F465834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 282 | 1158 | 461 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10076682|Ga0207707_100766822 |
| Length | 537 |
| Sequence | VGRPFSLPSGNPFAFAQLAAPHASPSAARKDPPGIAVARRLRNSGRIPLPDRGMAQQPITLIGGGLVGALLAQQLAGRGFAVDVYEKRPDPRLSGFLGRSSASCARGTRPSMDSGGRSINLALAERGLQALRTAGLADDVLQRAVMMRGRMVHDRDGHSGLQRYGVDDSEVIWSVSRGTLNMLLLDAAEAVGVRFHFGQSLVGADFGRQRIRLADEAGVQRELDAGLLIGADGAGSAVRAAMNAHAPLGERIESLGHGYKELEIPPAGELPAAVLQLSGGREQFALEPHALHIWPRGGYMCIALPNTEGSFTVTLFLPAQGAAPSFATLPDATAAAAFFREQFPGLLPLIPDFSKDFDSHPVGTLSTLYLERWHLDGRALLIGDAAHAIVPFHGQGMNCGFEDTVVLTELLAAAPDDSVGVFAEFQRMRQPNADAIAAMALENYVEMRDSVADPHYLAKRELGSALAARIPGHYMARYRLVTFTHVPYAYALERGRAQDRLLEQLLRDTPNVAEIDIDAAAQLFQSTLEPLPRLRHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 75 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 142 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 147 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 148 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 149 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 152 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 153 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 207 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 208 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 209 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 210 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 229 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 230 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 231 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 232 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 233 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 234 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 235 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 236 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 237 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 238 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 239 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 240 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 241 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 242 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 243 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 244 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 245 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 246 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 247 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 248 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 249 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 250 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 251 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 252 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 253 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 254 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 255 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 256 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 257 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 258 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 259 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 260 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 261 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 262 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 263 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 264 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 265 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 266 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 267 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 268 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 269 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 270 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 271 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 272 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 273 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 274 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 275 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 276 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 277 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 278 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 279 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 280 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 281 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 282 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.85 |
| Metatranscriptomes | 0.35 |
| Isolates | 8.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 23.83 |
| Nodule | 0.17 |
| Rhizoplane | 2.59 |
| Rhizosphere | 51.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207707_10076682 | 3300025912 | Bacteria | 2917 |
| 2 | JGI24739J22299_10000042 | 3300001989 | Bacteria | 34840 |
| 3 | JGI24739J22299_10000993 | 3300001989 | Bacteria | 10563 |
| 4 | JGI24737J22298_10009924 | 3300001990 | Bacteria | 3152 |
| 5 | JGI24735J21928_10003420 | 3300002067 | Bacteria | 5412 |
| 6 | JGI25156J39149_1000899 | 3300002705 | Bacteria | 14621 |
| 7 | JGI25156J39149_1002483 | 3300002705 | Bacteria | 6572 |
| 8 | JGI25162J39368_1000068 | 3300002737 | Bacteria | 129594 |
| 9 | JGI25162J39368_1000529 | 3300002737 | Bacteria | 28464 |
| 10 | JGI25162J39368_1000746 | 3300002737 | Bacteria | 22266 |
| 11 | JGI25162J39368_1001106 | 3300002737 | Bacteria | 16314 |
