F465829

General Info

Members Datasets Scaffolds Average Seq Length
579 322 1158 251

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10342454|Ga0157375_103424543
Length 267
Sequence MSGPGDKPDEMEGTEQPFVSHLIELRDRLIRACIAIGVCFGVLMVWPGSAHLYDLLAQPLVEHLPKGGTLIATSVISPFLVPLKITLMAAFMLALPVVLYQVWAFVAPGLYTHEKKLVLPLVISSTALFFLGVAFCYFFVFGKVFTFIQSFAPKSVSAMPDIEAYLSFVLTMFIAFGAAFEVPIAVVVLARLGVVSIEKLKEFRAYFVVLAFIIAAILTPPDVVSQLSLAIPMVLLYEVGIIAAGVFIKHTQAPDAEPADDTGGVPR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
312 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
313 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
314 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
315 2643221570 Acidovorax sp. Root568 Isolate Unclassified
316 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
317 2643221596 Acidovorax sp. Root70 Isolate Unclassified
318 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
319 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
320 2643221652 Acidovorax sp. Root402 Isolate Unclassified
321 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
322 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.35
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.73
Nodule 0.35
Rhizoplane 3.45
Rhizosphere 68.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10342454 3300013308 Bacteria 1660
2 JGI25152J39213_1001224 3300002773 Bacteria 11749
3 JGI25152J39213_1001251 3300002773 Bacteria 11566
4 JGI25152J39213_1001299 3300002773 Bacteria 11168
5 JGI25153J46596_10002653 3300003215 Bacteria 10222
6 rootH1_10005761 3300003316 Bacteria 1593
7 rootL2_10000300 3300003322 Bacteria 57400
8 rootH1_10006628 3300003323 Bacteria 3787
9 rootH1_10037279 3300003323 Bacteria 2878
10 Ga0055526_1000414 3300003771 Bacteria 34422
11 Ga0055526_1002262 3300003771 Bacteria 13160
12 Ga0055524_1003149 3300003775 Bacteria 8126
13 Ga0055524_1006310 3300003775 Bacteria 5155
14 Ga0055530_10009773 3300003791 Bacteria 3632
15 Ga0055540_1010102 3300003792 Bacteria 3173
16 Ga0055531_10000257 3300003794 Bacteria 56547
17 Ga0065715_10156194 3300005293 Bacteria 1674
18 Ga0070658_10067265 3300005327 Bacteria 2927
19 Ga0070658_10157899 3300005327 Bacteria 1901
20 Ga0070658_10235936 3300005327 Bacteria 1550
21 Ga0070676_10011649 3300005328 Bacteria 4784
22 Ga0070683_100084148 3300005329 Bacteria 2980
23 Ga0070690_100010106 3300005330 Bacteria 5481
24 Ga0070690_100020420 3300005330 Bacteria 4035
25 Ga0070670_100001787 3300005331 Bacteria 17505
26 Ga0070670_100024831 3300005331 Bacteria 5155
27 Ga0070670_100072367 3300005331 Bacteria 2960
28 Ga0070677_10021063 3300005333 Bacteria 2386
29 Ga0070677_10045788 3300005333 Bacteria 1746
30 Ga0068869_100009400 3300005334 Bacteria 6343
31 Ga0068869_100152615 3300005334 Bacteria 1792
32 Ga0070666_10006757 3300005335 Bacteria 7065
33 Ga0070666_10171459 3300005335 Bacteria 1520
34 Ga0070682_100109763 3300005337 Bacteria 1836
35 Ga0068868_100000966 3300005338 Bacteria 19576
36 Ga0068868_100157152 3300005338 Bacteria 1876
37 Ga0068868_100281375 3300005338 Bacteria 1408
38 Ga0070660_100001068 3300005339 Bacteria 18415
39 Ga0070660_100254866 3300005339 Bacteria 1431
40 Ga0070689_100082458 3300005340 Bacteria 2526
41 Ga0070687_100041173 3300005343 Bacteria 2333
42 Ga0070661_100007516 3300005344 Bacteria 7517
43 Ga0070661_100151254 3300005344 Bacteria 1754
44 Ga0070661_100169621 3300005344 Bacteria 1657
45 Ga0070668_100079120 3300005347 Bacteria 2573
46 Ga0070668_100152060 3300005347 Bacteria 1872
47 Ga0070668_100329857 3300005347 Bacteria 1286
48 Ga0070669_100119281 3300005353 Bacteria 2010
49 Ga0070669_100124590 3300005353 Bacteria 1970
50 Ga0070675_100008036 3300005354 Bacteria 8179
51 Ga0070675_100074059 3300005354 Bacteria 2828
52 Ga0070675_100140755 3300005354 Bacteria 2062
53 Ga0070675_100275509 3300005354 Bacteria 1477
54 Ga0070675_100373870 3300005354 Bacteria 1267
55 Ga0070671_100002643 3300005355 Bacteria 13868
56 Ga0070671_100147628 3300005355 Bacteria 1985
57 Ga0070671_100385199 3300005355 Bacteria 1198
58 Ga0070673_100030938 3300005364 Bacteria 4012
59 Ga0070673_100129882 3300005364 Bacteria 2112
60 Ga0070673_100268901 3300005364 Bacteria 1491
61 Ga0070673_100391098 3300005364 Bacteria 1241
62 Ga0070673_100705709 3300005364 Bacteria 926
63 Ga0070688_100212129 3300005365 Bacteria 1360
64 Ga0070659_100028796 3300005366 Bacteria 4291
65 Ga0070659_100044211 3300005366 Bacteria 3486
66 Ga0070667_100065184 3300005367 Bacteria 3093
67 Ga0070667_100108445 3300005367 Bacteria 2406
68 Ga0070667_100219027 3300005367 Bacteria 1694
69 Ga0070667_100246475 3300005367 Bacteria 1596
70 Ga0070663_100340514 3300005455 Bacteria 1212
71 Ga0070678_100075098 3300005456 Bacteria 2542
72 Ga0070662_100036336 3300005457 Bacteria 3484
73 Ga0070662_100071566 3300005457 Bacteria 2557
74 Ga0070662_100332470 3300005457 Bacteria 1241
75 Ga0070662_100392024 3300005457 Bacteria 1145
76 Ga0068867_100011669 3300005459 Bacteria 6206
77 Ga0068867_100040427 3300005459 Bacteria 3403
78 Ga0068867_100086049 3300005459 Bacteria 2377
79 Ga0068867_100499111 3300005459 Bacteria 1046
80 Ga0070684_100079647 3300005535 Bacteria 2896
81 Ga0070684_100341145 3300005535 Bacteria 1377
82 Ga0070672_100057093 3300005543 Bacteria 3063
83 Ga0070672_100208168 3300005543 Bacteria 1637
84 Ga0070693_100152620 3300005547 Bacteria 1464
85 Ga0070665_100015286 3300005548 Bacteria 7706
86 Ga0068855_101074005 3300005563 Bacteria 843
87 Ga0070664_100378996 3300005564 Bacteria 1291
88 Ga0068857_100042432 3300005577 Bacteria 4036
