria 1868
263 Ga0307507_10121676 3300033179 Bacteria 2085
264 Ga0307510_10030634 3300033180 Bacteria 6096
265 Ga0307510_10126827 3300033180 Bacteria 2239
266 Ga0373949_0000112 3300035090 Bacteria 30333
267 Ga0373954_0000090 3300035118 Bacteria 31033
268 Ga0373962_0000297 3300035242 Bacteria 10707
269 Ga0373927_0014701 3300035695 Bacteria 5174
270 Ga0373937_0010803 3300036401 Bacteria 7993
271 Ga0395899_0001796 3300037312 Bacteria 17781
272 Ga0395900_0058638 3300037418 Bacteria 3963
273 Ga0395898_0013633 3300037466 Bacteria 8362
274 Ga0395898_0431675 3300037466 Bacteria 1255
275 Ga0395905_0005226 3300037471 Bacteria 13288
276 Ga0395905_0026083 3300037471 Bacteria 5511
277 Ga0395905_0263534 3300037471 Bacteria 1609
278 Ga0395905_0352474 3300037471 Bacteria 1364
279 Ga0436364_1070120 3300037853 Bacteria 4453
280 Ga0395901_0001705 3300038443 Bacteria 22698
281 Ga0395901_0056735 3300038443 Bacteria 4074
282 Ga0395901_0117792 3300038443 Bacteria 2791
283 Ga0395901_0442802 3300038443 Bacteria 1330
284 Ga0436365_0961376 3300039437 Bacteria 13290
285 Ga0436365_1394498 3300039437 Bacteria 1801
286 Ga0436363_1121410 3300039450 Bacteria 1326
287 Ga0439465_0001095 3300041413 Bacteria 8687
288 Ga0439448_0006681 3300042005 Bacteria 3324
289 Ga0439449_0005470 3300042007 Bacteria 4865
290 Ga0439455_0003241 3300042012 Bacteria 3082
291 Ga0450903_007080 3300042138 Bacteria 1852
292 Ga0439446_0023312 3300042156 Bacteria 1759
293 Ga0439434_0002344 3300042435 Bacteria 5510
294 Ga0439435_0008045 3300042436 Bacteria 2436
295 Ga0466969_0007850 3300044656 Bacteria 5669
296 Ga0466969_0019832 3300044656 Bacteria 3488
297 Ga0466969_0032599 3300044656 Bacteria 2648
298 Ga0466969_0048294 3300044656 Bacteria 2104
299 Ga0466972_0005725 3300044658 Bacteria 6228
300 Ga0466972_0030120 3300044658 Bacteria 2671
301 Ga0466972_0086010 3300044658 Bacteria 1494
302 Ga0466966_0004356 3300044684 Bacteria 9340
303 Ga0466966_0004653 3300044684 Bacteria 9039
304 Ga0466966_0009137 3300044684 Bacteria 6563
305 Ga0466961_0004861 3300044693 Bacteria 8454
306 Ga0466961_0005533 3300044693 Bacteria 7968
307 Ga0466961_0006498 3300044693 Bacteria 7429
308 Ga0466961_0039060 3300044693 Bacteria 3043
309 Ga0466963_0000506 3300044694 Bacteria 18181
310 Ga0466964_0009674 3300044706 Bacteria 3632
311 Ga0466964_0038081 3300044706 Bacteria 1933
312 Ga0466971_0004337 3300044719 Bacteria 6112
313 Ga0466971_0016724 3300044719 Bacteria 3239
314 Ga0466971_0146560 3300044719 Bacteria 1101
315 Ga0466970_0003950 3300044765 Bacteria 7267
316 Ga0466970_0049481 3300044765 Bacteria 2242
317 Ga0466957_0000304 3300044842 Bacteria 24157
318 Ga0466960_0019514 3300044901 Bacteria 2989
319 Ga0466959_0000325 3300045049 Bacteria 28137
320 Ga0466959_0004028 3300045049 Bacteria 9764
321 Ga0466959_0006706 3300045049 Bacteria 8009
322 Ga0451576_0026836 3300045051 Bacteria 6189
323 Ga0466958_0002417 3300045836 Bacteria 9356
324 Ga0466967_0005624 3300045976 Bacteria 8719
325 Ga0466967_0018260 3300045976 Bacteria 5599
326 Ga0466967_0085081 3300045976 Bacteria 2863
327 Ga0495592_0009563 3300046454 Bacteria 7294
328 Ga0495592_0022120 3300046454 Bacteria 4837
329 Ga0495603_0000270 3300046455 Bacteria 27500
330 Ga0495603_0009428 3300046455 Bacteria 5899
331 Ga0495603_0035175 3300046455 Bacteria 3009
332 Ga0495603_0038422 3300046455 Bacteria 2870
333 Ga0495629_0002755 3300046459 Bacteria 13438
334 Ga0495629_0036998 3300046459 Bacteria 3441
335 Ga0495651_0000482 3300046462 Bacteria 30750
336 Ga0495651_0004623 3300046462 Bacteria 10524
337 Ga0495651_0025202 3300046462 Bacteria 4628
338 Ga0495653_0057666 3300046463 Bacteria 2954
339 Ga0495580_0017726 3300046472 Bacteria 5316
340 Ga0495580_0048563 3300046472 Bacteria 3004
341 Ga0495605_0038488 3300046474 Bacteria 2399
342 Ga0495662_0006964 3300046476 Bacteria 5618
343 Ga0495664_0075510 3300046477 Bacteria 2016
344 Ga0495594_0004572 3300046499 Bacteria 7120
345 Ga0495596_0095996 3300046500 Bacteria 1151
346 Ga0495606_0028018 3300046507 Bacteria 3981
347 Ga0495608_0001470 3300046511 Bacteria 16742
348 Ga0495618_0095011 3300046514 Bacteria 1906
349 Ga0495628_0010756 3300046516 Bacteria 7749
350 Ga0495628_0015383 3300046516 Bacteria 6388
351 Ga0495630_0025338 3300046517 Bacteria 4384
352 Ga0495666_0023704 3300046526 Bacteria 3034
353 Ga0495652_0000680 3300046529 Bacteria 39383
354 Ga0495652_0021332 3300046529 Bacteria 5761
355 Ga0495640_0098953 3300046533 Bacteria 1916
356 Ga0495587_0026611 3300046536 Bacteria 3526
357 Ga0495645_0000732 3300046543 Bacteria 22436
358 Ga0495645_0028391 3300046543 Bacteria 4065
359 Ga0495622_0060492 3300046557 Bacteria 1754
360 Ga0495667_0008815 3300046559 Bacteria 6858
361 Ga0495667_0103725 3300046559 Bacteria 1839
362 Ga0495668_0002013 3300046616 Bacteria 17749
363 Ga0495634_0197243 3300046642 Bacteria 1252
364 Ga0495625_0004381 3300046660 Bacteria 13391
365 Ga0495625_0005251 3300046660 Bacteria 11905
366 Ga0495635_0005934 3300046663 Bacteria 8521
367 Ga0495657_0008253 3300046675 Bacteria 7979
368 Ga0495657_0022281 3300046675 Bacteria 4540
369 Ga0495657_0079696 3300046675 Bacteria 2120
370 Ga0495657_0182501 3300046675 Bacteria 1287
371 Ga0495599_0033315 3300046678 Bacteria 3237
372 Ga0495599_0104246 3300046678 Bacteria 1766
373 Ga0495623_0005832 3300046679 Bacteria 8033
374 Ga0495623_0048645 3300046679 Bacteria 2688
375 Ga0495646_0038855 3300046680 Bacteria 2936
376 Ga0495647_0059804 3300046681 Bacteria 1501
377 Ga0495613_0002772 3300046689 Bacteria 13156
378 Ga0495613_0003415 3300046689 Bacteria 11870
379 Ga0495649_0016265 3300046694 Bacteria 4218
380 Ga0495600_0010460 3300046809 Bacteria 5760
381 Ga0495600_0027889 3300046809 Bacteria 3651
382 Ga0495660_0118653 3300046810 Bacteria 1341
383 Ga0495581_0088215 3300047315 Bacteria 1799
384 Ga0495604_0004205 3300047317 Bacteria 11400
385 Ga0495604_0014856 3300047317 Bacteria 6209
386 Ga0495604_0186322 3300047317 Bacteria 1449
387 Ga0495674_0017927 3300047319 Bacteria 6592
388 Ga0495676_0005415 3300047321 Bacteria 11704
389 Ga0495676_0008990 3300047321 Bacteria 9118
390 Ga0495676_0042562 3300047321 Bacteria 3726