| 12 | JGI25162J39368_1001478 | 3300002737 | Bacteria | 12327 |
| 13 | JGI25162J39368_1002607 | 3300002737 | Bacteria | 6750 |
| 14 | JGI25157J39369_1000198 | 3300002741 | Bacteria | 50968 |
| 15 | JGI25157J39369_1000446 | 3300002741 | Bacteria | 26463 |
| 16 | JGI25157J39369_1000503 | 3300002741 | Bacteria | 24065 |
| 17 | JGI25157J39369_1000649 | 3300002741 | Bacteria | 19381 |
| 18 | JGI25157J39369_1002597 | 3300002741 | Bacteria | 4300 |
| 19 | JGI25163J39215_1001143 | 3300002771 | Bacteria | 5223 |
| 20 | JGI25164J39214_1000102 | 3300002772 | Bacteria | 83707 |
| 21 | JGI25164J39214_1000142 | 3300002772 | Bacteria | 68956 |
| 22 | JGI25164J39214_1000366 | 3300002772 | Bacteria | 26967 |
| 23 | JGI25164J39214_1000443 | 3300002772 | Bacteria | 22266 |
| 24 | JGI25152J39213_1000032 | 3300002773 | Bacteria | 96369 |
| 25 | JGI25150J39212_1000179 | 3300002774 | Bacteria | 35481 |
| 26 | JGI25151J46595_10000138 | 3300003187 | Bacteria | 96369 |
| 27 | JGI25165J46597_1000058 | 3300003214 | Bacteria | 212833 |
| 28 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 29 | JGI25165J46597_1000405 | 3300003214 | Bacteria | 45672 |
| 30 | JGI25165J46597_1003705 | 3300003214 | Bacteria | 3639 |
| 31 | JGI25153J46596_10000102 | 3300003215 | Bacteria | 96369 |
| 32 | JGI25153J46596_10016785 | 3300003215 | Bacteria | 2916 |
| 33 | rootH1_10069378 | 3300003316 | Bacteria | 4391 |
| 34 | rootH2_10011619 | 3300003320 | Bacteria | 16641 |
| 35 | Ga0006562J51391_1070642 | 3300003578 | Bacteria | 2940 |
| 36 | Ga0055538_1000912 | 3300003751 | Bacteria | 7323 |
| 37 | Ga0055533_1002518 | 3300003756 | Bacteria | 4129 |
| 38 | Ga0055533_1003187 | 3300003756 | Bacteria | 3407 |
| 39 | Ga0055533_1005874 | 3300003756 | Bacteria | 1904 |
| 40 | Ga0055525_1000282 | 3300003759 | Bacteria | 46609 |
| 41 | Ga0055527_1000048 | 3300003760 | Bacteria | 105299 |
| 42 | Ga0055527_1000105 | 3300003760 | Bacteria | 60329 |
| 43 | Ga0055527_1000125 | 3300003760 | Bacteria | 54169 |
| 44 | Ga0055527_1000630 | 3300003760 | Bacteria | 11018 |
| 45 | Ga0055535_1000034 | 3300003761 | Bacteria | 181954 |
| 46 | Ga0055535_1000150 | 3300003761 | Bacteria | 74086 |
| 47 | Ga0055535_1000170 | 3300003761 | Bacteria | 70208 |
| 48 | Ga0055535_1000765 | 3300003761 | Bacteria | 23814 |
| 49 | Ga0055535_1001380 | 3300003761 | Bacteria | 12637 |
| 50 | Ga0055535_1001421 | 3300003761 | Bacteria | 12270 |
| 51 | Ga0055542_1000081 | 3300003762 | Bacteria | 129595 |
| 52 | Ga0055542_1000112 | 3300003762 | Bacteria | 107429 |
| 53 | Ga0055542_1000118 | 3300003762 | Bacteria | 105368 |
| 54 | Ga0055542_1000198 | 3300003762 | Bacteria | 74085 |
| 55 | Ga0055542_1000685 | 3300003762 | Bacteria | 26937 |
| 56 | Ga0055542_1001350 | 3300003762 | Bacteria | 12637 |
| 57 | Ga0055542_1001389 | 3300003762 | Bacteria | 12270 |
| 58 | Ga0055529_1000083 | 3300003763 | Bacteria | 146729 |
| 59 | Ga0055529_1000132 | 3300003763 | Bacteria | 105368 |
| 60 | Ga0055529_1000305 | 3300003763 | Bacteria | 56629 |
| 61 | Ga0055529_1000343 | 3300003763 | Bacteria | 51957 |
| 62 | Ga0055526_1000413 | 3300003771 | Bacteria | 34618 |
| 63 | Ga0055537_1000349 | 3300003773 | Bacteria | 31443 |
| 64 | Ga0055524_1008744 | 3300003775 | Bacteria | 4182 |
| 65 | Ga0055534_1000073 | 3300003784 | Bacteria | 77473 |
| 66 | Ga0055528_1000080 | 3300003790 | Bacteria | 75390 |
| 67 | Ga0055530_10001767 | 3300003791 | Bacteria | 15103 |
| 68 | Ga0055530_10003477 | 3300003791 | Bacteria | 8935 |
| 69 | Ga0058692_1000023 | 3300003856 | Bacteria | 237263 |
| 70 | Ga0065165_1000001 | 3300005262 | Bacteria | 494087 |
| 71 | Ga0065165_1003057 | 3300005262 | Bacteria | 12525 |
| 72 | Ga0065704_10073413 | 3300005289 | Bacteria | 7197 |
| 73 | Ga0070658_10014243 | 3300005327 | Bacteria | 6381 |
| 74 | Ga0070670_100005062 | 3300005331 | Bacteria | 11088 |
| 75 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 76 | Ga0070680_100132190 | 3300005336 | Bacteria | 2089 |
| 77 | Ga0070682_100005891 | 3300005337 | Bacteria | 6852 |
| 78 | Ga0070682_100017419 | 3300005337 | Bacteria | 4188 |
| 79 | Ga0070660_100016267 | 3300005339 | Bacteria | 5396 |
| 80 | Ga0070689_100096116 | 3300005340 | Bacteria | 2341 |
| 81 | Ga0070661_100014230 | 3300005344 | Bacteria | 5603 |
| 82 | Ga0070659_100001123 | 3300005366 | Bacteria | 19527 |
| 83 | Ga0070659_100091641 | 3300005366 | Bacteria | 2436 |
| 84 | Ga0070667_100018857 | 3300005367 | Bacteria | 5721 |
| 85 | Ga0070714_100000939 | 3300005435 | Bacteria | 20729 |
| 86 | Ga0070714_100007346 | 3300005435 | Bacteria | 8570 |
| 87 | Ga0070713_100002465 | 3300005436 | Bacteria | 12079 |
| 88 | Ga0070681_10003155 | 3300005458 | Bacteria | 15329 |
| 89 | Ga0070685_10001904 | 3300005466 | Bacteria | 10846 |
| 90 | Ga0068853_100006103 | 3300005539 | Bacteria | 9541 |
| 91 | Ga0068853_100032558 | 3300005539 | Bacteria | 4416 |
| 92 | Ga0070696_100008073 | 3300005546 | Bacteria | 7035 |
| 93 | Ga0070696_100017249 | 3300005546 | Bacteria | 4872 |
| 94 | Ga0070665_100016441 | 3300005548 | Bacteria | 7418 |
| 95 | Ga0070665_100062091 | 3300005548 | Bacteria | 3746 |
| 96 | Ga0068855_100039384 | 3300005563 | Bacteria | 5610 |
| 97 | Ga0068855_100084500 | 3300005563 | Bacteria | 3674 |
| 98 | Ga0068855_100088408 | 3300005563 | Bacteria | 3579 |
| 99 | Ga0068854_100007994 | 3300005578 | Bacteria | 6775 |
| 100 | Ga0068856_100002390 | 3300005614 | Bacteria | 19310 |