89 Ga0068857_100406469 3300005577 Bacteria 1267
90 Ga0068854_100009863 3300005578 Bacteria 6176
91 Ga0068854_100053635 3300005578 Bacteria 2896
92 Ga0068854_100194094 3300005578 Bacteria 1592
93 Ga0068854_100195560 3300005578 Bacteria 1587
94 Ga0068856_100007776 3300005614 Bacteria 10473
95 Ga0068856_100121330 3300005614 Bacteria 2615
96 Ga0068852_100110559 3300005616 Bacteria 2497
97 Ga0068852_100204810 3300005616 Bacteria 1868
98 Ga0068852_100373316 3300005616 Bacteria 1398
99 Ga0068859_100176577 3300005617 Bacteria 2218
100 Ga0068859_100336586 3300005617 Bacteria 1603
101 Ga0068864_100002065 3300005618 Bacteria 16597
102 Ga0068864_100013594 3300005618 Bacteria 6748
103 Ga0068864_100027852 3300005618 Bacteria 4775
104 Ga0068864_100428325 3300005618 Bacteria 1262
105 Ga0068851_10049615 3300005834 Bacteria 2129
106 Ga0068851_10112211 3300005834 Bacteria 1456
107 Ga0068870_10152417 3300005840 Bacteria 1363
108 Ga0068863_100040147 3300005841 Bacteria 4450
109 Ga0068863_100089500 3300005841 Bacteria 2919
110 Ga0068863_100140434 3300005841 Bacteria 2308
111 Ga0068863_100287793 3300005841 Bacteria 1593
112 Ga0068858_100520094 3300005842 Bacteria 1151
113 Ga0068862_100309834 3300005844 Bacteria 1455
114 Ga0075365_10034760 3300006038 Bacteria 3257
115 Ga0075368_10072843 3300006042 Bacteria 1390
116 Ga0075363_100032794 3300006048 Bacteria 2700
117 Ga0075363_100100310 3300006048 Bacteria 1602
118 Ga0075363_100251439 3300006048 Bacteria 1018
119 Ga0075364_10011121 3300006051 Bacteria 5463
120 Ga0075364_10186810 3300006051 Bacteria 1403
121 Ga0075432_10045246 3300006058 Bacteria 1544
122 Ga0070716_100111113 3300006173 Bacteria 1699
123 Ga0075362_10018715 3300006177 Bacteria 2870
124 Ga0075362_10094314 3300006177 Bacteria 1392
125 Ga0075367_10011834 3300006178 Bacteria 4633
126 Ga0075367_10081006 3300006178 Bacteria 1964
127 Ga0075367_10115220 3300006178 Bacteria 1652
128 Ga0075367_10155494 3300006178 Bacteria 1421
129 Ga0075367_10232415 3300006178 Bacteria 1155
130 Ga0075369_10013755 3300006186 Bacteria 3219
131 Ga0075366_10005263 3300006195 Bacteria 7007
132 Ga0075366_10031874 3300006195 Bacteria 3103
133 Ga0075366_10038597 3300006195 Bacteria 2821
134 Ga0075366_10049758 3300006195 Bacteria 2487
135 Ga0097621_100004475 3300006237 Bacteria 9740
136 Ga0097621_100047919 3300006237 Bacteria 3464
137 Ga0097621_100259951 3300006237 Bacteria 1523
138 Ga0097621_100292420 3300006237 Bacteria 1436
139 Ga0097621_100407235 3300006237 Bacteria 1218
140 Ga0075370_10001367 3300006353 Bacteria 10507
141 Ga0075370_10008212 3300006353 Bacteria 5358
142 Ga0075370_10009322 3300006353 Bacteria 5094
143 Ga0075370_10024370 3300006353 Bacteria 3341
144 Ga0075370_10028285 3300006353 Bacteria 3115
145 Ga0075370_10040663 3300006353 Bacteria 2623
146 Ga0075370_10044073 3300006353 Bacteria 2522
147 Ga0075370_10053807 3300006353 Bacteria 2284
148 Ga0075370_10068345 3300006353 Bacteria 2029
149 Ga0068871_100054307 3300006358 Bacteria 3250
150 Ga0068871_100128777 3300006358 Bacteria 2144
151 Ga0068871_100294616 3300006358 Bacteria 1423
152 Ga0075430_100005009 3300006846 Bacteria 11150
153 Ga0075433_10403451 3300006852 Bacteria 1206
154 Ga0075434_100613429 3300006871 Bacteria 1107
155 Ga0075429_100007444 3300006880 Bacteria 9503
156 Ga0068865_100278543 3300006881 Bacteria 1331
157 Ga0068865_100511616 3300006881 Bacteria 1003
158 Ga0075436_100284617 3300006914 Bacteria 1182
159 Ga0097620_100176580 3300006931 Bacteria 2218
160 Ga0097620_100336605 3300006931 Bacteria 1603
161 Ga0099823_1000139 3300006944 Bacteria 37935
162 Ga0099794_10022268 3300007265 Bacteria 2888
163 Ga0105240_10025383 3300009093 Bacteria 7788
164 Ga0105245_10123990 3300009098 Bacteria 2416
165 Ga0105245_10210535 3300009098 Bacteria 1871
166 Ga0105245_10411767 3300009098 Bacteria 1353
167 Ga0114129_10560169 3300009147 Bacteria 1485
168 Ga0105243_10019382 3300009148 Bacteria 5158
169 Ga0105241_10048128 3300009174 Bacteria 3243
170 Ga0105241_10185778 3300009174 Bacteria 1727
171 Ga0105241_10466836 3300009174 Bacteria 1119
172 Ga0105242_10114315 3300009176 Bacteria 2306
173 Ga0105248_10005804 3300009177 Bacteria 13570
174 Ga0105248_10229892 3300009177 Bacteria 2088
175 Ga0105248_10455142 3300009177 Bacteria 1442
176 Ga0105248_10752869 3300009177 Bacteria 1099
177 Ga0105237_10007447 3300009545 Bacteria 11978
178 Ga0105237_10391174 3300009545 Bacteria 1395
179 Ga0105238_10005477 3300009551 Bacteria 12552
180 Ga0105238_10053451 3300009551 Bacteria 4059
181 Ga0105238_10227512 3300009551 Bacteria 1842
182 Ga0105249_10032646 3300009553 Bacteria 4710
183 Ga0105239_10010780 3300010375 Bacteria 10211
184 Ga0105239_10171360 3300010375 Bacteria 2427
185 Ga0157319_1000008 3300012497 Bacteria 315600
186 Ga0157373_10026319 3300013100 Bacteria 4203
187 Ga0157371_10021216 3300013102 Bacteria 4771
188 Ga0157371_10119763 3300013102 Bacteria 1871
189 Ga0157369_10076444 3300013105 Bacteria 3589
190 Ga0157369_10634777 3300013105 Bacteria 1102
191 Ga0157374_10003108 3300013296 Bacteria 13934
192 Ga0157374_10047942 3300013296 Bacteria 3963
193 Ga0157374_10128313 3300013296 Bacteria 2453
194 Ga0157378_10588002 3300013297 Bacteria 1123
195 Ga0157372_10031276 3300013307 Bacteria 5827
196 Ga0157372_10076894 3300013307 Bacteria 3769
197 Ga0157375_10008892 3300013308 Bacteria 8789
198 Ga0157375_10010275 3300013308 Bacteria 8238
199 Ga0163163_10009458 3300014325 Bacteria 8703
200 Ga0163163_10328045 3300014325 Bacteria 1584
201 Ga0163163_10534877 3300014325 Bacteria 1234
202 Ga0157380_10060458 3300014326 Bacteria 3028