391 Ga0495675_0015811 3300047444 Bacteria 4773
392 Ga0495685_002371 3300047447 Bacteria 5899
393 Ga0495614_0000393 3300048089 Bacteria 17752
394 Ga0495614_0071451 3300048089 Bacteria 1496
395 Ga0495626_0000387 3300048091 Bacteria 45484
396 Ga0496102_0017786 3300048905 Bacteria 6233
397 Ga0496104_0000084 3300048907 Bacteria 90868
398 Ga0496104_0000304 3300048907 Bacteria 43780
399 Ga0496104_0022511 3300048907 Bacteria 5788
400 Ga0496105_0005361 3300048908 Bacteria 9722
401 Ga0496108_0003436 3300048911 Bacteria 12700
402 Ga0496108_0123897 3300048911 Bacteria 2218
403 Ga0496109_0013906 3300048912 Bacteria 6997
404 Ga0496110_0013175 3300048913 Bacteria 6827
405 Ga0496110_0182674 3300048913 Bacteria 1905
406 Ga0496111_0001068 3300048914 Bacteria 15097
407 Ga0496111_0218849 3300048914 Bacteria 1415
408 Ga0496112_0034267 3300048915 Bacteria 4940
409 Ga0496112_0043039 3300048915 Bacteria 4420
410 Ga0496112_0160250 3300048915 Bacteria 2216
411 Ga0496113_0048604 3300048916 Bacteria 3157
412 Ga0496114_0007675 3300048917 Bacteria 8530
413 Ga0496115_0017906 3300048918 Bacteria 5427
414 Ga0496115_0093866 3300048918 Bacteria 2454
415 Ga0496115_0183703 3300048918 Bacteria 1728
416 Ga0496117_0017949 3300048920 Bacteria 5890
417 Ga0496119_0012723 3300048922 Bacteria 6800
418 Ga0496120_0044349 3300048923 Bacteria 2584
419 Ga0496121_0000005 3300048924 Bacteria 1034486
420 Ga0496121_0073066 3300048924 Bacteria 2750
421 Ga0496122_0016734 3300048925 Bacteria 6911
422 Ga0496124_0000080 3300048927 Bacteria 210439
423 Ga0496124_0097604 3300048927 Bacteria 2385
424 Ga0496125_0000159 3300048928 Bacteria 151205
425 Ga0496126_0000085 3300048929 Bacteria 216528
426 Ga0501031_0010569 3300049568 Bacteria 6009
427 Ga0501031_0035337 3300049568 Bacteria 3260
428 Ga0501031_0045891 3300049568 Bacteria 2851
429 Ga0501032_0035741 3300049569 Bacteria 3395
430 Ga0501033_0249471 3300049570 Bacteria 1258
431 Ga0501034_0000386 3300049571 Bacteria 75350
432 Ga0501034_0030816 3300049571 Bacteria 5451
433 Ga0501034_0114120 3300049571 Bacteria 2690
434 Ga0501036_0038287 3300049572 Bacteria 4058
435 Ga0501036_0048374 3300049572 Bacteria 3600
436 Ga0501036_0141364 3300049572 Bacteria 2031
437 Ga0501037_0003818 3300049573 Bacteria 10929
438 Ga0501037_0013558 3300049573 Bacteria 6002
439 Ga0501037_0048521 3300049573 Bacteria 3111
440 Ga0501038_0000421 3300049574 Bacteria 36883
441 Ga0501038_0101198 3300049574 Bacteria 2399
442 Ga0501038_0163350 3300049574 Bacteria 1808
443 Ga0501038_0339582 3300049574 Bacteria 1171
444 Ga0501039_0161548 3300049575 Bacteria 1761
445 Ga0501039_0170397 3300049575 Bacteria 1712
446 Ga0501039_0201750 3300049575 Bacteria 1564
447 Ga0501042_0019379 3300049578 Bacteria 4723
448 Ga0501043_0005286 3300049579 Bacteria 10439
449 Ga0501043_0066207 3300049579 Bacteria 2837
450 Ga0501043_0066217 3300049579 Bacteria 2837
451 Ga0501043_0211314 3300049579 Bacteria 1504
452 Ga0501046_0009034 3300049580 Bacteria 8640
453 Ga0501047_0001674 3300049581 Bacteria 21567
454 Ga0501047_0038183 3300049581 Bacteria 4645
455 Ga0501047_0064604 3300049581 Bacteria 3530
456 Ga0501048_0082447 3300049582 Bacteria 2268
457 Ga0501069_0009534 3300049585 Bacteria 5124
458 Ga0501070_0000487 3300049586 Bacteria 36109
459 Ga0501071_0007783 3300049587 Bacteria 7066
460 Ga0501071_0108510 3300049587 Bacteria 2050
461 Ga0501072_0068675 3300049588 Bacteria 2797
462 Ga0501073_0049226 3300049589 Bacteria 2956
463 Ga0501075_0193215 3300049591 Bacteria 1552
464 Ga0501076_0024157 3300049592 Bacteria 4694
465 Ga0501076_0112224 3300049592 Bacteria 2204
466 Ga0501243_000820 3300049675 Bacteria 4319
467 Ga0501079_0030094 3300049741 Bacteria 4172
468 Ga0501080_0004877 3300049742 Bacteria 11954
469 Ga0501081_0207026 3300049743 Bacteria 1424
470 Ga0501035_0003514 3300049822 Bacteria 14982
471 Ga0501035_0008042 3300049822 Bacteria 9829
472 Ga0501035_0056722 3300049822 Bacteria 3494
473 Ga0501035_0091231 3300049822 Bacteria 2681
474 Ga0501044_0009499 3300049823 Bacteria 10591
475 Ga0501044_0013416 3300049823 Bacteria 8860
476 Ga0501044_0019873 3300049823 Bacteria 7174
477 Ga0501044_0236618 3300049823 Bacteria 1771
478 nmdc:mga05p37_334797_c1 3300050507 Bacteria 1787
479 nmdc:mga09592_62245_c1 3300050508 Bacteria 3157
480 nmdc:mga0qj67_66485_c1 3300050509 Bacteria 2871
481 nmdc:mga06r32_16702_c1 3300050510 Bacteria 6690
482 nmdc:mga08y16_110010_c1 3300050511 Bacteria 2869
483 nmdc:mga08y16_182422_c1 3300050511 Bacteria 2179
484 nmdc:mga0n895_199556_c1 3300050512 Bacteria 2032
485 nmdc:mga0n895_285914_c1 3300050512 Bacteria 1672
486 nmdc:mga0a205_224571_c1 3300050515 Bacteria 1763
487 Ga0495601_0006969 3300053077 Bacteria 6618
488 Ga0495601_0152440 3300053077 Bacteria 1509
489 Ga0495612_0007964 3300053078 Bacteria 4319
490 Ga0495612_0062948 3300053078 Bacteria 1538
491 Ga0495619_0012030 3300053085 Bacteria 5452
492 Ga0495619_0212025 3300053085 Bacteria 1341
493 Ga0500560_000204 3300053107 Bacteria 7053
494 Ga0500572_001954 3300053111 Bacteria 5169
495 Ga0500618_001007 3300053125 Bacteria 14209
496 Ga0500642_0078349 3300053130 Bacteria 1514
497 Ga0500568_0005827 3300053139 Bacteria 6283
498 Ga0500573_0022513 3300053140 Bacteria 3616
499 Ga0500573_0147218 3300053140 Bacteria 1292
500 Ga0500577_0008410 3300053142 Bacteria 2942
501 Ga0500590_001916 3300053148 Bacteria 8896
502 Ga0500616_0007928 3300053153 Bacteria 6672
503 Ga0500634_0003279 3300053161 Bacteria 7149
504 Ga0500636_0000011 3300053177 Bacteria 140769
505 Ga0500636_0000283 3300053177 Bacteria 28087
506 Ga0500637_0100249 3300053178 Bacteria 1680
507 Ga0501084_0037736 3300054114 Bacteria 4038
508 Ga0501084_0043877 3300054114 Bacteria 3741
509 Ga0501082_0028825 3300060353 Bacteria 4783
510 Ga0466962_0000167 3300061719 Bacteria 28033
511 Ga0530510_0009799 3300061734 Bacteria 6723

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10047944 Ga0081455_100479443 309
2 3300044719 Ga0466971_0146560 Ga0466971_0146560_18_1028 333
3 3300037466 Ga0395898_0431675 Ga0395898_0431675_174_1238 338
4 3300049579 Ga0501043_0066207 Ga0501043_0066207_36_1079 338