| 101 | Ga0068856_100002901 | 3300005614 | Bacteria | 17553 |
| 102 | Ga0068856_100040275 | 3300005614 | Bacteria | 4588 |
| 103 | Ga0068858_100019131 | 3300005842 | Bacteria | 6407 |
| 104 | Ga0068862_100130201 | 3300005844 | Bacteria | 2225 |
| 105 | Ga0075364_10015664 | 3300006051 | Bacteria | 4705 |
| 106 | Ga0075367_10026170 | 3300006178 | Bacteria | 3306 |
| 107 | Ga0105251_10000108 | 3300009011 | Bacteria | 81679 |
| 108 | Ga0105251_10006958 | 3300009011 | Bacteria | 7082 |
| 109 | Ga0105240_10013498 | 3300009093 | Bacteria | 11219 |
| 110 | Ga0105240_10072871 | 3300009093 | Bacteria | 4243 |
| 111 | Ga0105240_10086921 | 3300009093 | Bacteria | 3829 |
| 112 | Ga0105240_10092054 | 3300009093 | Bacteria | 3703 |
| 113 | Ga0105240_10132088 | 3300009093 | Bacteria | 2994 |
| 114 | Ga0105243_10067280 | 3300009148 | Bacteria | 2883 |
| 115 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 116 | Ga0105237_10001198 | 3300009545 | Bacteria | 34705 |
| 117 | Ga0105238_10000060 | 3300009551 | Bacteria | 129934 |
| 118 | Ga0105238_10070855 | 3300009551 | Bacteria | 3484 |
| 119 | Ga0105239_10000044 | 3300010375 | Bacteria | 187680 |
| 120 | Ga0157373_10010095 | 3300013100 | Bacteria | 6957 |
| 121 | Ga0157373_10014543 | 3300013100 | Bacteria | 5769 |
| 122 | Ga0157373_10029899 | 3300013100 | Bacteria | 3922 |
| 123 | Ga0157373_10051211 | 3300013100 | Bacteria | 2941 |
| 124 | Ga0157373_10079818 | 3300013100 | Bacteria | 2308 |
| 125 | Ga0157371_10003647 | 3300013102 | Bacteria | 13861 |
| 126 | Ga0157371_10014602 | 3300013102 | Bacteria | 5920 |
| 127 | Ga0157371_10026030 | 3300013102 | Bacteria | 4257 |
| 128 | Ga0157371_10075801 | 3300013102 | Bacteria | 2382 |
| 129 | Ga0157370_10001227 | 3300013104 | Bacteria | 32113 |
| 130 | Ga0157370_10005668 | 3300013104 | Bacteria | 13956 |
| 131 | Ga0157370_10050405 | 3300013104 | Bacteria | 3979 |
| 132 | Ga0157370_10065362 | 3300013104 | Bacteria | 3441 |
| 133 | Ga0157369_10000364 | 3300013105 | Bacteria | 60361 |
| 134 | Ga0157369_10005722 | 3300013105 | Bacteria | 14438 |
| 135 | Ga0163162_10055455 | 3300013306 | Bacteria | 3990 |
| 136 | Ga0157372_10009601 | 3300013307 | Bacteria | 10283 |
| 137 | Ga0157372_10016735 | 3300013307 | Bacteria | 7871 |
| 138 | Ga0182008_10002089 | 3300014497 | Bacteria | 12754 |
| 139 | Ga0182008_10002596 | 3300014497 | Bacteria | 11222 |
| 140 | Ga0182008_10025633 | 3300014497 | Bacteria | 2995 |
| 141 | Ga0182006_1007530 | 3300015261 | Bacteria | 4975 |
| 142 | Ga0182006_1012898 | 3300015261 | Bacteria | 3646 |
| 143 | Ga0182007_10000353 | 3300015262 | Bacteria | 29023 |
| 144 | Ga0182007_10009307 | 3300015262 | Bacteria | 3971 |
| 145 | Ga0182007_10020351 | 3300015262 | Bacteria | 2373 |
| 146 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 147 | Ga0182005_1000344 | 3300015265 | Bacteria | 26562 |
| 148 | Ga0183369_1012 | 3300015685 | Bacteria | 251554 |
| 149 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 150 | Ga0163161_10007121 | 3300017792 | Bacteria | 7732 |
| 151 | Ga0163161_10012244 | 3300017792 | Bacteria | 5951 |
| 152 | Ga0206353_11824210 | 3300020082 | Bacteria | 2260 |
| 153 | Ga0209760_100462 | 3300025207 | Bacteria | 9090 |
| 154 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 155 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 156 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 157 | Ga0209674_100244 | 3300025226 | Bacteria | 45968 |
| 158 | Ga0209674_100318 | 3300025226 | Bacteria | 31053 |
| 159 | Ga0209674_100489 | 3300025226 | Bacteria | 16826 |
| 160 | Ga0209674_100669 | 3300025226 | Bacteria | 12224 |
| 161 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 162 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 163 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 164 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 165 | Ga0209672_100673 | 3300025228 | Bacteria | 17260 |
| 166 | Ga0209672_102112 | 3300025228 | Bacteria | 5305 |
| 167 | Ga0209563_100169 | 3300025230 | Bacteria | 46948 |
| 168 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 169 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 170 | Ga0207427_100050 | 3300025231 | Bacteria | 227233 |
| 171 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 172 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 173 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 174 | Ga0209437_100120 | 3300025233 | Bacteria | 205054 |
| 175 | Ga0209437_100192 | 3300025233 | Bacteria | 122888 |
| 176 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 177 | Ga0209437_102614 | 3300025233 | Bacteria | 3448 |
| 178 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 179 | Ga0209258_100038 | 3300025242 | Bacteria | 398959 |
| 180 | Ga0209258_100039 | 3300025242 | Bacteria | 386366 |
| 181 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 182 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 183 | Ga0209258_100308 | 3300025242 | Bacteria | 77195 |
| 184 | Ga0209258_101017 | 3300025242 | Bacteria | 12688 |
| 185 | Ga0209258_104741 | 3300025242 | Bacteria | 2488 |
| 186 | Ga0207425_1000078 | 3300025245 | Bacteria | 104429 |
| 187 | Ga0209646_1000307 | 3300025246 | Bacteria | 39199 |
| 188 | Ga0209646_1000581 | 3300025246 | Bacteria | 15100 |
| 189 | Ga0209646_1006311 | 3300025246 | Bacteria | 1998 |
| 190 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 191 | Ga0209026_1000140 | 3300025250 | Bacteria | 115081 |
| 192 | Ga0209026_1000158 | 3300025250 | Bacteria | 106333 |