203 Ga0157377_10001539 3300014745 Bacteria 10025
204 Ga0157379_10018511 3300014968 Bacteria 6144
205 Ga0157379_10153905 3300014968 Bacteria 2074
206 Ga0157376_10047410 3300014969 Bacteria 3547
207 Ga0157376_10184697 3300014969 Bacteria 1908
208 Ga0182005_1031825 3300015265 Bacteria 1437
209 Ga0163161_10023850 3300017792 Bacteria 4318
210 Ga0163161_10169379 3300017792 Bacteria 1669
211 Ga0213872_10000113 3300021361 Bacteria 74827
212 Ga0213874_10046582 3300021377 Bacteria 1316
213 Ga0213876_10040343 3300021384 Bacteria 2466
214 Ga0207425_1001237 3300025245 Bacteria 11199
215 Ga0209129_1000027 3300025258 Bacteria 409587
216 Ga0209673_1002844 3300025273 Bacteria 11093
217 Ga0209673_1010832 3300025273 Bacteria 3810
218 Ga0209673_1012145 3300025273 Bacteria 3493
219 Ga0209673_1015129 3300025273 Bacteria 2948
220 Ga0209673_1017499 3300025273 Bacteria 2640
221 Ga0209673_1030462 3300025273 Bacteria 1699
222 Ga0209564_1000008 3300025295 Bacteria 953227
223 Ga0209564_1000139 3300025295 Bacteria 180328
224 Ga0209758_1000281 3300025297 Bacteria 100826
225 Ga0209758_1000310 3300025297 Bacteria 94307
226 Ga0209050_1000303 3300025298 Bacteria 101498
227 Ga0209050_1003036 3300025298 Bacteria 12951
228 Ga0209256_1001514 3300025299 Bacteria 23507
229 Ga0209256_1001861 3300025299 Bacteria 19505
230 Ga0209051_1000025 3300025303 Bacteria 415397
231 Ga0209051_1001714 3300025303 Bacteria 17502
232 Ga0209257_1000039 3300025304 Bacteria 591694
233 Ga0209257_1002401 3300025304 Bacteria 18726
234 Ga0209257_1003376 3300025304 Bacteria 13783
235 Ga0207656_10034200 3300025321 Bacteria 2121
236 Ga0207656_10064330 3300025321 Bacteria 1617
237 Ga0207710_10235578 3300025900 Bacteria 912
238 Ga0207688_10170936 3300025901 Bacteria 1292
239 Ga0207680_10002140 3300025903 Bacteria 9255
240 Ga0207643_10034365 3300025908 Bacteria 2841
241 Ga0207705_10104251 3300025909 Bacteria 2089
242 Ga0207705_10196948 3300025909 Bacteria 1525
243 Ga0207654_10065178 3300025911 Bacteria 2144
244 Ga0207707_10089670 3300025912 Bacteria 2688
245 Ga0207695_10009980 3300025913 Bacteria 11666
246 Ga0207671_10008972 3300025914 Bacteria 8414
247 Ga0207662_10033979 3300025918 Bacteria 2976
248 Ga0207649_10016552 3300025920 Bacteria 4161
249 Ga0207681_10016930 3300025923 Bacteria 4570
250 Ga0207681_10052456 3300025923 Bacteria 2765
251 Ga0207681_10179049 3300025923 Bacteria 1613
252 Ga0207694_10030287 3300025924 Bacteria 4132
253 Ga0207694_10104881 3300025924 Bacteria 2244
254 Ga0207694_10253862 3300025924 Bacteria 1439
255 Ga0207650_10027813 3300025925 Bacteria 4050
256 Ga0207650_10049583 3300025925 Bacteria 3101
257 Ga0207650_10064948 3300025925 Bacteria 2733
258 Ga0207650_10102984 3300025925 Bacteria 2200
259 Ga0207659_10024900 3300025926 Bacteria 4016
260 Ga0207659_10051600 3300025926 Bacteria 2926
261 Ga0207659_10053608 3300025926 Bacteria 2877
262 Ga0207659_10155123 3300025926 Bacteria 1792
263 Ga0207659_10398419 3300025926 Bacteria 1151
264 Ga0207687_10075631 3300025927 Bacteria 2417
265 Ga0207687_10214643 3300025927 Bacteria 1511
266 Ga0207644_10000264 3300025931 Bacteria 35311
267 Ga0207644_10002654 3300025931 Bacteria 11522
268 Ga0207644_10054169 3300025931 Bacteria 2888
269 Ga0207690_10072581 3300025932 Bacteria 2377
270 Ga0207706_10013512 3300025933 Bacteria 7420
271 Ga0207706_10090309 3300025933 Bacteria 2693
272 Ga0207706_10300790 3300025933 Bacteria 1398
273 Ga0207686_10008165 3300025934 Bacteria 5647
274 Ga0207709_10044667 3300025935 Bacteria 2679
275 Ga0207709_10122879 3300025935 Bacteria 1756
276 Ga0207670_10007649 3300025936 Bacteria 6048
277 Ga0207704_10126274 3300025938 Bacteria 1762
278 Ga0207665_10026795 3300025939 Bacteria 3806
279 Ga0207691_10004404 3300025940 Bacteria 13651
280 Ga0207691_10120320 3300025940 Bacteria 2328
281 Ga0207691_10132505 3300025940 Bacteria 2200
282 Ga0207711_10003550 3300025941 Bacteria 13509
283 Ga0207711_10036357 3300025941 Bacteria 4179
284 Ga0207711_10114256 3300025941 Bacteria 2404
285 Ga0207711_10340194 3300025941 Bacteria 1389
286 Ga0207689_10150648 3300025942 Bacteria 1917
287 Ga0207689_10178139 3300025942 Bacteria 1753
288 Ga0207661_10662293 3300025944 Bacteria 959
289 Ga0207679_10474929 3300025945 Bacteria 1112
290 Ga0207667_10394864 3300025949 Bacteria 1408
291 Ga0207651_10013837 3300025960 Bacteria 4634
292 Ga0207651_10071872 3300025960 Bacteria 2454
293 Ga0207651_10160489 3300025960 Bacteria 1762
294 Ga0207651_10582867 3300025960 Bacteria 976
295 Ga0207712_10017553 3300025961 Bacteria 4650
296 Ga0207712_10096061 3300025961 Bacteria 2193
297 Ga0207668_10024415 3300025972 Bacteria 3901
298 Ga0207668_10162670 3300025972 Bacteria 1741
299 Ga0207640_10047680 3300025981 Bacteria 2765
300 Ga0207640_10090632 3300025981 Bacteria 2116
301 Ga0207640_10417206 3300025981 Bacteria 1097
302 Ga0207658_10010175 3300025986 Bacteria 6393
303 Ga0207658_10043142 3300025986 Bacteria 3277
304 Ga0207658_10235615 3300025986 Bacteria 1547
305 Ga0207677_10001522 3300026023 Bacteria 12255
306 Ga0207677_10004585 3300026023 Bacteria 7430
307 Ga0207677_10085928 3300026023 Bacteria 2272
308 Ga0207677_10092121 3300026023 Bacteria 2206
309 Ga0207703_10032964 3300026035 Bacteria 4103
310 Ga0207703_10197881 3300026035 Bacteria 1784
311 Ga0207639_10081416 3300026041 Bacteria 2564
312 Ga0207639_10227416 3300026041 Bacteria 1615
313 Ga0207702_10004429 3300026078 Bacteria 12481
314 Ga0207641_10003329 3300026088 Bacteria 14294
315 Ga0207641_10044236 3300026088 Bacteria 3744
316 Ga0207641_10121062 3300026088 Bacteria 2335
317 Ga0207648_10010028 3300026089 Bacteria 9011