5 3300009551 Ga0105238_10015806 Ga0105238_100158064 339
6 3300026121 Ga0207683_10450279 Ga0207683_104502791 346
7 3300046500 Ga0495596_0095996 Ga0495596_0095996_70_1140 346
8 3300047317 Ga0495604_0186322 Ga0495604_0186322_21_1097 346
9 3300035118 Ga0373954_0000090 Ga0373954_0000090_25835_26977 351
10 3300049568 Ga0501031_0035337 Ga0501031_0035337_1557_2633 358
11 3300049568 Ga0501031_0045891 Ga0501031_0045891_1517_2593 358
12 3300049570 Ga0501033_0249471 Ga0501033_0249471_52_1128 358
13 3300049572 Ga0501036_0141364 Ga0501036_0141364_352_1428 358
14 3300049574 Ga0501038_0339582 Ga0501038_0339582_54_1130 358
15 3300049575 Ga0501039_0161548 Ga0501039_0161548_316_1392 358
16 3300049575 Ga0501039_0201750 Ga0501039_0201750_285_1361 358
17 3300049578 Ga0501042_0019379 Ga0501042_0019379_2589_3665 358
18 3300049587 Ga0501071_0007783 Ga0501071_0007783_3202_4278 358
19 3300049587 Ga0501071_0108510 Ga0501071_0108510_511_1587 358
20 3300049588 Ga0501072_0068675 Ga0501072_0068675_463_1539 358
21 3300049591 Ga0501075_0193215 Ga0501075_0193215_297_1373 358
22 3300049592 Ga0501076_0024157 Ga0501076_0024157_2426_3502 358
23 3300049741 Ga0501079_0030094 Ga0501079_0030094_2524_3600 358
24 3300049743 Ga0501081_0207026 Ga0501081_0207026_177_1253 358
25 3300054114 Ga0501084_0037736 Ga0501084_0037736_2798_3874 358
26 3300054114 Ga0501084_0043877 Ga0501084_0043877_878_1954 358
27 3300060353 Ga0501082_0028825 Ga0501082_0028825_2170_3246 358
28 3300061734 Ga0530510_0009799 Ga0530510_0009799_3818_4894 358
29 3300046455 Ga0495603_0009428 Ga0495603_0009428_3402_4553 361
30 3300006844 Ga0075428_100032142 Ga0075428_1000321423 363
31 3300025923 Ga0207681_10042369 Ga0207681_100423691 363
32 3300005341 Ga0070691_10006836 Ga0070691_100068362 364
33 3300005530 Ga0070679_100021162 Ga0070679_1000211624 364
34 3300025921 Ga0207652_10095879 Ga0207652_100958791 364
35 3300025909 Ga0207705_10009902 Ga0207705_100099026 366
36 3300046642 Ga0495634_0197243 Ga0495634_0197243_134_1237 366
37 3300049675 Ga0501243_000820 Ga0501243_000820_684_1832 366
38 3300044656 Ga0466969_0048294 Ga0466969_0048294_559_1662 367
39 3300044684 Ga0466966_0004653 Ga0466966_0004653_4808_5911 367
40 3300045049 Ga0466959_0006706 Ga0466959_0006706_4884_5987 367
41 3300053130 Ga0500642_0078349 Ga0500642_0078349_377_1498 367
42 3300005367 Ga0070667_100316451 Ga0070667_1003164511 368
43 3300006844 Ga0075428_100256468 Ga0075428_1002564682 368
44 3300006871 Ga0075434_100095835 Ga0075434_1000958352 368
45 3300006881 Ga0068865_100263345 Ga0068865_1002633452 368
46 3300005333 Ga0070677_10045907 Ga0070677_100459071 371
47 3300026075 Ga0207708_10212000 Ga0207708_102120002 371
48 3300046474 Ga0495605_0038488 Ga0495605_0038488_54_1211 371
49 3300050515 nmdc:mga0a205_224571_c1 nmdc:mga0a205_224571_c1_434_1600 372
50 3300035242 Ga0373962_0000297 Ga0373962_0000297_3651_4817 373
51 3300046455 Ga0495603_0038422 Ga0495603_0038422_395_1552 373
52 3300047321 Ga0495676_0042562 Ga0495676_0042562_2556_3713 373
53 3300047447 Ga0495685_002371 Ga0495685_002371_4214_5371 373
54 3300005339 Ga0070660_100061557 Ga0070660_1000615571 374
55 3300005347 Ga0070668_100021164 Ga0070668_1000211645 374
56 3300005434 Ga0070709_10092569 Ga0070709_100925692 374
57 3300005458 Ga0070681_10106805 Ga0070681_101068052 374
58 3300005459 Ga0068867_100067035 Ga0068867_1000670352 374
59 3300005834 Ga0068851_10019024 Ga0068851_100190242 374
60 3300010375 Ga0105239_10338411 Ga0105239_103384112 374
61 3300025321 Ga0207656_10050037 Ga0207656_100500371 374
62 3300025909 Ga0207705_10009948 Ga0207705_100099484 374
63 3300025909 Ga0207705_10129915 Ga0207705_101299152 374
64 3300025912 Ga0207707_10187349 Ga0207707_101873492 374
65 3300025927 Ga0207687_10032836 Ga0207687_100328362 374
66 3300031249 Ga0265339_10032022 Ga0265339_100320222 374
67 3300031730 Ga0307516_10013517 Ga0307516_100135174 374
68 3300037466 Ga0395898_0013633 Ga0395898_0013633_6867_7991 374
69 3300038443 Ga0395901_0056735 Ga0395901_0056735_1119_2243 374
70 3300044656 Ga0466969_0007850 Ga0466969_0007850_3741_4865 374
71 3300044656 Ga0466969_0032599 Ga0466969_0032599_596_1720 374
72 3300048913 Ga0496110_0182674 Ga0496110_0182674_716_1840 374
73 3300048915 Ga0496112_0160250 Ga0496112_0160250_248_1396 374
74 3300053078 Ga0495612_0062948 Ga0495612_0062948_12_1151 374
75 3300031456 Ga0307513_10034866 Ga0307513_100348664 375
76 3300039450 Ga0436363_1121410 Ga0436363_1121410_19_1149 375
77 3300005471 Ga0070698_100145958 Ga0070698_1001459582 376
78 3300042005 Ga0439448_0006681 Ga0439448_0006681_934_2064 376
79 3300042012 Ga0439455_0003241 Ga0439455_0003241_490_1620 376
80 3300046810 Ga0495660_0118653 Ga0495660_0118653_29_1162 376
81 iso_pu_bacteria 2929138655 2929142962 376
82 iso_pu_bacteria 8003314358 8003316221 376
83 iso_pu_bacteria 8054460903 8054464678 376
84 iso_pu_bacteria 2675903060 2676490778 377
85 iso_pu_bacteria 2887478801 2887480714 377
86 iso_pu_bacteria 2894817345 2894818907 377
87 iso_pu_bacteria 8001781756 8001786170 377
88 iso_pu_bacteria 2558860112 2558912229 378
89 3300007076 Ga0075435_100073666 Ga0075435_1000736662 379
90 3300009094 Ga0111539_10023670 Ga0111539_100236706 379
91 iso_pu_bacteria 2554235005 2554258475 379
92 iso_pu_bacteria 2558860112 2558908979 379
93 iso_pu_bacteria 2643221587 2643942925 379
94 iso_pu_bacteria 2643221587 2643944552 379
95 iso_pu_bacteria 2643221601 2644013945 379
96 iso_pu_bacteria 2643221601 2644017768 379
97 iso_pu_bacteria 2643221631 2644174494 379
98 iso_pu_bacteria 2643221631 2644178916 379
99 iso_pu_bacteria 2643221670 2644385518 379
100 iso_pu_bacteria 2643221677 2644430384 379
101 iso_pu_bacteria 2643221677 2644431450 379
102 iso_pu_bacteria 2643221678 2644436542 379
103 iso_pu_bacteria 2751185782 2753263753 379
104 iso_pu_bacteria 2784132148 2784587999 379
105 iso_pu_bacteria 2808606359 2808841434 379
106 iso_pu_bacteria 2808606982 2811848387 379
107 iso_pu_bacteria 2811994917 2812481104 379
108 iso_pu_bacteria 2818991472 2819745872 379
109 iso_pu_bacteria 2862290372 2862296623 379