| 193 | Ga0209026_1000249 | 3300025250 | Bacteria | 68455 |
| 194 | Ga0209026_1000623 | 3300025250 | Bacteria | 22318 |
| 195 | Ga0209677_102331 | 3300025253 | Bacteria | 7288 |
| 196 | Ga0209677_104968 | 3300025253 | Bacteria | 3623 |
| 197 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 198 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 199 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 200 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 201 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 202 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 203 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 204 | Ga0209148_1002736 | 3300025254 | Bacteria | 5601 |
| 205 | Ga0209759_1000750 | 3300025256 | Bacteria | 28083 |
| 206 | Ga0209759_1000852 | 3300025256 | Bacteria | 23718 |
| 207 | Ga0209759_1002326 | 3300025256 | Bacteria | 8526 |
| 208 | Ga0209759_1003116 | 3300025256 | Bacteria | 6798 |
| 209 | Ga0209759_1010047 | 3300025256 | Bacteria | 2808 |
| 210 | Ga0209129_1000157 | 3300025258 | Bacteria | 105043 |
| 211 | Ga0209129_1002030 | 3300025258 | Bacteria | 10476 |
| 212 | Ga0209129_1008599 | 3300025258 | Bacteria | 2821 |
| 213 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 214 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 215 | Ga0209233_1000174 | 3300025261 | Bacteria | 144639 |
| 216 | Ga0209233_1000184 | 3300025261 | Bacteria | 134246 |
| 217 | Ga0209233_1000283 | 3300025261 | Bacteria | 70137 |
| 218 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 219 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 220 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 221 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 222 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 223 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 224 | Ga0209455_1001030 | 3300025272 | Bacteria | 13880 |
| 225 | Ga0209455_1004445 | 3300025272 | Bacteria | 4585 |
| 226 | Ga0209673_1000087 | 3300025273 | Bacteria | 205213 |
| 227 | Ga0209130_1006405 | 3300025284 | Bacteria | 3832 |
| 228 | Ga0209675_1000060 | 3300025291 | Bacteria | 184316 |
| 229 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 230 | Ga0209564_1000302 | 3300025295 | Bacteria | 97770 |
| 231 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 232 | Ga0209758_1002406 | 3300025297 | Bacteria | 19172 |
| 233 | Ga0209758_1037412 | 3300025297 | Bacteria | 1877 |
| 234 | Ga0209050_1001760 | 3300025298 | Bacteria | 21464 |
| 235 | Ga0209050_1002154 | 3300025298 | Bacteria | 17919 |
| 236 | Ga0209256_1003341 | 3300025299 | Bacteria | 11380 |
| 237 | Ga0209256_1005490 | 3300025299 | Bacteria | 7267 |
| 238 | Ga0209256_1012323 | 3300025299 | Bacteria | 3295 |
| 239 | Ga0209051_1000606 | 3300025303 | Bacteria | 41704 |
| 240 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 241 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 242 | Ga0209257_1006948 | 3300025304 | Bacteria | 7058 |
| 243 | Ga0207713_1000507 | 3300025735 | Bacteria | 39676 |
| 244 | Ga0207713_1007579 | 3300025735 | Bacteria | 6371 |
| 245 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 246 | Ga0207647_10001002 | 3300025904 | Bacteria | 21914 |
| 247 | Ga0207647_10007576 | 3300025904 | Bacteria | 7831 |
| 248 | Ga0207647_10020707 | 3300025904 | Bacteria | 4406 |
| 249 | Ga0207705_10011525 | 3300025909 | Bacteria | 6394 |
| 250 | Ga0207705_10014974 | 3300025909 | Bacteria | 5575 |
| 251 | Ga0207707_10006499 | 3300025912 | Bacteria | 10209 |
| 252 | Ga0207695_10000294 | 3300025913 | Bacteria | 123676 |
| 253 | Ga0207695_10001068 | 3300025913 | Bacteria | 47945 |
| 254 | Ga0207695_10002599 | 3300025913 | Bacteria | 26471 |
| 255 | Ga0207695_10002825 | 3300025913 | Bacteria | 25239 |
| 256 | Ga0207695_10041406 | 3300025913 | Bacteria | 4931 |
| 257 | Ga0207695_10063941 | 3300025913 | Bacteria | 3791 |
| 258 | Ga0207695_10093960 | 3300025913 | Bacteria | 3007 |
| 259 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 260 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 261 | Ga0207671_10001191 | 3300025914 | Bacteria | 30871 |
| 262 | Ga0207693_10197695 | 3300025915 | Bacteria | 1581 |
| 263 | Ga0207657_10024290 | 3300025919 | Bacteria | 5619 |
| 264 | Ga0207652_10038799 | 3300025921 | Bacteria | 4039 |
| 265 | Ga0207694_10000332 | 3300025924 | Bacteria | 44554 |
| 266 | Ga0207650_10005976 | 3300025925 | Bacteria | 8307 |
| 267 | Ga0207664_10000036 | 3300025929 | Bacteria | 173396 |
| 268 | Ga0207690_10001378 | 3300025932 | Bacteria | 15253 |
| 269 | Ga0207690_10010521 | 3300025932 | Bacteria | 5504 |
| 270 | Ga0207690_10021020 | 3300025932 | Bacteria | 4042 |
| 271 | Ga0207690_10029938 | 3300025932 | Bacteria | 3466 |
| 272 | Ga0207709_10039628 | 3300025935 | Bacteria | 2815 |
| 273 | Ga0207670_10002849 | 3300025936 | Bacteria | 9128 |
| 274 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 275 | Ga0207667_10000293 | 3300025949 | Bacteria | 69188 |
| 276 | Ga0207667_10040028 | 3300025949 | Bacteria | 4990 |
| 277 | Ga0207667_10127990 | 3300025949 | Bacteria | 2616 |
| 278 | Ga0207640_10000103 | 3300025981 | Bacteria | 65214 |
| 279 | Ga0207640_10003468 | 3300025981 | Bacteria | 8492 |
| 280 | Ga0207640_10091996 | 3300025981 | Bacteria | 2103 |
| 281 | Ga0207639_10008066 | 3300026041 | Bacteria | 7199 |
| 282 | Ga0207678_10058827 | 3300026067 | Bacteria | 3307 |
| 283 | Ga0207702_10000290 | 3300026078 | Bacteria | 58330 |