318 Ga0207648_10019133 3300026089 Bacteria 6180
319 Ga0207676_10002741 3300026095 Bacteria 12542
320 Ga0207676_10003295 3300026095 Bacteria 11473
321 Ga0207674_10018099 3300026116 Bacteria 7668
322 Ga0207683_10007622 3300026121 Bacteria 9271
323 Ga0207683_10115309 3300026121 Bacteria 2408
324 Ga0207683_10124469 3300026121 Bacteria 2316
325 Ga0207698_10037653 3300026142 Bacteria 3565
326 Ga0207698_10180977 3300026142 Bacteria 1867
327 Ga0207698_10344499 3300026142 Bacteria 1405
328 Ga0207698_10579900 3300026142 Bacteria 1103
329 Ga0209389_1009996 3300027296 Bacteria 8525
330 Ga0209813_10021171 3300027866 Bacteria 1825
331 Ga0209974_10004079 3300027876 Bacteria 5216
332 Ga0209974_10017003 3300027876 Bacteria 2414
333 Ga0268266_10045732 3300028379 Bacteria 3745
334 Ga0268266_10486108 3300028379 Bacteria 1177
335 Ga0268265_10119897 3300028380 Bacteria 2165
336 Ga0268265_10129704 3300028380 Bacteria 2093
337 Ga0268265_10230848 3300028380 Bacteria 1626
338 Ga0268264_10094518 3300028381 Bacteria 2584
339 Ga0268264_10139845 3300028381 Bacteria 2157
340 Ga0268264_10330437 3300028381 Bacteria 1444
341 Ga0268264_10387128 3300028381 Bacteria 1340
342 Ga0307517_10003685 3300028786 Bacteria 23834
343 Ga0307517_10091143 3300028786 Bacteria 2493
344 Ga0307515_10000609 3300028794 Bacteria 83557
345 Ga0307515_10003487 3300028794 Bacteria 33051
346 Ga0307515_10003934 3300028794 Bacteria 31018
347 Ga0307515_10018282 3300028794 Bacteria 12704
348 Ga0307515_10068536 3300028794 Bacteria 4872
349 Ga0307515_10084430 3300028794 Bacteria 4078
350 Ga0307515_10355356 3300028794 Bacteria 1109
351 Ga0307512_10024260 3300030522 Bacteria 5401
352 Ga0316177_1183037 3300030731 Bacteria 970
353 Ga0265330_10000156 3300031235 Bacteria 55313
354 Ga0265330_10050715 3300031235 Bacteria 1820
355 Ga0265332_10000157 3300031238 Bacteria 55228
356 Ga0265332_10007427 3300031238 Bacteria 4954
357 Ga0265329_10016464 3300031242 Bacteria 2560
358 Ga0265327_10000320 3300031251 Bacteria 91776
359 Ga0307513_10082183 3300031456 Bacteria 3317
360 Ga0307509_10000991 3300031507 Bacteria 48763
361 Ga0307509_10040089 3300031507 Bacteria 5095
362 Ga0307509_10104924 3300031507 Bacteria 2849
363 Ga0307408_100000557 3300031548 Bacteria 32161
364 Ga0307408_100415677 3300031548 Bacteria 1158
365 Ga0307508_10000404 3300031616 Bacteria 51734
366 Ga0307508_10005736 3300031616 Bacteria 11754
367 Ga0307508_10011564 3300031616 Bacteria 8064
368 Ga0307514_10000355 3300031649 Bacteria 106758
369 Ga0307514_10032476 3300031649 Bacteria 4178
370 Ga0307514_10227514 3300031649 Bacteria 1135
371 Ga0265314_10000446 3300031711 Bacteria 55219
372 Ga0265314_10006203 3300031711 Bacteria 10617
373 Ga0307516_10001752 3300031730 Bacteria 29850
374 Ga0307516_10054923 3300031730 Bacteria 3890
375 Ga0307405_10006962 3300031731 Bacteria 5616
376 Ga0307406_10001107 3300031901 Bacteria 15028
377 Ga0307412_10024007 3300031911 Bacteria 3760
378 Ga0307409_100000580 3300031995 Bacteria 15944
379 Ga0307409_100630695 3300031995 Bacteria 1063
380 Ga0307415_100002051 3300032126 Bacteria 9953
381 Ga0307507_10196072 3300033179 Bacteria 1408
382 Ga0307510_10003212 3300033180 Bacteria 19002
383 Ga0307510_10064638 3300033180 Bacteria 3714
384 Ga0307510_10240837 3300033180 Bacteria 1303
385 Ga0373934_0152734 3300035086 Bacteria 946
386 Ga0373940_0016966 3300035088 Bacteria 1811
387 Ga0373923_0046311 3300035111 Bacteria 1809
388 Ga0373939_0023217 3300035114 Bacteria 1717
389 Ga0373945_0041211 3300035116 Bacteria 1669
390 Ga0373953_0137579 3300035117 Bacteria 1044
391 Ga0373956_0048219 3300035119 Bacteria 1907
392 Ga0373957_0023394 3300035120 Bacteria 2210
393 Ga0373955_0003334 3300035172 Bacteria 7054
394 Ga0373931_0001378 3300035691 Bacteria 10389
395 Ga0373931_0251479 3300035691 Bacteria 1075
396 Ga0373935_0124622 3300035692 Bacteria 1725
397 Ga0373933_0011855 3300035724 Bacteria 4814
398 Ga0373933_0245170 3300035724 Bacteria 1153
399 Ga0373937_0027728 3300036401 Bacteria 5124
400 Ga0373937_0229738 3300036401 Bacteria 1747
401 Ga0373937_0263158 3300036401 Bacteria 1627
402 Ga0395905_0000728 3300037471 Bacteria 43400
403 Ga0395905_0023956 3300037471 Bacteria 5763
404 Ga0395905_0211772 3300037471 Bacteria 1815
405 Ga0436361_0287659 3300039447 Bacteria 26995
406 Ga0436361_0511282 3300039447 Bacteria 4027
407 Ga0436363_1431319 3300039450 Bacteria 5047
408 Ga0451795_0415125 3300041456 Bacteria 764
409 Ga0451798_0351599 3300041458 Bacteria 2029
410 Ga0451800_0189236 3300041459 Bacteria 1428
411 Ga0451802_1131562 3300041460 Bacteria 3723
412 Ga0451807_2220868 3300041486 Bacteria 3350
413 Ga0451845_0990444 3300041501 Bacteria 1262
414 Ga0451853_0858034 3300041512 Bacteria 1825
415 Ga0451853_3805220 3300041512 Bacteria 1376
416 Ga0439462_0003124 3300042015 Bacteria 3938
417 Ga0439464_0044277 3300042439 Bacteria 1274
418 Ga0451577_0003533 3300042876 Bacteria 17291
419 Ga0451577_0004221 3300042876 Bacteria 15320
420 Ga0451577_0035475 3300042876 Bacteria 4492
421 Ga0451577_0323479 3300042876 Bacteria 1399
422 Ga0466966_0025704 3300044684 Bacteria 3846
423 Ga0466961_0016632 3300044693 Bacteria 4729
424 Ga0453684_0029736 3300044712 Bacteria 7744
425 Ga0466971_0007541 3300044719 Bacteria 4742
426 Ga0451576_0010377 3300045051 Bacteria 10695
427 Ga0451576_0092795 3300045051 Bacteria 3140
428 Ga0495592_0000083 3300046454 Bacteria 83092
429 Ga0495590_0032942 3300046457 Bacteria 1812
430 Ga0495638_0048022 3300046460 Bacteria 2674
431 Ga0495641_0111711 3300046461 Bacteria 1219
432 Ga0495580_0018628 3300046472 Bacteria 5167