110 iso_pu_bacteria 2862507626 2862512971 379
111 iso_pu_bacteria 2873151551 2873156450 379
112 iso_pu_bacteria 2884215851 2884217127 379
113 iso_pu_bacteria 2888578766 2888583815 379
114 iso_pu_bacteria 2889049205 2889055590 379
115 iso_pu_bacteria 2912715099 2912720729 379
116 iso_pu_bacteria 2918501144 2918503952 379
117 iso_pu_bacteria 2919468124 2919473557 379
118 iso_pu_bacteria 2990088156 2990093085 379
119 iso_pu_bacteria 3006493962 3006501500 379
120 iso_pu_bacteria 8023623736 8023631011 379
121 iso_pu_bacteria 8048406513 8048413367 379
122 iso_pu_bacteria 8056533031 8056538240 379
123 iso_pu_bacteria 8056667051 8056672416 379
124 iso_pu_bacteria 8056829672 8056830199 379
125 3300026067 Ga0207678_10000523 Ga0207678_1000052324 380
126 3300033180 Ga0307510_10126827 Ga0307510_101268272 380
127 3300044658 Ga0466972_0005725 Ga0466972_0005725_3775_4917 380
128 3300044765 Ga0466970_0049481 Ga0466970_0049481_564_1706 380
129 3300046459 Ga0495629_0036998 Ga0495629_0036998_1345_2490 380
130 3300046557 Ga0495622_0060492 Ga0495622_0060492_154_1299 380
131 3300046675 Ga0495657_0079696 Ga0495657_0079696_913_2058 380
132 3300048920 Ga0496117_0017949 Ga0496117_0017949_2393_3550 380
133 3300048922 Ga0496119_0012723 Ga0496119_0012723_1449_2606 380
134 3300048923 Ga0496120_0044349 Ga0496120_0044349_857_2014 380
135 3300048924 Ga0496121_0000005 Ga0496121_0000005_913866_915023 380
136 3300048924 Ga0496121_0073066 Ga0496121_0073066_1239_2396 380
137 3300048925 Ga0496122_0016734 Ga0496122_0016734_1909_3051 380
138 3300048927 Ga0496124_0000080 Ga0496124_0000080_110433_111575 380
139 3300048927 Ga0496124_0097604 Ga0496124_0097604_1202_2359 380
140 3300048928 Ga0496125_0000159 Ga0496125_0000159_37963_39120 380
141 3300050511 nmdc:mga08y16_182422_c1 nmdc:mga08y16_182422_c1_730_1890 380
142 3300053077 Ga0495601_0152440 Ga0495601_0152440_92_1237 380
143 3300053111 Ga0500572_001954 Ga0500572_001954_3751_4893 380
144 3300053125 Ga0500618_001007 Ga0500618_001007_3831_4973 380
145 3300053140 Ga0500573_0022513 Ga0500573_0022513_801_1946 380
146 3300053148 Ga0500590_001916 Ga0500590_001916_3685_4830 380
147 3300053161 Ga0500634_0003279 Ga0500634_0003279_5274_6416 380
148 3300053177 Ga0500636_0000011 Ga0500636_0000011_132991_134133 380
149 3300053177 Ga0500636_0000283 Ga0500636_0000283_25470_26612 380
150 3300005543 Ga0070672_100138598 Ga0070672_1001385981 381
151 3300005548 Ga0070665_100000204 Ga0070665_10000020440 381
152 3300005937 Ga0081455_10008019 Ga0081455_100080193 381
153 3300006353 Ga0075370_10066998 Ga0075370_100669982 381
154 3300006844 Ga0075428_100212173 Ga0075428_1002121732 381
155 3300006846 Ga0075430_100013280 Ga0075430_1000132808 381
156 3300006847 Ga0075431_100015347 Ga0075431_1000153474 381
157 3300006847 Ga0075431_100114206 Ga0075431_1001142062 381
158 3300006880 Ga0075429_100003160 Ga0075429_10000316015 381
159 3300009098 Ga0105245_10270456 Ga0105245_102704561 381
160 3300009147 Ga0114129_10001926 Ga0114129_1000192614 381
161 3300009147 Ga0114129_10029362 Ga0114129_100293629 381
162 3300013307 Ga0157372_10405462 Ga0157372_104054622 381
163 3300025918 Ga0207662_10145707 Ga0207662_101457072 381
164 3300028379 Ga0268266_10000475 Ga0268266_1000047525 381
165 3300031251 Ga0265327_10007543 Ga0265327_100075432 381
166 3300037312 Ga0395899_0001796 Ga0395899_0001796_6499_7692 381
167 3300037418 Ga0395900_0058638 Ga0395900_0058638_2183_3376 381
168 3300037471 Ga0395905_0005226 Ga0395905_0005226_5583_6749 381
169 3300037471 Ga0395905_0026083 Ga0395905_0026083_2265_3458 381
170 3300037471 Ga0395905_0263534 Ga0395905_0263534_323_1492 381
171 3300037471 Ga0395905_0352474 Ga0395905_0352474_21_1190 381
172 3300038443 Ga0395901_0001705 Ga0395901_0001705_20243_21436 381
173 3300044706 Ga0466964_0038081 Ga0466964_0038081_208_1365 381
174 3300045976 Ga0466967_0005624 Ga0466967_0005624_6543_7700 381
175 3300046507 Ga0495606_0028018 Ga0495606_0028018_2590_3735 381
176 3300046616 Ga0495668_0002013 Ga0495668_0002013_2603_3748 381
177 3300046660 Ga0495625_0004381 Ga0495625_0004381_2548_3693 381
178 3300046681 Ga0495647_0059804 Ga0495647_0059804_12_1157 381
179 3300048091 Ga0495626_0000387 Ga0495626_0000387_41822_42967 381
180 3300048915 Ga0496112_0034267 Ga0496112_0034267_661_1818 381
181 3300049742 Ga0501080_0004877 Ga0501080_0004877_9878_11032 381
182 3300053139 Ga0500568_0005827 Ga0500568_0005827_1723_2877 381
183 3300053153 Ga0500616_0007928 Ga0500616_0007928_1915_3069 381
184 iso_pu_bacteria 2643221714 2644625612 381
185 iso_pu_bacteria 2786546132 2786669867 381
186 iso_pu_bacteria 2862574272 2862579848 381
187 iso_pu_bacteria 2867369537 2867371293 381
188 iso_pu_bacteria 2867428634 2867435966 381
189 iso_pu_bacteria 2946072368 2946075363 381
190 iso_pu_bacteria 2954673503 2954676296 381
191 iso_pu_bacteria 2954682443 2954687873 381
192 iso_pu_bacteria 2954711539 2954716848 381
193 iso_pu_bacteria 2954721474 2954726796 381
194 iso_pu_bacteria 2954731030 2954734999 381
195 iso_pu_bacteria 2954740390 2954745719 381
196 iso_pu_bacteria 2954749733 2954753871 381
197 iso_pu_bacteria 2954759201 2954764693 381
198 iso_pu_bacteria 3002998708 3002999970 381
199 3300005327 Ga0070658_10120292 Ga0070658_101202922 382
200 3300005328 Ga0070676_10001373 Ga0070676_100013733 382
201 3300005328 Ga0070676_10002091 Ga0070676_100020916 382
202 3300005328 Ga0070676_10033478 Ga0070676_100334782 382
203 3300005329 Ga0070683_100039836 Ga0070683_1000398363 382
204 3300005329 Ga0070683_100055663 Ga0070683_1000556632 382
205 3300005331 Ga0070670_100002131 Ga0070670_1000021316 382
206 3300005331 Ga0070670_100172402 Ga0070670_1001724022 382
207 3300005335 Ga0070666_10004120 Ga0070666_100041202 382
208 3300005338 Ga0068868_100012473 Ga0068868_1000124733 382
209 3300005339 Ga0070660_100025774 Ga0070660_1000257744 382
210 3300005344 Ga0070661_100146358 Ga0070661_1001463582 382
211 3300005347 Ga0070668_100004745 Ga0070668_1000047455 382
212 3300005354 Ga0070675_100003182 Ga0070675_1000031829 382
213 3300005355 Ga0070671_100003465 Ga0070671_1000034657 382
214 3300005356 Ga0070674_100008362 Ga0070674_1000083622 382