| 284 | Ga0207702_10005453 | 3300026078 | Bacteria | 11129 |
| 285 | Ga0207674_10000218 | 3300026116 | Bacteria | 71563 |
| 286 | Ga0207674_10024726 | 3300026116 | Bacteria | 6411 |
| 287 | Ga0207674_10086415 | 3300026116 | Bacteria | 3131 |
| 288 | Ga0209371_1000059 | 3300027312 | Bacteria | 237154 |
| 289 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 290 | Ga0268265_10190811 | 3300028380 | Bacteria | 1769 |
| 291 | Ga0268256_1000055 | 3300030500 | Bacteria | 237299 |
| 292 | Ga0316181_1273914 | 3300030744 | Bacteria | 4325 |
| 293 | Ga0307412_10005560 | 3300031911 | Bacteria | 7075 |
| 294 | Ga0307412_10007331 | 3300031911 | Bacteria | 6255 |
| 295 | Ga0307412_10234954 | 3300031911 | Bacteria | 1414 |
| 296 | Ga0307416_100359095 | 3300032002 | Bacteria | 1478 |
| 297 | Ga0307414_10049447 | 3300032004 | Bacteria | 2907 |
| 298 | Ga0395899_0000046 | 3300037312 | Bacteria | 242486 |
| 299 | Ga0395899_0000175 | 3300037312 | Bacteria | 95781 |
| 300 | Ga0395899_0009328 | 3300037312 | Bacteria | 7536 |
| 301 | Ga0395899_0077296 | 3300037312 | Bacteria | 2428 |
| 302 | Ga0395899_0109019 | 3300037312 | Bacteria | 1992 |
| 303 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 304 | Ga0395900_0000039 | 3300037418 | Bacteria | 248722 |
| 305 | Ga0395900_0020607 | 3300037418 | Bacteria | 6735 |
| 306 | Ga0395900_0056221 | 3300037418 | Bacteria | 4051 |
| 307 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 308 | Ga0395898_0000197 | 3300037466 | Bacteria | 155187 |
| 309 | Ga0395898_0053114 | 3300037466 | Bacteria | 3957 |
| 310 | Ga0395898_0053718 | 3300037466 | Bacteria | 3934 |
| 311 | Ga0395898_0113447 | 3300037466 | Bacteria | 2597 |
| 312 | Ga0395898_0147621 | 3300037466 | Bacteria | 2250 |
| 313 | Ga0395901_0005891 | 3300038443 | Bacteria | 12404 |
| 314 | Ga0395901_0060044 | 3300038443 | Bacteria | 3956 |
| 315 | Ga0395901_0134582 | 3300038443 | Bacteria | 2597 |
| 316 | Ga0395901_0186022 | 3300038443 | Bacteria | 2178 |
| 317 | Ga0395901_0326608 | 3300038443 | Bacteria | 1587 |
| 318 | Ga0237819_00252 | 3300038705 | Bacteria | 19595 |
| 319 | Ga0439436_0000014 | 3300041404 | Bacteria | 90241 |
| 320 | Ga0439465_0003345 | 3300041413 | Bacteria | 5237 |
| 321 | Ga0451791_0221684 | 3300041451 | Bacteria | 3164 |
| 322 | Ga0451793_0417357 | 3300041452 | Bacteria | 1836 |
| 323 | Ga0451800_0139849 | 3300041459 | Bacteria | 5083 |
| 324 | Ga0451807_0813515 | 3300041486 | Bacteria | 2540 |
| 325 | Ga0451833_0048849 | 3300041491 | Bacteria | 1662 |
| 326 | Ga0451837_1456316 | 3300041494 | Bacteria | 4960 |
| 327 | Ga0451843_0383473 | 3300041509 | Bacteria | 2929 |
| 328 | Ga0450908_000020 | 3300042184 | Bacteria | 37390 |
| 329 | Ga0466969_0006890 | 3300044656 | Bacteria | 6049 |
| 330 | Ga0466969_0011780 | 3300044656 | Bacteria | 4624 |
| 331 | Ga0466972_0001559 | 3300044658 | Bacteria | 11179 |
| 332 | Ga0466975_0039304 | 3300044661 | Bacteria | 3339 |
| 333 | Ga0466982_0001571 | 3300044672 | Bacteria | 8499 |
| 334 | Ga0466966_0015868 | 3300044684 | Bacteria | 4979 |
| 335 | Ga0466966_0030247 | 3300044684 | Bacteria | 3516 |
| 336 | Ga0466961_0000983 | 3300044693 | Bacteria | 17675 |
| 337 | Ga0466961_0009198 | 3300044693 | Bacteria | 6290 |
| 338 | Ga0466961_0011333 | 3300044693 | Bacteria | 5701 |
| 339 | Ga0466961_0031621 | 3300044693 | Bacteria | 3402 |
| 340 | Ga0466961_0083008 | 3300044693 | Bacteria | 2026 |
| 341 | Ga0466963_0135867 | 3300044694 | Bacteria | 1701 |
| 342 | Ga0466971_0004168 | 3300044719 | Bacteria | 6230 |
| 343 | Ga0466971_0009512 | 3300044719 | Bacteria | 4244 |
| 344 | Ga0466971_0013357 | 3300044719 | Bacteria | 3606 |
| 345 | Ga0466968_0008983 | 3300044735 | Bacteria | 3841 |
| 346 | Ga0466970_0001017 | 3300044765 | Bacteria | 13518 |
| 347 | Ga0466970_0013560 | 3300044765 | Bacteria | 4181 |
| 348 | Ga0466970_0039510 | 3300044765 | Bacteria | 2503 |
| 349 | Ga0466970_0046877 | 3300044765 | Bacteria | 2302 |
| 350 | Ga0466970_0104067 | 3300044765 | Bacteria | 1547 |
| 351 | Ga0466957_0006091 | 3300044842 | Bacteria | 6808 |
| 352 | Ga0466957_0100543 | 3300044842 | Bacteria | 1822 |
| 353 | Ga0466959_0054207 | 3300045049 | Bacteria | 2930 |
| 354 | Ga0466959_0055550 | 3300045049 | Bacteria | 2890 |
| 355 | Ga0466959_0081593 | 3300045049 | Bacteria | 2330 |
| 356 | Ga0466958_0005201 | 3300045836 | Bacteria | 6972 |
| 357 | Ga0466958_0115596 | 3300045836 | Bacteria | 1676 |
| 358 | Ga0466967_0084458 | 3300045976 | Bacteria | 2873 |
| 359 | Ga0495617_000411 | 3300046452 | Bacteria | 23420 |
| 360 | Ga0495617_010690 | 3300046452 | Bacteria | 3143 |
| 361 | Ga0495590_0036029 | 3300046457 | Bacteria | 1726 |
| 362 | Ga0495638_0000159 | 3300046460 | Bacteria | 106490 |
| 363 | Ga0495638_0000161 | 3300046460 | Bacteria | 104406 |
| 364 | Ga0495638_0000246 | 3300046460 | Bacteria | 74281 |
| 365 | Ga0495638_0001421 | 3300046460 | Bacteria | 21733 |
| 366 | Ga0495650_0000197 | 3300046471 | Bacteria | 131300 |
| 367 | Ga0495650_0000590 | 3300046471 | Bacteria | 50202 |
| 368 | Ga0495650_0001258 | 3300046471 | Bacteria | 26169 |
| 369 | Ga0495584_0002602 | 3300046491 | Bacteria | 10162 |
| 370 | Ga0495585_0000623 | 3300046492 | Bacteria | 32946 |
| 371 | Ga0495585_0001230 | 3300046492 | Bacteria | 20734 |
| 372 | Ga0495607_0000046 | 3300046501 | Bacteria | 123998 |
| 373 | Ga0495607_0000508 | 3300046501 | Bacteria | 38562 |
| 374 | Ga0495607_0003198 | 3300046501 | Bacteria | 12654 |