433 Ga0495662_0214486 3300046476 Bacteria 949
434 Ga0495628_0009672 3300046516 Bacteria 8226
435 Ga0495632_0002758 3300046519 Bacteria 13043
436 Ga0495632_0023888 3300046519 Bacteria 3257
437 Ga0495632_0063426 3300046519 Bacteria 1789
438 Ga0495643_0107709 3300046522 Bacteria 1420
439 Ga0495652_0002976 3300046529 Bacteria 17031
440 Ga0495597_0004807 3300046542 Bacteria 7296
441 Ga0495597_0044110 3300046542 Bacteria 1984
442 Ga0495645_0000247 3300046543 Bacteria 39450
443 Ga0495668_0170113 3300046616 Bacteria 1194
444 Ga0495625_0009747 3300046660 Bacteria 7995
445 Ga0495625_0127538 3300046660 Bacteria 1726
446 Ga0495635_0096618 3300046663 Bacteria 2019
447 Ga0495599_0000345 3300046678 Bacteria 27538
448 Ga0495647_0061381 3300046681 Bacteria 1484
449 Ga0495669_0263014 3300046684 Bacteria 829
450 Ga0495613_0064653 3300046689 Bacteria 2675
451 Ga0495624_0016323 3300046690 Bacteria 4998
452 Ga0495670_0143205 3300046691 Bacteria 1251
453 Ga0495649_0003342 3300046694 Bacteria 10883
454 Ga0495674_0122440 3300047319 Bacteria 2197
455 Ga0495676_0050153 3300047321 Bacteria 3349
456 Ga0495680_0119830 3300047322 Bacteria 1944
457 Ga0495680_0363982 3300047322 Bacteria 1004
458 Ga0495687_000961 3300047443 Bacteria 29557
459 Ga0495687_011873 3300047443 Bacteria 4650
460 Ga0495677_0128348 3300047445 Bacteria 970
461 Ga0495684_0282774 3300047471 Bacteria 1196
462 Ga0495686_0003513 3300047472 Bacteria 13526
463 Ga0495686_0218332 3300047472 Bacteria 1086
464 Ga0495626_0136421 3300048091 Bacteria 1043
465 Ga0496102_0018445 3300048905 Bacteria 6133
466 Ga0496104_0032470 3300048907 Bacteria 4859
467 Ga0496106_0082196 3300048909 Bacteria 2476
468 Ga0496108_0011606 3300048911 Bacteria 7167
469 Ga0496108_0023125 3300048911 Bacteria 5112
470 Ga0496108_0025181 3300048911 Bacteria 4903
471 Ga0496109_0010074 3300048912 Bacteria 8065
472 Ga0496109_0071476 3300048912 Bacteria 3186
473 Ga0496109_0089695 3300048912 Bacteria 2843
474 Ga0496111_0133104 3300048914 Bacteria 1841
475 Ga0496111_0261875 3300048914 Bacteria 1283
476 Ga0496112_0461023 3300048915 Bacteria 1208
477 Ga0496114_0049088 3300048917 Bacteria 3511
478 Ga0496114_0113261 3300048917 Bacteria 2325
479 Ga0496115_0037521 3300048918 Bacteria 3840
480 Ga0496121_0044309 3300048924 Bacteria 3839
481 Ga0501031_0012636 3300049568 Bacteria 5514
482 Ga0501040_0004390 3300049576 Bacteria 9163
483 Ga0501042_0003021 3300049578 Bacteria 10463
484 Ga0501043_0249868 3300049579 Bacteria 1366
485 Ga0501046_0003243 3300049580 Bacteria 14952
486 Ga0501047_0410366 3300049581 Bacteria 1187
487 Ga0501048_0007325 3300049582 Bacteria 8364
488 Ga0501068_0002746 3300049584 Bacteria 9355
489 Ga0501070_0239216 3300049586 Bacteria 1486
490 Ga0501072_0011492 3300049588 Bacteria 6768
491 Ga0501075_0004962 3300049591 Bacteria 9071
492 Ga0501076_0023753 3300049592 Bacteria 4729
493 Ga0501076_0037359 3300049592 Bacteria 3808
494 Ga0501077_0022192 3300049593 Bacteria 4020
495 Ga0501223_012639 3300049663 Bacteria 1686
496 Ga0501079_0041234 3300049741 Bacteria 3562
497 Ga0501035_0203385 3300049822 Bacteria 1697
498 nmdc:mga03683_101847_c1 3300050489 Bacteria 1263
499 nmdc:mga03683_121045_c1 3300050489 Bacteria 1164
500 nmdc:mga03683_49503_c1 3300050489 Bacteria 1750
501 nmdc:mga03n38_50923_c1 3300050490 Bacteria 1847
502 nmdc:mga00v17_51711_c1 3300050491 Bacteria 2498
503 nmdc:mga0yw44_26539_c1 3300050492 Bacteria 3310
504 nmdc:mga0k408_108273_c1 3300050493 Bacteria 1642
505 nmdc:mga0k408_12351_c1 3300050493 Bacteria 4668
506 nmdc:mga0k408_12774_c1 3300050493 Bacteria 4594
507 nmdc:mga0k408_247766_c1 3300050493 Bacteria 1064
508 nmdc:mga0k408_284072_c1 3300050493 Bacteria 988
509 nmdc:mga0k408_287_c1 3300050493 Bacteria 27526
510 nmdc:mga0k408_29299_c1 3300050493 Bacteria 3132
511 nmdc:mga0k408_3129_c1 3300050493 Bacteria 8767
512 nmdc:mga0k408_42457_c1 3300050493 Bacteria 2620
513 nmdc:mga0k408_4278_c1 3300050493 Bacteria 7582
514 nmdc:mga0k408_7247_c1 3300050493 Bacteria 5928
515 nmdc:mga0k408_78476_c1 3300050493 Bacteria 1932
516 nmdc:mga06z11_122159_c1 3300050494 Bacteria 1454
517 nmdc:mga06z11_5767_c1 3300050494 Bacteria 4993
518 nmdc:mga06z11_79525_c1 3300050494 Bacteria 1756
519 nmdc:mga04h51_32611_c1 3300050495 Bacteria 1653
520 nmdc:mga04h51_5532_c1 3300050495 Bacteria 3226
521 nmdc:mga07m45_12296_c1 3300050496 Bacteria 4521
522 nmdc:mga07m45_135061_c1 3300050496 Bacteria 1428
523 nmdc:mga07m45_135723_c1 3300050496 Bacteria 1424
524 nmdc:mga07m45_137487_c1 3300050496 Bacteria 1415
525 nmdc:mga07m45_178285_c1 3300050496 Bacteria 1236
526 nmdc:mga07m45_18900_c1 3300050496 Bacteria 3728
527 nmdc:mga07m45_189525_c1 3300050496 Bacteria 1196
528 nmdc:mga07m45_23650_c1 3300050496 Bacteria 3361
529 nmdc:mga07m45_27453_c1 3300050496 Bacteria 3136
530 nmdc:mga07m45_284600_c1 3300050496 Bacteria 962
531 nmdc:mga07m45_29411_c1 3300050496 Bacteria 3038
532 nmdc:mga07m45_3946_c1 3300050496 Bacteria 7209
533 nmdc:mga07m45_84513_c1 3300050496 Bacteria 1815
534 nmdc:mga07m45_91426_c1 3300050496 Bacteria 1744
535 nmdc:mga07m45_9149_c1 3300050496 Bacteria 5120
536 nmdc:mga09592_9896_c1 3300050508 Bacteria 7754
537 nmdc:mga0qj67_15077_c1 3300050509 Bacteria 5848
538 nmdc:mga0a205_324012_c1 3300050515 Bacteria 1411
539 nmdc:mga0sz30_1941_c1 3300050516 Bacteria 7388
540 Ga0495601_0082952 3300053077 Bacteria 2058
541 Ga0495619_0137928 3300053085 Bacteria 1678
542 Ga0500578_0000363 3300053086 Bacteria 55670
543 Ga0500644_0058659 3300053088 Bacteria 1347
544 Ga0500651_0198496 3300053093 Bacteria 1185
545 Ga0500594_0004214 3300053118 Bacteria 3169