215 3300005364 Ga0070673_100003135 Ga0070673_1000031354 382
216 3300005434 Ga0070709_10007846 Ga0070709_100078464 382
217 3300005435 Ga0070714_100048184 Ga0070714_1000481842 382
218 3300005437 Ga0070710_10006157 Ga0070710_100061577 382
219 3300005439 Ga0070711_100023906 Ga0070711_1000239062 382
220 3300005441 Ga0070700_100037877 Ga0070700_1000378771 382
221 3300005455 Ga0070663_100010425 Ga0070663_1000104253 382
222 3300005455 Ga0070663_100022037 Ga0070663_1000220375 382
223 3300005459 Ga0068867_100003568 Ga0068867_1000035689 382
224 3300005518 Ga0070699_100008755 Ga0070699_1000087556 382
225 3300005530 Ga0070679_100009371 Ga0070679_1000093717 382
226 3300005535 Ga0070684_100214798 Ga0070684_1002147982 382
227 3300005543 Ga0070672_100015179 Ga0070672_1000151793 382
228 3300005548 Ga0070665_100004380 Ga0070665_10000438010 382
229 3300005577 Ga0068857_100009005 Ga0068857_1000090055 382
230 3300005616 Ga0068852_100003935 Ga0068852_1000039355 382
231 3300005719 Ga0068861_100002273 Ga0068861_1000022734 382
232 3300005834 Ga0068851_10000749 Ga0068851_100007495 382
233 3300005841 Ga0068863_100012995 Ga0068863_1000129958 382
234 3300005843 Ga0068860_100021822 Ga0068860_1000218225 382
235 3300005985 Ga0081539_10001070 Ga0081539_1000107034 382
236 3300009093 Ga0105240_10001673 Ga0105240_1000167337 382
237 3300009093 Ga0105240_10063734 Ga0105240_100637342 382
238 3300009093 Ga0105240_10125892 Ga0105240_101258924 382
239 3300009174 Ga0105241_10049319 Ga0105241_100493192 382
240 3300009545 Ga0105237_10114640 Ga0105237_101146402 382
241 3300009551 Ga0105238_10048034 Ga0105238_100480344 382
242 3300009553 Ga0105249_10061024 Ga0105249_100610244 382
243 3300013104 Ga0157370_10095233 Ga0157370_100952332 382
244 3300013104 Ga0157370_10289729 Ga0157370_102897292 382
245 3300013307 Ga0157372_10120473 Ga0157372_101204732 382
246 3300013308 Ga0157375_10003512 Ga0157375_100035126 382
247 3300014325 Ga0163163_10101808 Ga0163163_101018082 382
248 3300014325 Ga0163163_10200074 Ga0163163_102000742 382
249 3300017792 Ga0163161_10128810 Ga0163161_101288102 382
250 3300025893 Ga0207682_10001577 Ga0207682_100015772 382
251 3300025898 Ga0207692_10035126 Ga0207692_100351261 382
252 3300025906 Ga0207699_10047663 Ga0207699_100476632 382
253 3300025909 Ga0207705_10001995 Ga0207705_100019955 382
254 3300025913 Ga0207695_10393437 Ga0207695_103934371 382
255 3300025914 Ga0207671_10108826 Ga0207671_101088262 382
256 3300025919 Ga0207657_10035164 Ga0207657_100351644 382
257 3300025920 Ga0207649_10096825 Ga0207649_100968252 382
258 3300025921 Ga0207652_10004503 Ga0207652_100045037 382
259 3300025923 Ga0207681_10020937 Ga0207681_100209373 382
260 3300025929 Ga0207664_10046789 Ga0207664_100467893 382
261 3300025931 Ga0207644_10005243 Ga0207644_100052432 382
262 3300025938 Ga0207704_10071369 Ga0207704_100713692 382
263 3300025940 Ga0207691_10001445 Ga0207691_1000144512 382
264 3300025960 Ga0207651_10026090 Ga0207651_100260902 382
265 3300025961 Ga0207712_10080674 Ga0207712_100806742 382
266 3300025972 Ga0207668_10041511 Ga0207668_100415113 382
267 3300025986 Ga0207658_10024913 Ga0207658_100249132 382
268 3300026041 Ga0207639_10010336 Ga0207639_100103365 382
269 3300026067 Ga0207678_10006690 Ga0207678_100066902 382
270 3300026067 Ga0207678_10036630 Ga0207678_100366304 382
271 3300026075 Ga0207708_10072776 Ga0207708_100727763 382
272 3300026088 Ga0207641_10425955 Ga0207641_104259551 382
273 3300026089 Ga0207648_10005115 Ga0207648_100051155 382
274 3300026116 Ga0207674_10007107 Ga0207674_100071074 382
275 3300026116 Ga0207674_10092027 Ga0207674_100920272 382
276 3300026118 Ga0207675_100128387 Ga0207675_1001283872 382
277 3300026121 Ga0207683_10000005 Ga0207683_100000056 382
278 3300027364 Ga0209967_1004815 Ga0209967_10048152 382
279 3300028379 Ga0268266_10035506 Ga0268266_100355063 382
280 3300042156 Ga0439446_0023312 Ga0439446_0023312_247_1407 382
281 3300042435 Ga0439434_0002344 Ga0439434_0002344_524_1684 382
282 3300042436 Ga0439435_0008045 Ga0439435_0008045_137_1297 382
283 3300045976 Ga0466967_0085081 Ga0466967_0085081_413_1561 382
284 3300046680 Ga0495646_0038855 Ga0495646_0038855_1314_2477 382
285 3300048907 Ga0496104_0022511 Ga0496104_0022511_1830_2981 382
286 3300048914 Ga0496111_0218849 Ga0496111_0218849_37_1221 382
287 3300049571 Ga0501034_0000386 Ga0501034_0000386_13828_14988 382
288 3300049573 Ga0501037_0003818 Ga0501037_0003818_567_1727 382
289 3300049574 Ga0501038_0000421 Ga0501038_0000421_7107_8267 382
290 3300049574 Ga0501038_0163350 Ga0501038_0163350_289_1464 382
291 3300049575 Ga0501039_0170397 Ga0501039_0170397_517_1677 382
292 3300049579 Ga0501043_0066217 Ga0501043_0066217_632_1792 382
293 3300049581 Ga0501047_0001674 Ga0501047_0001674_141_1316 382
294 3300049581 Ga0501047_0038183 Ga0501047_0038183_3421_4578 382
295 3300049581 Ga0501047_0064604 Ga0501047_0064604_456_1616 382
296 3300049585 Ga0501069_0009534 Ga0501069_0009534_895_2070 382
297 3300049586 Ga0501070_0000487 Ga0501070_0000487_30785_31960 382
298 3300049589 Ga0501073_0049226 Ga0501073_0049226_112_1287 382
299 3300049592 Ga0501076_0112224 Ga0501076_0112224_936_2096 382
300 3300049822 Ga0501035_0003514 Ga0501035_0003514_6428_7585 382
301 3300049822 Ga0501035_0008042 Ga0501035_0008042_4457_5632 382
302 3300049823 Ga0501044_0009499 Ga0501044_0009499_2009_3166 382
303 3300049823 Ga0501044_0013416 Ga0501044_0013416_6671_7846 382
304 3300050509 nmdc:mga0qj67_66485_c1 nmdc:mga0qj67_66485_c1_394_1545 382
305 3300050511 nmdc:mga08y16_110010_c1 nmdc:mga08y16_110010_c1_835_1995 382
306 3300053142 Ga0500577_0008410 Ga0500577_0008410_626_1774 382
307 iso_pu_bacteria 2767802112 2768646969 382
308 iso_pu_bacteria 2866612099 2866615468 382
309 iso_pu_bacteria 2867346516 2867349290 382
310 3300003578 Ga0006562J51391_1027448 Ga0006562J51391_10274484 383
311 3300003578 Ga0006562J51391_1027450 Ga0006562J51391_10274505 383
312 3300005290 Ga0065712_10131502 Ga0065712_101315022 383
313 3300005327 Ga0070658_10000837 Ga0070658_1000083725 383
314 3300005327 Ga0070658_10006445 Ga0070658_100064456 383