| 375 | Ga0495583_0032424 | 3300046506 | Bacteria | 2521 |
| 376 | Ga0495606_0000356 | 3300046507 | Bacteria | 78185 |
| 377 | Ga0495606_0000940 | 3300046507 | Bacteria | 42915 |
| 378 | Ga0495606_0001458 | 3300046507 | Bacteria | 31590 |
| 379 | Ga0495606_0009272 | 3300046507 | Bacteria | 8352 |
| 380 | Ga0495606_0048591 | 3300046507 | Bacteria | 2789 |
| 381 | Ga0495610_0002744 | 3300046512 | Bacteria | 14471 |
| 382 | Ga0495616_0000062 | 3300046513 | Bacteria | 91197 |
| 383 | Ga0495616_0018719 | 3300046513 | Bacteria | 3794 |
| 384 | Ga0495620_0002390 | 3300046515 | Bacteria | 10873 |
| 385 | Ga0495631_0000157 | 3300046518 | Bacteria | 45751 |
| 386 | Ga0495631_0003247 | 3300046518 | Bacteria | 8939 |
| 387 | Ga0495632_0000003 | 3300046519 | Bacteria | 396071 |
| 388 | Ga0495632_0006126 | 3300046519 | Bacteria | 7795 |
| 389 | Ga0495637_0019037 | 3300046520 | Bacteria | 3179 |
| 390 | Ga0495643_0003481 | 3300046522 | Bacteria | 11485 |
| 391 | Ga0495648_0002187 | 3300046524 | Bacteria | 18314 |
| 392 | Ga0495648_0002466 | 3300046524 | Bacteria | 17025 |
| 393 | Ga0495609_0007018 | 3300046538 | Bacteria | 5677 |
| 394 | Ga0495668_0003971 | 3300046616 | Bacteria | 10778 |
| 395 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 396 | Ga0495611_0000258 | 3300046648 | Bacteria | 36465 |
| 397 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 398 | Ga0495625_0013224 | 3300046660 | Bacteria | 6645 |
| 399 | Ga0495625_0021685 | 3300046660 | Bacteria | 4941 |
| 400 | Ga0495625_0031562 | 3300046660 | Bacteria | 3938 |
| 401 | Ga0495625_0108521 | 3300046660 | Bacteria | 1899 |
| 402 | Ga0495661_0025776 | 3300046665 | Bacteria | 3793 |
| 403 | Ga0495670_0001900 | 3300046691 | Bacteria | 10296 |
| 404 | Ga0495670_0002153 | 3300046691 | Bacteria | 9738 |
| 405 | Ga0495671_0000634 | 3300046692 | Bacteria | 25637 |
| 406 | Ga0495649_0002293 | 3300046694 | Bacteria | 13595 |
| 407 | Ga0495649_0044406 | 3300046694 | Bacteria | 2426 |
| 408 | Ga0495589_0000314 | 3300046794 | Bacteria | 38602 |
| 409 | Ga0495660_0002147 | 3300046810 | Bacteria | 12713 |
| 410 | Ga0495660_0002345 | 3300046810 | Bacteria | 12113 |
| 411 | Ga0495672_0000455 | 3300047320 | Bacteria | 48439 |
| 412 | Ga0495683_0004404 | 3300047323 | Bacteria | 8002 |
| 413 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 414 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 415 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 416 | Ga0495673_0000562 | 3300047469 | Bacteria | 37800 |
| 417 | Ga0495686_0000019 | 3300047472 | Bacteria | 434054 |
| 418 | Ga0495686_0000175 | 3300047472 | Bacteria | 122163 |
| 419 | Ga0495686_0004837 | 3300047472 | Bacteria | 10873 |
| 420 | Ga0495686_0010033 | 3300047472 | Bacteria | 6765 |
| 421 | Ga0495686_0074523 | 3300047472 | Bacteria | 2082 |
| 422 | Ga0496101_0016276 | 3300048904 | Bacteria | 5019 |
| 423 | Ga0496105_0016340 | 3300048908 | Bacteria | 5924 |
| 424 | Ga0496105_0017638 | 3300048908 | Bacteria | 5727 |
| 425 | Ga0496106_0005098 | 3300048909 | Bacteria | 9726 |
| 426 | Ga0496106_0051486 | 3300048909 | Bacteria | 3105 |
| 427 | Ga0496113_0022124 | 3300048916 | Bacteria | 4492 |
| 428 | Ga0496114_0092116 | 3300048917 | Bacteria | 2575 |
| 429 | Ga0496115_0000974 | 3300048918 | Bacteria | 20806 |
| 430 | Ga0496115_0001165 | 3300048918 | Bacteria | 18867 |
| 431 | Ga0496115_0024163 | 3300048918 | Bacteria | 4722 |
| 432 | Ga0496115_0033324 | 3300048918 | Bacteria | 4066 |
| 433 | Ga0496116_0008342 | 3300048919 | Bacteria | 9004 |
| 434 | Ga0496116_0009818 | 3300048919 | Bacteria | 8110 |
| 435 | Ga0496116_0033151 | 3300048919 | Bacteria | 3668 |
| 436 | Ga0496117_0005879 | 3300048920 | Bacteria | 12682 |
| 437 | Ga0496117_0009735 | 3300048920 | Bacteria | 8868 |
| 438 | Ga0496117_0010591 | 3300048920 | Bacteria | 8379 |
| 439 | Ga0496117_0013334 | 3300048920 | Bacteria | 7177 |
| 440 | Ga0496118_0000362 | 3300048921 | Bacteria | 76786 |
| 441 | Ga0496118_0001376 | 3300048921 | Bacteria | 36678 |
| 442 | Ga0496118_0002751 | 3300048921 | Bacteria | 23098 |
| 443 | Ga0496118_0008539 | 3300048921 | Bacteria | 10565 |
| 444 | Ga0496118_0030076 | 3300048921 | Bacteria | 4542 |
| 445 | Ga0496118_0033110 | 3300048921 | Bacteria | 4247 |
| 446 | Ga0496118_0048926 | 3300048921 | Bacteria | 3259 |
| 447 | Ga0496118_0054469 | 3300048921 | Bacteria | 3029 |
| 448 | Ga0496119_0000851 | 3300048922 | Bacteria | 40261 |
| 449 | Ga0496119_0001095 | 3300048922 | Bacteria | 34129 |
| 450 | Ga0496119_0005052 | 3300048922 | Bacteria | 12826 |
| 451 | Ga0496119_0006339 | 3300048922 | Bacteria | 11010 |
| 452 | Ga0496120_0001387 | 3300048923 | Bacteria | 29403 |
| 453 | Ga0496120_0002462 | 3300048923 | Bacteria | 18657 |
| 454 | Ga0496120_0004003 | 3300048923 | Bacteria | 12799 |
| 455 | Ga0496120_0013968 | 3300048923 | Bacteria | 5374 |
| 456 | Ga0496121_0000376 | 3300048924 | Bacteria | 91480 |
| 457 | Ga0496121_0001290 | 3300048924 | Bacteria | 43154 |
| 458 | Ga0496121_0004611 | 3300048924 | Bacteria | 18358 |
| 459 | Ga0496121_0007636 | 3300048924 | Bacteria | 12994 |
| 460 | Ga0496121_0009617 | 3300048924 | Bacteria | 11074 |
| 461 | Ga0496121_0014077 | 3300048924 | Bacteria | 8532 |
| 462 | Ga0496121_0031203 | 3300048924 | Bacteria | 4873 |
| 463 | Ga0496121_0038544 | 3300048924 | Bacteria | 4228 |
| 464 | Ga0496122_0003014 | 3300048925 | Bacteria | 22846 |
| 465 | Ga0496122_0012864 | 3300048925 | Bacteria | 8272 |
| 466 | Ga0496122_0018868 | 3300048925 | Bacteria | 6339 |