546 Ga0500642_0007976 3300053130 Bacteria 3592
547 Ga0500652_010242 3300053131 Bacteria 3204
548 Ga0500655_030131 3300053133 Bacteria 1043
549 Ga0500658_0000889 3300053134 Bacteria 12243
550 Ga0500658_0063219 3300053134 Bacteria 1545
551 Ga0500559_0000019 3300053136 Bacteria 134862
552 Ga0500568_0002988 3300053139 Bacteria 9674
553 Ga0500568_0008342 3300053139 Bacteria 5005
554 Ga0500619_000171 3300053154 Bacteria 15684
555 Ga0500622_0003170 3300053156 Bacteria 11250
556 Ga0500622_0004274 3300053156 Bacteria 9058
557 Ga0500622_0029190 3300053156 Bacteria 2901
558 Ga0500622_0084597 3300053156 Bacteria 1583
559 Ga0500570_141840 3300053724 Bacteria 881
560 Ga0500645_001960 3300053730 Bacteria 9727
561 Ga0500587_002884 3300053739 Bacteria 2432
562 Ga0501084_0005520 3300054114 Bacteria 10383
563 Ga0590075_048045 3300059424 Bacteria 1094
564 Ga0587090_002855 3300059510 Bacteria 1945
565 Ga0587111_0002835 3300060346 Bacteria 2380
566 Ga0501082_0029179 3300060353 Bacteria 4752
567 Ga0466962_0018473 3300061719 Bacteria 3353
568 2587724924 2585428057 Bacteria 6737412
569 2587731709 2585428058 Bacteria 6853932
570 2587754194 2585428062 Bacteria 6842168
571 2588292426 2588253510 Bacteria 6901809
572 2643867735 2643221570 Bacteria 5103772
573 2643968194 2643221592 Bacteria 6608788
574 2643991598 2643221596 Bacteria 5006805
575 2644142450 2643221625 Bacteria 6512927
576 2644277051 2643221648 Bacteria 6521465
577 2644293344 2643221652 Bacteria 5140275
578 2886851959 2886848708 Bacteria 5632523
579 2990713956 2990710928 Bacteria 5002431
580 Ga0157375_10342454
581 JGI25152J39213_1001224
582 JGI25152J39213_1001251
583 JGI25152J39213_1001299
584 JGI25153J46596_10002653
585 rootH1_10005761
586 rootL2_10000300
587 rootH1_10006628
588 rootH1_10037279
589 Ga0055526_1000414
590 Ga0055526_1002262
591 Ga0055524_1003149
592 Ga0055524_1006310
593 Ga0055530_10009773
594 Ga0055540_1010102
595 Ga0055531_10000257
596 Ga0065715_10156194
597 Ga0070658_10067265
598 Ga0070658_10157899
599 Ga0070658_10235936
600 Ga0070676_10011649
601 Ga0070683_100084148
602 Ga0070690_100010106
603 Ga0070690_100020420
604 Ga0070670_100001787
605 Ga0070670_100024831
606 Ga0070670_100072367
607 Ga0070677_10021063
608 Ga0070677_10045788
609 Ga0068869_100009400
610 Ga0068869_100152615
611 Ga0070666_10006757
612 Ga0070666_10171459
613 Ga0070682_100109763
614 Ga0068868_100000966
615 Ga0068868_100157152
616 Ga0068868_100281375
617 Ga0070660_100001068
618 Ga0070660_100254866
619 Ga0070689_100082458
620 Ga0070687_100041173
621 Ga0070661_100007516
622 Ga0070661_100151254
623 Ga0070661_100169621
624 Ga0070668_100079120
625 Ga0070668_100152060
626 Ga0070668_100329857
627 Ga0070669_100119281
628 Ga0070669_100124590
629 Ga0070675_100008036
630 Ga0070675_100074059
631 Ga0070675_100140755
632 Ga0070675_100275509
633 Ga0070675_100373870
634 Ga0070671_100002643
635 Ga0070671_100147628
636 Ga0070671_100385199
637 Ga0070673_100030938
638 Ga0070673_100129882
639 Ga0070673_100268901
640 Ga0070673_100391098
641 Ga0070673_100705709
642 Ga0070688_100212129
643 Ga0070659_100028796
644 Ga0070659_100044211
645 Ga0070667_100065184
646 Ga0070667_100108445
647 Ga0070667_100219027
648 Ga0070667_100246475
649 Ga0070663_100340514
650 Ga0070678_100075098
651 Ga0070662_100036336
652 Ga0070662_100071566
653 Ga0070662_100332470
654 Ga0070662_100392024
655 Ga0068867_100011669
656 Ga0068867_100040427
657 Ga0068867_100086049
658 Ga0068867_100499111
659 Ga0070684_100079647
660 Ga0070684_100341145
661 Ga0070672_100057093
662 Ga0070672_100208168
663 Ga0070693_100152620
664 Ga0070665_100015286
665 Ga0068855_101074005
666 Ga0070664_100378996
667 Ga0068857_100042432
668 Ga0068857_100406469
669 Ga0068854_100009863
670 Ga0068854_100053635
671 Ga0068854_100194094
672 Ga0068854_100195560
673 Ga0068856_100007776
674 Ga0068856_100121330
675 Ga0068852_100110559
676 Ga0068852_100204810
677 Ga0068852_100373316
678 Ga0068859_100176577
679 Ga0068859_100336586
680 Ga0068864_100002065
681 Ga0068864_100013594
682 Ga0068864_100027852
683 Ga0068864_100428325
684 Ga0068851_10049615
685 Ga0068851_10112211
686 Ga0068870_10152417
687 Ga0068863_100040147
688 Ga0068863_100089500
689 Ga0068863_100140434
690 Ga0068863_100287793
691 Ga0068858_100520094
692 Ga0068862_100309834
693 Ga0075365_10034760
694 Ga0075368_10072843
695 Ga0075363_100032794
696 Ga0075363_100100310
697 Ga0075363_100251439
698 Ga0075364_10011121
699 Ga0075364_10186810
700 Ga0075432_10045246
701 Ga0070716_100111113
702 Ga0075362_10018715
703 Ga0075362_10094314
704 Ga0075367_10011834
705 Ga0075367_10081006
706 Ga0075367_10115220
707 Ga0075367_10155494
708 Ga0075367_10232415
709 Ga0075369_10013755
710 Ga0075366_10005263
711 Ga0075366_10031874
712 Ga0075366_10038597
713 Ga0075366_10049758
714 Ga0097621_100004475
715 Ga0097621_100047919
716 Ga0097621_100259951
717 Ga0097621_100292420
718 Ga0097621_100407235
719 Ga0075370_10001367
720 Ga0075370_10008212
721 Ga0075370_10009322
722 Ga0075370_10024370
723 Ga0075370_10028285
724 Ga0075370_10040663
725 Ga0075370_10044073
726 Ga0075370_10053807
727 Ga0075370_10068345
728 Ga0068871_100054307
729 Ga0068871_100128777
730 Ga0068871_100294616
731 Ga0075430_100005009
732 Ga0075433_10403451
733 Ga0075434_100613429
734 Ga0075429_100007444
735 Ga0068865_100278543
736 Ga0068865_100511616
737 Ga0075436_100284617
738 Ga0097620_100176580
739 Ga0097620_100336605
740 Ga0099823_1000139
741 Ga0099794_10022268
742 Ga0105240_10025383
743 Ga0105245_10123990
744 Ga0105245_10210535
745 Ga0105245_10411767
746 Ga0114129_10560169
747 Ga0105243_10019382