315 3300005327 Ga0070658_10032845 Ga0070658_100328452 383
316 3300005329 Ga0070683_100090591 Ga0070683_1000905911 383
317 3300005334 Ga0068869_100143892 Ga0068869_1001438922 383
318 3300005339 Ga0070660_100021866 Ga0070660_1000218665 383
319 3300005344 Ga0070661_100141629 Ga0070661_1001416291 383
320 3300005355 Ga0070671_100077306 Ga0070671_1000773062 383
321 3300005366 Ga0070659_100025886 Ga0070659_1000258864 383
322 3300005445 Ga0070708_100000065 Ga0070708_10000006559 383
323 3300005455 Ga0070663_100002740 Ga0070663_1000027406 383
324 3300005455 Ga0070663_100008508 Ga0070663_1000085083 383
325 3300005458 Ga0070681_10159132 Ga0070681_101591322 383
326 3300005468 Ga0070707_100039203 Ga0070707_1000392034 383
327 3300005530 Ga0070679_100000354 Ga0070679_1000003544 383
328 3300005535 Ga0070684_100135835 Ga0070684_1001358351 383
329 3300005535 Ga0070684_100189803 Ga0070684_1001898032 383
330 3300005539 Ga0068853_100005015 Ga0068853_1000050156 383
331 3300005539 Ga0068853_100017623 Ga0068853_1000176234 383
332 3300005539 Ga0068853_100246157 Ga0068853_1002461571 383
333 3300005543 Ga0070672_100060451 Ga0070672_1000604513 383
334 3300005563 Ga0068855_100001455 Ga0068855_10000145511 383
335 3300005563 Ga0068855_100049744 Ga0068855_1000497444 383
336 3300005564 Ga0070664_100086240 Ga0070664_1000862402 383
337 3300005614 Ga0068856_100134051 Ga0068856_1001340512 383
338 3300005617 Ga0068859_100186956 Ga0068859_1001869562 383
339 3300005842 Ga0068858_100086025 Ga0068858_1000860252 383
340 3300005983 Ga0081540_1027095 Ga0081540_10270954 383
341 3300006028 Ga0070717_10136867 Ga0070717_101368672 383
342 3300006871 Ga0075434_100075672 Ga0075434_1000756723 383
343 3300006880 Ga0075429_100000402 Ga0075429_1000004024 383
344 3300006881 Ga0068865_100078854 Ga0068865_1000788542 383
345 3300006931 Ga0097620_100186948 Ga0097620_1001869482 383
346 3300009093 Ga0105240_10010403 Ga0105240_100104033 383
347 3300009093 Ga0105240_10060886 Ga0105240_100608862 383
348 3300009147 Ga0114129_10029903 Ga0114129_100299034 383
349 3300009177 Ga0105248_10124423 Ga0105248_101244232 383
350 3300009177 Ga0105248_10308780 Ga0105248_103087802 383
351 3300009551 Ga0105238_10016367 Ga0105238_100163673 383
352 3300009551 Ga0105238_10445834 Ga0105238_104458341 383
353 3300010375 Ga0105239_10486185 Ga0105239_104861851 383
354 3300011119 Ga0105246_10083451 Ga0105246_100834512 383
355 3300013100 Ga0157373_10128977 Ga0157373_101289772 383
356 3300013104 Ga0157370_10001669 Ga0157370_100016699 383
357 3300013105 Ga0157369_10099980 Ga0157369_100999803 383
358 3300013296 Ga0157374_10047770 Ga0157374_100477702 383
359 3300013307 Ga0157372_10122566 Ga0157372_101225662 383
360 3300013307 Ga0157372_10174719 Ga0157372_101747192 383
361 3300014969 Ga0157376_10247514 Ga0157376_102475142 383
362 3300021384 Ga0213876_10034090 Ga0213876_100340902 383
363 3300025302 Ga0207426_1001238 Ga0207426_100123810 383
364 3300025302 Ga0207426_1003918 Ga0207426_10039182 383
365 3300025315 Ga0207697_10062524 Ga0207697_100625242 383
366 3300025893 Ga0207682_10010885 Ga0207682_100108853 383
367 3300025904 Ga0207647_10010093 Ga0207647_100100934 383
368 3300025905 Ga0207685_10040725 Ga0207685_100407251 383
369 3300025907 Ga0207645_10041189 Ga0207645_100411892 383
370 3300025908 Ga0207643_10002947 Ga0207643_100029475 383
371 3300025909 Ga0207705_10078283 Ga0207705_100782831 383
372 3300025909 Ga0207705_10103367 Ga0207705_101033672 383
373 3300025913 Ga0207695_10006092 Ga0207695_100060925 383
374 3300025913 Ga0207695_10072759 Ga0207695_100727592 383
375 3300025918 Ga0207662_10007297 Ga0207662_100072972 383
376 3300025919 Ga0207657_10019568 Ga0207657_100195684 383
377 3300025921 Ga0207652_10000964 Ga0207652_100009643 383
378 3300025924 Ga0207694_10213221 Ga0207694_102132212 383
379 3300025926 Ga0207659_10072839 Ga0207659_100728392 383
380 3300025929 Ga0207664_10176570 Ga0207664_101765702 383
381 3300025931 Ga0207644_10185878 Ga0207644_101858782 383
382 3300025932 Ga0207690_10118545 Ga0207690_101185452 383
383 3300025937 Ga0207669_10244596 Ga0207669_102445962 383
384 3300025940 Ga0207691_10040127 Ga0207691_100401272 383
385 3300025941 Ga0207711_10310787 Ga0207711_103107871 383
386 3300025945 Ga0207679_10053486 Ga0207679_100534862 383
387 3300025949 Ga0207667_10003334 Ga0207667_100033346 383
388 3300025949 Ga0207667_10038455 Ga0207667_100384553 383
389 3300025972 Ga0207668_10102500 Ga0207668_101025001 383
390 3300026035 Ga0207703_10160743 Ga0207703_101607432 383
391 3300026067 Ga0207678_10000702 Ga0207678_1000070212 383
392 3300026067 Ga0207678_10008308 Ga0207678_100083084 383
393 3300026067 Ga0207678_10197338 Ga0207678_101973382 383
394 3300026089 Ga0207648_10106447 Ga0207648_101064472 383
395 3300026095 Ga0207676_10082429 Ga0207676_100824292 383
396 3300026116 Ga0207674_10007750 Ga0207674_100077508 383
397 3300027312 Ga0209371_1017176 Ga0209371_10171762 383
398 3300028558 Ga0265326_10001407 Ga0265326_100014072 383
399 3300028563 Ga0265319_1046943 Ga0265319_10469432 383
400 3300028573 Ga0265334_10002258 Ga0265334_100022582 383
401 3300028653 Ga0265323_10000925 Ga0265323_100009252 383
402 3300028666 Ga0265336_10043776 Ga0265336_100437762 383
403 3300028794 Ga0307515_10002741 Ga0307515_1000274111 383
404 3300028800 Ga0265338_10001044 Ga0265338_1000104429 383
405 3300028800 Ga0265338_10062022 Ga0265338_100620222 383
406 3300030521 Ga0307511_10001661 Ga0307511_1000166111 383
407 3300031238 Ga0265332_10003899 Ga0265332_100038995 383
408 3300031241 Ga0265325_10030176 Ga0265325_100301762 383
409 3300031247 Ga0265340_10027586 Ga0265340_100275862 383
410 3300031507 Ga0307509_10000403 Ga0307509_1000040333 383
411 3300031616 Ga0307508_10065536 Ga0307508_100655362 383
412 3300031711 Ga0265314_10009598 Ga0265314_100095982 383
413 3300031712 Ga0265342_10007811 Ga0265342_100078112 383
414 3300031731 Ga0307405_10013241 Ga0307405_100132412 383
415 3300031901 Ga0307406_10235762 Ga0307406_102357622 383
416 3300031995 Ga0307409_100093238 Ga0307409_1000932382 383
417 3300031995 Ga0307409_100350143 Ga0307409_1003501432 383