| 467 | Ga0496122_0022593 | 3300048925 | Bacteria | 5584 |
| 468 | Ga0496123_0000619 | 3300048926 | Bacteria | 59624 |
| 469 | Ga0496123_0005952 | 3300048926 | Bacteria | 12009 |
| 470 | Ga0496123_0011606 | 3300048926 | Bacteria | 7615 |
| 471 | Ga0496123_0038701 | 3300048926 | Bacteria | 3347 |
| 472 | Ga0496123_0041655 | 3300048926 | Bacteria | 3179 |
| 473 | Ga0496123_0064454 | 3300048926 | Bacteria | 2335 |
| 474 | Ga0496123_0067236 | 3300048926 | Bacteria | 2264 |
| 475 | Ga0496123_0139534 | 3300048926 | Bacteria | 1328 |
| 476 | Ga0496124_0000411 | 3300048927 | Bacteria | 76929 |
| 477 | Ga0496124_0000808 | 3300048927 | Bacteria | 50879 |
| 478 | Ga0496124_0008706 | 3300048927 | Bacteria | 10546 |
| 479 | Ga0496124_0009017 | 3300048927 | Bacteria | 10320 |
| 480 | Ga0496124_0009858 | 3300048927 | Bacteria | 9770 |
| 481 | Ga0496124_0015807 | 3300048927 | Bacteria | 7211 |
| 482 | Ga0496124_0022121 | 3300048927 | Bacteria | 5837 |
| 483 | Ga0496124_0028626 | 3300048927 | Bacteria | 4981 |
| 484 | Ga0496124_0044067 | 3300048927 | Bacteria | 3830 |
| 485 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 486 | Ga0496125_0009078 | 3300048928 | Bacteria | 10287 |
| 487 | Ga0496125_0009310 | 3300048928 | Bacteria | 10130 |
| 488 | Ga0496125_0013084 | 3300048928 | Bacteria | 8182 |
| 489 | Ga0496125_0014372 | 3300048928 | Bacteria | 7713 |
| 490 | Ga0496125_0023264 | 3300048928 | Bacteria | 5723 |
| 491 | Ga0496126_0003518 | 3300048929 | Bacteria | 19705 |
| 492 | Ga0496126_0010449 | 3300048929 | Bacteria | 9727 |
| 493 | Ga0496126_0036762 | 3300048929 | Bacteria | 4576 |
| 494 | Ga0496126_0048515 | 3300048929 | Bacteria | 3879 |
| 495 | Ga0496126_0071889 | 3300048929 | Bacteria | 3078 |
| 496 | Ga0496126_0121700 | 3300048929 | Bacteria | 2262 |
| 497 | Ga0496126_0224678 | 3300048929 | Bacteria | 1575 |
| 498 | Ga0495678_000296 | 3300049459 | Bacteria | 54659 |
| 499 | Ga0495682_0009360 | 3300049460 | Bacteria | 3823 |
| 500 | Ga0495682_0015347 | 3300049460 | Bacteria | 2902 |
| 501 | Ga0501031_0121698 | 3300049568 | Bacteria | 1705 |
| 502 | Ga0501032_0046667 | 3300049569 | Bacteria | 2927 |
| 503 | Ga0501032_0066247 | 3300049569 | Bacteria | 2414 |
| 504 | Ga0501033_0000550 | 3300049570 | Bacteria | 34940 |
| 505 | Ga0501034_0016514 | 3300049571 | Bacteria | 7573 |
| 506 | Ga0501034_0095519 | 3300049571 | Bacteria | 2969 |
| 507 | Ga0501034_0129629 | 3300049571 | Bacteria | 2506 |
| 508 | Ga0501036_0036107 | 3300049572 | Bacteria | 4181 |
| 509 | Ga0501037_0046330 | 3300049573 | Bacteria | 3189 |
| 510 | Ga0501038_0094206 | 3300049574 | Bacteria | 2504 |
| 511 | Ga0501038_0188767 | 3300049574 | Bacteria | 1659 |
| 512 | Ga0501043_0033733 | 3300049579 | Bacteria | 4028 |
| 513 | Ga0501043_0036992 | 3300049579 | Bacteria | 3840 |
| 514 | Ga0501047_0038762 | 3300049581 | Bacteria | 4610 |
| 515 | Ga0501048_0053386 | 3300049582 | Bacteria | 2874 |
| 516 | Ga0501070_0007853 | 3300049586 | Bacteria | 9042 |
| 517 | Ga0501070_0089761 | 3300049586 | Bacteria | 2543 |
| 518 | Ga0501035_0005508 | 3300049822 | Bacteria | 11963 |
| 519 | Ga0501035_0056441 | 3300049822 | Bacteria | 3503 |
| 520 | Ga0501035_0128459 | 3300049822 | Bacteria | 2211 |
| 521 | Ga0501044_0034823 | 3300049823 | Bacteria | 5278 |
| 522 | Ga0501044_0128406 | 3300049823 | Bacteria | 2531 |
| 523 | Ga0501044_0171424 | 3300049823 | Bacteria | 2141 |
| 524 | Ga0501044_0241477 | 3300049823 | Bacteria | 1750 |
| 525 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 526 | Ga0500651_0000413 | 3300053093 | Bacteria | 23063 |
| 527 | Ga0500555_000631 | 3300053103 | Bacteria | 13597 |
| 528 | Ga0500645_001002 | 3300053730 | Bacteria | 15937 |
| 529 | 2525556790 | 2524614729 | Bacteria | 3091755 |
| 530 | 2538834049 | 2537561836 | Bacteria | 3910579 |
| 531 | 2578457869 | 2576861471 | Bacteria | 4648976 |
| 532 | 2595445928 | 2593339238 | Bacteria | 4182970 |
| 533 | 2595452653 | 2593339239 | Bacteria | 4124669 |
| 534 | 2630648386 | 2627854209 | Bacteria | 3093011 |
| 535 | 2643830711 | 2643221562 | Bacteria | 4048635 |
| 536 | 2643894089 | 2643221577 | Bacteria | 3710843 |
| 537 | 2644476292 | 2643221685 | Bacteria | 3673288 |
| 538 | 2687582860 | 2687453130 | Bacteria | 4227172 |
| 539 | 2721027698 | 2718218334 | Bacteria | 4765486 |
| 540 | 2735836742 | 2734482264 | Unclassified | 5014763 |
| 541 | 2739228659 | 2738543009 | Bacteria | 4944499 |
| 542 | 2739731745 | 2739367700 | Bacteria | 4747630 |
| 543 | 2748015777 | 2747842501 | Bacteria | 5293829 |
| 544 | 2819562978 | 2818991440 | Bacteria | 4774720 |
| 545 | 2819663036 | 2818991457 | Bacteria | 5323295 |
| 546 | 2842391887 | 2842391507 | Bacteria | 4486072 |
| 547 | 2842760159 | 2842757796 | Bacteria | 3981385 |
| 548 | 2842916278 | 2842914999 | Bacteria | 4419378 |
| 549 | 2842918904 | 2842918807 | Bacteria | 4289178 |
| 550 | 2852650306 | 2852649853 | Bacteria | 4036942 |
| 551 | 2852685971 | 2852684882 | Bacteria | 5463342 |
| 552 | 2857446784 | 2857442823 | Bacteria | 4562550 |
| 553 | 2874222321 | 2874220319 | Bacteria | 4594709 |
| 554 | 2884340339 | 2884338543 | Bacteria | 4610696 |
| 555 | 2884414073 | 2884411467 | Bacteria | 5246714 |
| 556 | 2895396706 | 2895395659 | Bacteria | 3983269 |
| 557 | 2904463590 | 2904463128 | Bacteria | 4775606 |
| 558 | 2919085587 | 2919085039 | Bacteria | 4532964 |
| 559 | 2919091096 | 2919089067 | Bacteria | 4560942 |
| 560 | 2919133509 | 2919130084 | Bacteria | 5301837 |