748 Ga0105241_10048128
749 Ga0105241_10185778
750 Ga0105241_10466836
751 Ga0105242_10114315
752 Ga0105248_10005804
753 Ga0105248_10229892
754 Ga0105248_10455142
755 Ga0105248_10752869
756 Ga0105237_10007447
757 Ga0105237_10391174
758 Ga0105238_10005477
759 Ga0105238_10053451
760 Ga0105238_10227512
761 Ga0105249_10032646
762 Ga0105239_10010780
763 Ga0105239_10171360
764 Ga0157319_1000008
765 Ga0157373_10026319
766 Ga0157371_10021216
767 Ga0157371_10119763
768 Ga0157369_10076444
769 Ga0157369_10634777
770 Ga0157374_10003108
771 Ga0157374_10047942
772 Ga0157374_10128313
773 Ga0157378_10588002
774 Ga0157372_10031276
775 Ga0157372_10076894
776 Ga0157375_10008892
777 Ga0157375_10010275
778 Ga0163163_10009458
779 Ga0163163_10328045
780 Ga0163163_10534877
781 Ga0157380_10060458
782 Ga0157377_10001539
783 Ga0157379_10018511
784 Ga0157379_10153905
785 Ga0157376_10047410
786 Ga0157376_10184697
787 Ga0182005_1031825
788 Ga0163161_10023850
789 Ga0163161_10169379
790 Ga0213872_10000113
791 Ga0213874_10046582
792 Ga0213876_10040343
793 Ga0207425_1001237
794 Ga0209129_1000027
795 Ga0209673_1002844
796 Ga0209673_1010832
797 Ga0209673_1012145
798 Ga0209673_1015129
799 Ga0209673_1017499
800 Ga0209673_1030462
801 Ga0209564_1000008
802 Ga0209564_1000139
803 Ga0209758_1000281
804 Ga0209758_1000310
805 Ga0209050_1000303
806 Ga0209050_1003036
807 Ga0209256_1001514
808 Ga0209256_1001861
809 Ga0209051_1000025
810 Ga0209051_1001714
811 Ga0209257_1000039
812 Ga0209257_1002401
813 Ga0209257_1003376
814 Ga0207656_10034200
815 Ga0207656_10064330
816 Ga0207710_10235578
817 Ga0207688_10170936
818 Ga0207680_10002140
819 Ga0207643_10034365
820 Ga0207705_10104251
821 Ga0207705_10196948
822 Ga0207654_10065178
823 Ga0207707_10089670
824 Ga0207695_10009980
825 Ga0207671_10008972
826 Ga0207662_10033979
827 Ga0207649_10016552
828 Ga0207681_10016930
829 Ga0207681_10052456
830 Ga0207681_10179049
831 Ga0207694_10030287
832 Ga0207694_10104881
833 Ga0207694_10253862
834 Ga0207650_10027813
835 Ga0207650_10049583
836 Ga0207650_10064948
837 Ga0207650_10102984
838 Ga0207659_10024900
839 Ga0207659_10051600
840 Ga0207659_10053608
841 Ga0207659_10155123
842 Ga0207659_10398419
843 Ga0207687_10075631
844 Ga0207687_10214643
845 Ga0207644_10000264
846 Ga0207644_10002654
847 Ga0207644_10054169
848 Ga0207690_10072581
849 Ga0207706_10013512
850 Ga0207706_10090309
851 Ga0207706_10300790
852 Ga0207686_10008165
853 Ga0207709_10044667
854 Ga0207709_10122879
855 Ga0207670_10007649
856 Ga0207704_10126274
857 Ga0207665_10026795
858 Ga0207691_10004404
859 Ga0207691_10120320
860 Ga0207691_10132505
861 Ga0207711_10003550
862 Ga0207711_10036357
863 Ga0207711_10114256
864 Ga0207711_10340194
865 Ga0207689_10150648
866 Ga0207689_10178139
867 Ga0207661_10662293
868 Ga0207679_10474929
869 Ga0207667_10394864
870 Ga0207651_10013837
871 Ga0207651_10071872
872 Ga0207651_10160489
873 Ga0207651_10582867
874 Ga0207712_10017553
875 Ga0207712_10096061
876 Ga0207668_10024415
877 Ga0207668_10162670
878 Ga0207640_10047680
879 Ga0207640_10090632
880 Ga0207640_10417206
881 Ga0207658_10010175
882 Ga0207658_10043142
883 Ga0207658_10235615
884 Ga0207677_10001522
885 Ga0207677_10004585
886 Ga0207677_10085928
887 Ga0207677_10092121
888 Ga0207703_10032964
889 Ga0207703_10197881
890 Ga0207639_10081416
891 Ga0207639_10227416
892 Ga0207702_10004429
893 Ga0207641_10003329
894 Ga0207641_10044236
895 Ga0207641_10121062
896 Ga0207648_10010028
897 Ga0207648_10019133
898 Ga0207676_10002741
899 Ga0207676_10003295
900 Ga0207674_10018099
901 Ga0207683_10007622
902 Ga0207683_10115309
903 Ga0207683_10124469
904 Ga0207698_10037653
905 Ga0207698_10180977
906 Ga0207698_10344499
907 Ga0207698_10579900
908 Ga0209389_1009996
909 Ga0209813_10021171
910 Ga0209974_10004079
911 Ga0209974_10017003
912 Ga0268266_10045732
913 Ga0268266_10486108
914 Ga0268265_10119897
915 Ga0268265_10129704
916 Ga0268265_10230848
917 Ga0268264_10094518
918 Ga0268264_10139845
919 Ga0268264_10330437
920 Ga0268264_10387128
921 Ga0307517_10003685
922 Ga0307517_10091143
923 Ga0307515_10000609
924 Ga0307515_10003487
925 Ga0307515_10003934
926 Ga0307515_10018282
927 Ga0307515_10068536
928 Ga0307515_10084430
929 Ga0307515_10355356
930 Ga0307512_10024260
931 Ga0316177_1183037
932 Ga0265330_10000156
933 Ga0265330_10050715
934 Ga0265332_10000157
935 Ga0265332_10007427
936 Ga0265329_10016464
937 Ga0265327_10000320
938 Ga0307513_10082183
939 Ga0307509_10000991
940 Ga0307509_10040089
941 Ga0307509_10104924
942 Ga0307408_100000557
943 Ga0307408_100415677
944 Ga0307508_10000404
945 Ga0307508_10005736
946 Ga0307508_10011564
947 Ga0307514_10000355
948 Ga0307514_10032476
949 Ga0307514_10227514
950 Ga0265314_10000446
951 Ga0265314_10006203
952 Ga0307516_10001752
953 Ga0307516_10054923
954 Ga0307405_10006962
955 Ga0307406_10001107
956 Ga0307412_10024007
957 Ga0307409_100000580
958 Ga0307409_100630695
959 Ga0307415_100002051
960 Ga0307507_10196072
961 Ga0307510_10003212
962 Ga0307510_10064638
963 Ga0307510_10240837
964 Ga0373934_0152734
965 Ga0373940_0016966
966 Ga0373923_0046311
967 Ga0373939_0023217
968 Ga0373945_0041211
969 Ga0373953_0137579
970 Ga0373956_0048219
971 Ga0373957_0023394
972 Ga0373955_0003334
973 Ga0373931_0001378
974 Ga0373931_0251479
975 Ga0373935_0124622
976 Ga0373933_0011855
977 Ga0373933_0245170
978 Ga0373937_0027728
979 Ga0373937_0229738
980 Ga0373937_0263158
981 Ga0395905_0000728
982 Ga0395905_0023956
983 Ga0395905_0211772
984 Ga0436361_0287659
985 Ga0436361_0511282
986 Ga0436363_1431319
987 Ga0451795_0415125
988 Ga0451798_0351599
989 Ga0451800_0189236