418 3300032002 Ga0307416_100159559 Ga0307416_1001595592 383
419 3300032005 Ga0307411_10114783 Ga0307411_101147832 383
420 3300032126 Ga0307415_100049807 Ga0307415_1000498072 383
421 3300032126 Ga0307415_100136133 Ga0307415_1001361332 383
422 3300033179 Ga0307507_10121676 Ga0307507_101216762 383
423 3300033180 Ga0307510_10030634 Ga0307510_100306347 383
424 3300035090 Ga0373949_0000112 Ga0373949_0000112_7801_8970 383
425 3300035695 Ga0373927_0014701 Ga0373927_0014701_1299_2459 383
426 3300036401 Ga0373937_0010803 Ga0373937_0010803_685_1872 383
427 3300037853 Ga0436364_1070120 Ga0436364_1070120_2903_4054 383
428 3300039437 Ga0436365_0961376 Ga0436365_0961376_646_1878 383
429 3300039437 Ga0436365_1394498 Ga0436365_1394498_68_1219 383
430 3300041413 Ga0439465_0001095 Ga0439465_0001095_6466_7629 383
431 3300042007 Ga0439449_0005470 Ga0439449_0005470_1493_2644 383
432 3300044656 Ga0466969_0019832 Ga0466969_0019832_2324_3475 383
433 3300044658 Ga0466972_0030120 Ga0466972_0030120_1459_2610 383
434 3300044658 Ga0466972_0086010 Ga0466972_0086010_223_1374 383
435 3300044684 Ga0466966_0004356 Ga0466966_0004356_3302_4453 383
436 3300044684 Ga0466966_0009137 Ga0466966_0009137_4545_5696 383
437 3300044693 Ga0466961_0004861 Ga0466961_0004861_1862_3013 383
438 3300044693 Ga0466961_0005533 Ga0466961_0005533_4602_5753 383
439 3300044693 Ga0466961_0039060 Ga0466961_0039060_753_1904 383
440 3300044694 Ga0466963_0000506 Ga0466963_0000506_1332_2483 383
441 3300044706 Ga0466964_0009674 Ga0466964_0009674_89_1240 383
442 3300044719 Ga0466971_0016724 Ga0466971_0016724_2070_3221 383
443 3300044765 Ga0466970_0003950 Ga0466970_0003950_4516_5667 383
444 3300044842 Ga0466957_0000304 Ga0466957_0000304_20716_21867 383
445 3300044901 Ga0466960_0019514 Ga0466960_0019514_1375_2526 383
446 3300045049 Ga0466959_0004028 Ga0466959_0004028_1749_2900 383
447 3300045051 Ga0451576_0026836 Ga0451576_0026836_2764_4002 383
448 3300045836 Ga0466958_0002417 Ga0466958_0002417_8059_9210 383
449 3300045976 Ga0466967_0018260 Ga0466967_0018260_2191_3342 383
450 3300046454 Ga0495592_0009563 Ga0495592_0009563_3293_4444 383
451 3300046454 Ga0495592_0022120 Ga0495592_0022120_1554_2720 383
452 3300046455 Ga0495603_0000270 Ga0495603_0000270_17920_19071 383
453 3300046455 Ga0495603_0035175 Ga0495603_0035175_1399_2550 383
454 3300046459 Ga0495629_0002755 Ga0495629_0002755_8090_9241 383
455 3300046462 Ga0495651_0004623 Ga0495651_0004623_7999_9150 383
456 3300046462 Ga0495651_0025202 Ga0495651_0025202_2265_3431 383
457 3300046463 Ga0495653_0057666 Ga0495653_0057666_1628_2779 383
458 3300046472 Ga0495580_0017726 Ga0495580_0017726_2204_3364 383
459 3300046472 Ga0495580_0048563 Ga0495580_0048563_687_1838 383
460 3300046476 Ga0495662_0006964 Ga0495662_0006964_176_1327 383
461 3300046477 Ga0495664_0075510 Ga0495664_0075510_475_1626 383
462 3300046499 Ga0495594_0004572 Ga0495594_0004572_2233_3393 383
463 3300046511 Ga0495608_0001470 Ga0495608_0001470_9714_10865 383
464 3300046516 Ga0495628_0015383 Ga0495628_0015383_3834_4985 383
465 3300046517 Ga0495630_0025338 Ga0495630_0025338_2965_4116 383
466 3300046526 Ga0495666_0023704 Ga0495666_0023704_685_1836 383
467 3300046529 Ga0495652_0000680 Ga0495652_0000680_21572_22738 383
468 3300046529 Ga0495652_0021332 Ga0495652_0021332_3923_5074 383
469 3300046533 Ga0495640_0098953 Ga0495640_0098953_590_1741 383
470 3300046536 Ga0495587_0026611 Ga0495587_0026611_154_1305 383
471 3300046543 Ga0495645_0000732 Ga0495645_0000732_938_2089 383
472 3300046543 Ga0495645_0028391 Ga0495645_0028391_2462_3613 383
473 3300046559 Ga0495667_0008815 Ga0495667_0008815_1126_2277 383
474 3300046559 Ga0495667_0103725 Ga0495667_0103725_242_1405 383
475 3300046663 Ga0495635_0005934 Ga0495635_0005934_3751_4917 383
476 3300046675 Ga0495657_0008253 Ga0495657_0008253_4680_5831 383
477 3300046675 Ga0495657_0022281 Ga0495657_0022281_1126_2277 383
478 3300046675 Ga0495657_0182501 Ga0495657_0182501_60_1247 383
479 3300046678 Ga0495599_0033315 Ga0495599_0033315_555_1721 383
480 3300046678 Ga0495599_0104246 Ga0495599_0104246_590_1741 383
481 3300046679 Ga0495623_0005832 Ga0495623_0005832_1003_2169 383
482 3300046679 Ga0495623_0048645 Ga0495623_0048645_412_1563 383
483 3300046689 Ga0495613_0002772 Ga0495613_0002772_2893_4044 383
484 3300046689 Ga0495613_0003415 Ga0495613_0003415_3423_4574 383
485 3300046809 Ga0495600_0027889 Ga0495600_0027889_1375_2526 383
486 3300047315 Ga0495581_0088215 Ga0495581_0088215_291_1451 383
487 3300047317 Ga0495604_0004205 Ga0495604_0004205_8393_9544 383
488 3300047317 Ga0495604_0014856 Ga0495604_0014856_2094_3245 383
489 3300047319 Ga0495674_0017927 Ga0495674_0017927_4635_5786 383
490 3300047321 Ga0495676_0005415 Ga0495676_0005415_2916_4067 383
491 3300047321 Ga0495676_0008990 Ga0495676_0008990_2485_3636 383
492 3300047444 Ga0495675_0015811 Ga0495675_0015811_2248_3399 383
493 3300048089 Ga0495614_0000393 Ga0495614_0000393_8662_9813 383
494 3300048089 Ga0495614_0071451 Ga0495614_0071451_17_1168 383
495 3300048905 Ga0496102_0017786 Ga0496102_0017786_5053_6216 383
496 3300048907 Ga0496104_0000084 Ga0496104_0000084_78108_79283 383
497 3300048907 Ga0496104_0000304 Ga0496104_0000304_11806_12969 383
498 3300048908 Ga0496105_0005361 Ga0496105_0005361_3452_4615 383
499 3300048911 Ga0496108_0003436 Ga0496108_0003436_1986_3149 383
500 3300048911 Ga0496108_0123897 Ga0496108_0123897_534_1721 383
501 3300048912 Ga0496109_0013906 Ga0496109_0013906_2417_3580 383
502 3300048913 Ga0496110_0013175 Ga0496110_0013175_1402_2565 383
503 3300048914 Ga0496111_0001068 Ga0496111_0001068_12702_13865 383
504 3300048915 Ga0496112_0043039 Ga0496112_0043039_2176_3363 383
505 3300048916 Ga0496113_0048604 Ga0496113_0048604_1097_2284 383
506 3300048917 Ga0496114_0007675 Ga0496114_0007675_4481_5647 383
507 3300048918 Ga0496115_0017906 Ga0496115_0017906_2285_3445 383
508 3300048918 Ga0496115_0093866 Ga0496115_0093866_164_1327 383
509 3300048918 Ga0496115_0183703 Ga0496115_0183703_317_1480 383
510 3300048929 Ga0496126_0000085 Ga0496126_0000085_136253_137428 383
511 3300049568 Ga0501031_0010569 Ga0501031_0010569_4604_5755 383
512 3300049569 Ga0501032_0035741 Ga0501032_0035741_840_1991 383
513 3300049571 Ga0501034_0114120 Ga0501034_0114120_1265_2416 383
514 3300049572 Ga0501036_0038287 Ga0501036_0038287_1540_2691 383
515 3300049572 Ga0501036_0048374 Ga0501036_0048374_720_1871 383
516 3300049573 Ga0501037_0013558 Ga0501037_0013558_3085_4236 383
517 3300049573 Ga0501037_0048521 Ga0501037_0048521_1442_2602 383
518 3300049574 Ga0501038_0101198 Ga0501038_0101198_881_2032 383
519 3300049579 Ga0501043_0005286 Ga0501043_0005286_4719_5870 383
520 3300049579 Ga0501043_0211314 Ga0501043_0211314_330_1490 383
521 3300049580 Ga0501046_0009034 Ga0501046_0009034_2890_4041 383
522 3300049582 Ga0501048_0082447 Ga0501048_0082447_403_1554 383
523 3300049822 Ga0501035_0056722 Ga0501035_0056722_799_1950 383
524 3300049822 Ga0501035_0091231 Ga0501035_0091231_160_1311 383
525 3300049823 Ga0501044_0019873 Ga0501044_0019873_2975_4159 383
526 3300049823 Ga0501044_0236618 Ga0501044_0236618_31_1182 383
527 3300050507 nmdc:mga05p37_334797_c1 nmdc:mga05p37_334797_c1_441_1604 383
528 3300050508 nmdc:mga09592_62245_c1 nmdc:mga09592_62245_c1_1125_2288 383
529 3300050512 nmdc:mga0n895_199556_c1 nmdc:mga0n895_199556_c1_749_1987 383
530 3300050512 nmdc:mga0n895_285914_c1 nmdc:mga0n895_285914_c1_166_1407 383
531 3300053078 Ga0495612_0007964 Ga0495612_0007964_1829_2995 383
532 3300053085 Ga0495619_0012030 Ga0495619_0012030_2779_3930 383
533 3300053085 Ga0495619_0212025 Ga0495619_0212025_28_1194 383
534 3300053178 Ga0500637_0100249 Ga0500637_0100249_481_1641 383
535 3300009094 Ga0111539_10011464 Ga0111539_1001146413 384
536 3300026121 Ga0207683_10220127 Ga0207683_102201272 384
537 3300028794 Ga0307515_10002074 Ga0307515_1000207416 384
538 3300044693 Ga0466961_0006498 Ga0466961_0006498_4258_5430 384
539 3300044719 Ga0466971_0004337 Ga0466971_0004337_2657_3829 384
540 3300045049 Ga0466959_0000325 Ga0466959_0000325_20309_21481 384
541 3300046462 Ga0495651_0000482 Ga0495651_0000482_11371_12540 384
542 3300046514 Ga0495618_0095011 Ga0495618_0095011_528_1697 384
543 3300046516 Ga0495628_0010756 Ga0495628_0010756_6431_7600 384
544 3300046809 Ga0495600_0010460 Ga0495600_0010460_1986_3155 384
545 3300053077 Ga0495601_0006969 Ga0495601_0006969_3597_4766 384
546 3300061719 Ga0466962_0000167 Ga0466962_0000167_6840_8012 384
547 3300028563 Ga0265319_1017168 Ga0265319_10171682 385
548 3300031240 Ga0265320_10000130 Ga0265320_1000013058 385
549 3300031616 Ga0307508_10052444 Ga0307508_100524443 385
550 3300031730 Ga0307516_10012545 Ga0307516_100125452 385
551 3300046694 Ga0495649_0016265 Ga0495649_0016265_1221_2378 385
552 3300053140 Ga0500573_0147218 Ga0500573_0147218_69_1229 385
553 3300053107 Ga0500560_000204 Ga0500560_000204_2148_3341 387
554 iso_pu_bacteria 2862705112 2862708724 387
555 iso_pu_bacteria 2990044586 2990048569 387
556 iso_pu_bacteria 8008485437 8008487882 387
557 iso_pu_bacteria 8025524527 8025526599 387
558 3300038443 Ga0395901_0442802 Ga0395901_0442802_53_1246 389
559 iso_pu_bacteria 2954002825 2954003391 389
560 3300005983 Ga0081540_1006447 Ga0081540_10064475 390
561 3300046660 Ga0495625_0005251 Ga0495625_0005251_3449_4624 391
562 3300049571 Ga0501034_0030816 Ga0501034_0030816_3851_5041 391
563 3300050510 nmdc:mga06r32_16702_c1 nmdc:mga06r32_16702_c1_2034_3212 392
564 3300038443 Ga0395901_0117792 Ga0395901_0117792_1314_2495 393
565 3300028786 Ga0307517_10006019 Ga0307517_100060197 395
566 iso_pu_bacteria 2751185734 2753074821 395
567 3300005981 Ga0081538_10001934 Ga0081538_1000193410 397
568 3300015688 Ga0183367_1006 Ga0183367_1006306 397
569 3300003578 Ga0006562J51391_1115102 Ga0006562J51391_11151025 398
570 3300003578 Ga0006562J51391_1115103 Ga0006562J51391_11151032 398
571 3300006844 Ga0075428_100000289 Ga0075428_10000028940 398
572 3300006880 Ga0075429_100298423 Ga0075429_1002984232 398
573 iso_pu_bacteria 2808606448 2809231604 399
574 iso_pu_bacteria 2946064051 2946067067 402
575 3300014497 Ga0182008_10015751 Ga0182008_100157512 406
576 3300042138 Ga0450903_007080 Ga0450903_007080_515_1735 406
577 3300031649 Ga0307514_10064088 Ga0307514_100640882 407
578 3300005564 Ga0070664_100035087 Ga0070664_1000350874 408
579 3300001990 JGI24737J22298_10016034 JGI24737J22298_100160342 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

154

292

0.97

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

158

383

0.83

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

15

145

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oqb-assembly1.cif.gz_C crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9903 26 407
3oqb-assembly1.cif.gz_H crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9883 26 407
3oqb-assembly1.cif.gz_C crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9877 26 407
3oqb-assembly1.cif.gz_H crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9856 26 407
3oqb-assembly1.cif.gz_A crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110 0.9853 26 407
ID Description Score Start End Superfamily
3oqbH02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9907 168 407 3.30.360.10
3oqbH02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9823 168 407 3.30.360.10
3oqbF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9787 26 166 3.40.50.720
3oqbF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 26 166 3.40.50.720
1xeaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8907 30 165 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535CEX2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9922 85 406 GO:0000166
GO:0016491
AF-A0A535CEX2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9681 85 406 GO:0000166
GO:0016491
AF-A0A060XI41-F1-model_v4 Uncharacterized protein 0.9377 97 183 GO:0000166
GO:0004074
GO:0008270
GO:0042167
AF-A0A7X8MEI1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9103 26 403
AF-A0A7C2VWT6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9072 28 403 GO:0000166

Feature Viewer

pLDDT pTM Quality
90.61 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map