990 Ga0451802_1131562
991 Ga0451807_2220868
992 Ga0451845_0990444
993 Ga0451853_0858034
994 Ga0451853_3805220
995 Ga0439462_0003124
996 Ga0439464_0044277
997 Ga0451577_0003533
998 Ga0451577_0004221
999 Ga0451577_0035475
1000 Ga0451577_0323479
1001 Ga0466966_0025704
1002 Ga0466961_0016632
1003 Ga0453684_0029736
1004 Ga0466971_0007541
1005 Ga0451576_0010377
1006 Ga0451576_0092795
1007 Ga0495592_0000083
1008 Ga0495590_0032942
1009 Ga0495638_0048022
1010 Ga0495641_0111711
1011 Ga0495580_0018628
1012 Ga0495662_0214486
1013 Ga0495628_0009672
1014 Ga0495632_0002758
1015 Ga0495632_0023888
1016 Ga0495632_0063426
1017 Ga0495643_0107709
1018 Ga0495652_0002976
1019 Ga0495597_0004807
1020 Ga0495597_0044110
1021 Ga0495645_0000247
1022 Ga0495668_0170113
1023 Ga0495625_0009747
1024 Ga0495625_0127538
1025 Ga0495635_0096618
1026 Ga0495599_0000345
1027 Ga0495647_0061381
1028 Ga0495669_0263014
1029 Ga0495613_0064653
1030 Ga0495624_0016323
1031 Ga0495670_0143205
1032 Ga0495649_0003342
1033 Ga0495674_0122440
1034 Ga0495676_0050153
1035 Ga0495680_0119830
1036 Ga0495680_0363982
1037 Ga0495687_000961
1038 Ga0495687_011873
1039 Ga0495677_0128348
1040 Ga0495684_0282774
1041 Ga0495686_0003513
1042 Ga0495686_0218332
1043 Ga0495626_0136421
1044 Ga0496102_0018445
1045 Ga0496104_0032470
1046 Ga0496106_0082196
1047 Ga0496108_0011606
1048 Ga0496108_0023125
1049 Ga0496108_0025181
1050 Ga0496109_0010074
1051 Ga0496109_0071476
1052 Ga0496109_0089695
1053 Ga0496111_0133104
1054 Ga0496111_0261875
1055 Ga0496112_0461023
1056 Ga0496114_0049088
1057 Ga0496114_0113261
1058 Ga0496115_0037521
1059 Ga0496121_0044309
1060 Ga0501031_0012636
1061 Ga0501040_0004390
1062 Ga0501042_0003021
1063 Ga0501043_0249868
1064 Ga0501046_0003243
1065 Ga0501047_0410366
1066 Ga0501048_0007325
1067 Ga0501068_0002746
1068 Ga0501070_0239216
1069 Ga0501072_0011492
1070 Ga0501075_0004962
1071 Ga0501076_0023753
1072 Ga0501076_0037359
1073 Ga0501077_0022192
1074 Ga0501223_012639
1075 Ga0501079_0041234
1076 Ga0501035_0203385
1077 nmdc:mga03683_101847_c1
1078 nmdc:mga03683_121045_c1
1079 nmdc:mga03683_49503_c1
1080 nmdc:mga03n38_50923_c1
1081 nmdc:mga00v17_51711_c1
1082 nmdc:mga0yw44_26539_c1
1083 nmdc:mga0k408_108273_c1
1084 nmdc:mga0k408_12351_c1
1085 nmdc:mga0k408_12774_c1
1086 nmdc:mga0k408_247766_c1
1087 nmdc:mga0k408_284072_c1
1088 nmdc:mga0k408_287_c1
1089 nmdc:mga0k408_29299_c1
1090 nmdc:mga0k408_3129_c1
1091 nmdc:mga0k408_42457_c1
1092 nmdc:mga0k408_4278_c1
1093 nmdc:mga0k408_7247_c1
1094 nmdc:mga0k408_78476_c1
1095 nmdc:mga06z11_122159_c1
1096 nmdc:mga06z11_5767_c1
1097 nmdc:mga06z11_79525_c1
1098 nmdc:mga04h51_32611_c1
1099 nmdc:mga04h51_5532_c1
1100 nmdc:mga07m45_12296_c1
1101 nmdc:mga07m45_135061_c1
1102 nmdc:mga07m45_135723_c1
1103 nmdc:mga07m45_137487_c1
1104 nmdc:mga07m45_178285_c1
1105 nmdc:mga07m45_18900_c1
1106 nmdc:mga07m45_189525_c1
1107 nmdc:mga07m45_23650_c1
1108 nmdc:mga07m45_27453_c1
1109 nmdc:mga07m45_284600_c1
1110 nmdc:mga07m45_29411_c1
1111 nmdc:mga07m45_3946_c1
1112 nmdc:mga07m45_84513_c1
1113 nmdc:mga07m45_91426_c1
1114 nmdc:mga07m45_9149_c1
1115 nmdc:mga09592_9896_c1
1116 nmdc:mga0qj67_15077_c1
1117 nmdc:mga0a205_324012_c1
1118 nmdc:mga0sz30_1941_c1
1119 Ga0495601_0082952
1120 Ga0495619_0137928
1121 Ga0500578_0000363
1122 Ga0500644_0058659
1123 Ga0500651_0198496
1124 Ga0500594_0004214
1125 Ga0500642_0007976
1126 Ga0500652_010242
1127 Ga0500655_030131
1128 Ga0500658_0000889
1129 Ga0500658_0063219
1130 Ga0500559_0000019
1131 Ga0500568_0002988
1132 Ga0500568_0008342
1133 Ga0500619_000171
1134 Ga0500622_0003170
1135 Ga0500622_0004274
1136 Ga0500622_0029190
1137 Ga0500622_0084597
1138 Ga0500570_141840
1139 Ga0500645_001960
1140 Ga0500587_002884
1141 Ga0501084_0005520
1142 Ga0590075_048045
1143 Ga0587090_002855
1144 Ga0587111_0002835
1145 Ga0501082_0029179
1146 Ga0466962_0018473
1147 2587724924
1148 2587731709
1149 2587754194
1150 2588292426
1151 2643867735
1152 2643968194
1153 2643991598
1154 2644142450
1155 2644277051
1156 2644293344
1157 2886851959
1158 2990713956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

20

232

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8497 21 244
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8361 21 244
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.8214 21 246
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.8055 21 246
7ard-assembly1.cif.gz_Y cryo-em structure of polytomella complex-i (complete composition) 0.3627 118 252
ID Description Score Start End Superfamily
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4542 67 249 1.20.1640.10
af_P9WJV5_535_729_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4316 67 249 1.20.1640.10
af_Q9N2Z6_260_461_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4232 69 251 1.20.1640.10
af_P37746_280_415_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3852 121 250 1.20.1070.10
af_Q9N2Z6_260_461_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3756 69 251 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A2L1GQH2-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.948 119 247 GO:0016020
AF-A0A4Q3WEQ3-F1-model_v4 Twin-arginine translocase subunit TatC 0.933 96 246 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A840S0E9-F1-model_v4 Sec-independent protein translocase protein TatC 0.9285 2 259 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A1Q4C8A2-F1-model_v4 deleted 0.9271 13 258
AF-A0A1V4GQT0-F1-model_v4 Sec-independent protein translocase protein TatC 0.922 19 250 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Map