| 561 | 2919405227 | 2919404418 | Bacteria | 4232372 |
| 562 | 2928497646 | 2928496128 | Bacteria | 4631123 |
| 563 | 2928967350 | 2928963466 | Bacteria | 5165703 |
| 564 | 2929197437 | 2929195423 | Bacteria | 5325372 |
| 565 | 2937613290 | 2937610967 | Bacteria | 4618818 |
| 566 | 2939592928 | 2939589442 | Bacteria | 4214238 |
| 567 | 2939614506 | 2939611941 | Bacteria | 3892017 |
| 568 | 2939628954 | 2939626828 | Bacteria | 4695272 |
| 569 | 2941473457 | 2941471342 | Bacteria | 5018624 |
| 570 | 2941476389 | 2941475908 | Bacteria | 4145589 |
| 571 | 2953994808 | 2953994433 | Bacteria | 4303959 |
| 572 | 2961049086 | 2961047084 | Bacteria | 4594415 |
| 573 | 2961066218 | 2961064222 | Bacteria | 4749990 |
| 574 | 2974308469 | 2974307012 | Bacteria | 4172388 |
| 575 | 2977249223 | 2977247770 | Bacteria | 4160543 |
| 576 | 2984516321 | 2984514374 | Bacteria | 4172479 |
| 577 | 8021624229 | 8021622325 | Bacteria | 4844743 |
| 578 | 8021628275 | 8021626552 | Bacteria | 4665214 |
| 579 | 8021652026 | 8021648035 | Bacteria | 4772378 |
| 580 | Ga0207707_10076682 | |||
| 581 | JGI24739J22299_10000042 | |||
| 582 | JGI24739J22299_10000993 | |||
| 583 | JGI24737J22298_10009924 | |||
| 584 | JGI24735J21928_10003420 | |||
| 585 | JGI25156J39149_1000899 | |||
| 586 | JGI25156J39149_1002483 | |||
| 587 | JGI25162J39368_1000068 | |||
| 588 | JGI25162J39368_1000529 | |||
| 589 | JGI25162J39368_1000746 | |||
| 590 | JGI25162J39368_1001106 | |||
| 591 | JGI25162J39368_1001478 | |||
| 592 | JGI25162J39368_1002607 | |||
| 593 | JGI25157J39369_1000198 | |||
| 594 | JGI25157J39369_1000446 | |||
| 595 | JGI25157J39369_1000503 | |||
| 596 | JGI25157J39369_1000649 | |||
| 597 | JGI25157J39369_1002597 | |||
| 598 | JGI25163J39215_1001143 | |||
| 599 | JGI25164J39214_1000102 | |||
| 600 | JGI25164J39214_1000142 | |||
| 601 | JGI25164J39214_1000366 | |||
| 602 | JGI25164J39214_1000443 | |||
| 603 | JGI25152J39213_1000032 | |||
| 604 | JGI25150J39212_1000179 | |||
| 605 | JGI25151J46595_10000138 | |||
| 606 | JGI25165J46597_1000058 | |||
| 607 | JGI25165J46597_1000090 | |||
| 608 | JGI25165J46597_1000405 | |||
| 609 | JGI25165J46597_1003705 | |||
| 610 | JGI25153J46596_10000102 | |||
| 611 | JGI25153J46596_10016785 | |||
| 612 | rootH1_10069378 | |||
| 613 | rootH2_10011619 | |||
| 614 | Ga0006562J51391_1070642 | |||
| 615 | Ga0055538_1000912 | |||
| 616 | Ga0055533_1002518 | |||
| 617 | Ga0055533_1003187 | |||
| 618 | Ga0055533_1005874 | |||
| 619 | Ga0055525_1000282 | |||
| 620 | Ga0055527_1000048 | |||
| 621 | Ga0055527_1000105 | |||
| 622 | Ga0055527_1000125 | |||
| 623 | Ga0055527_1000630 | |||
| 624 | Ga0055535_1000034 | |||
| 625 | Ga0055535_1000150 | |||
| 626 | Ga0055535_1000170 | |||
| 627 | Ga0055535_1000765 | |||
| 628 | Ga0055535_1001380 | |||
| 629 | Ga0055535_1001421 | |||
| 630 | Ga0055542_1000081 | |||
| 631 | Ga0055542_1000112 | |||
| 632 | Ga0055542_1000118 | |||
| 633 | Ga0055542_1000198 | |||
| 634 | Ga0055542_1000685 | |||
| 635 | Ga0055542_1001350 | |||
| 636 | Ga0055542_1001389 | |||
| 637 | Ga0055529_1000083 | |||
| 638 | Ga0055529_1000132 | |||
| 639 | Ga0055529_1000305 | |||
| 640 | Ga0055529_1000343 | |||
| 641 | Ga0055526_1000413 | |||
| 642 | Ga0055537_1000349 | |||
| 643 | Ga0055524_1008744 | |||
| 644 | Ga0055534_1000073 | |||
| 645 | Ga0055528_1000080 | |||
| 646 | Ga0055530_10001767 | |||
| 647 | Ga0055530_10003477 | |||
| 648 | Ga0058692_1000023 | |||
| 649 | Ga0065165_1000001 | |||
| 650 | Ga0065165_1003057 | |||
| 651 | Ga0065704_10073413 | |||
| 652 | Ga0070658_10014243 | |||
| 653 | Ga0070670_100005062 | |||
| 654 | Ga0070666_10000005 | |||
| 655 | Ga0070680_100132190 | |||
| 656 | Ga0070682_100005891 | |||
| 657 | Ga0070682_100017419 | |||
| 658 | Ga0070660_100016267 | |||
| 659 | Ga0070689_100096116 | |||
| 660 | Ga0070661_100014230 | |||
| 661 | Ga0070659_100001123 | |||
| 662 | Ga0070659_100091641 | |||
| 663 | Ga0070667_100018857 | |||
| 664 | Ga0070714_100000939 | |||
| 665 | Ga0070714_100007346 | |||
| 666 | Ga0070713_100002465 | |||
| 667 | Ga0070681_10003155 | |||
| 668 | Ga0070685_10001904 | |||
| 669 | Ga0068853_100006103 | |||
| 670 | Ga0068853_100032558 | |||
| 671 | Ga0070696_100008073 | |||
| 672 | Ga0070696_100017249 | |||
| 673 | Ga0070665_100016441 | |||
| 674 | Ga0070665_100062091 | |||
| 675 | Ga0068855_100039384 | |||
| 676 | Ga0068855_100084500 | |||
| 677 | Ga0068855_100088408 | |||
| 678 | Ga0068854_100007994 | |||
| 679 | Ga0068856_100002390 | |||
| 680 | Ga0068856_100002901 | |||
| 681 | Ga0068856_100040275 | |||
| 682 | Ga0068858_100019131 | |||
| 683 | Ga0068862_100130201 | |||
| 684 | Ga0075364_10015664 | |||
| 685 | Ga0075367_10026170 | |||
| 686 | Ga0105251_10000108 | |||
| 687 | Ga0105251_10006958 | |||
| 688 | Ga0105240_10013498 | |||
| 689 | Ga0105240_10072871 | |||
| 690 | Ga0105240_10086921 | |||
| 691 | Ga0105240_10092054 | |||
| 692 | Ga0105240_10132088 | |||
| 693 | Ga0105243_10067280 | |||
| 694 | Ga0105237_10000023 | |||
| 695 | Ga0105237_10001198 | |||
| 696 | Ga0105238_10000060 | |||
| 697 | Ga0105238_10070855 | |||
| 698 | Ga0105239_10000044 | |||
| 699 | Ga0157373_10010095 | |||
| 700 | Ga0157373_10014543 | |||
| 701 | Ga0157373_10029899 | |||
| 702 | Ga0157373_10051211 | |||
| 703 | Ga0157373_10079818 | |||
| 704 | Ga0157371_10003647 | |||
| 705 | Ga0157371_10014602 | |||
| 706 | Ga0157371_10026030 | |||
| 707 | Ga0157371_10075801 | |||
| 708 | Ga0157370_10001227 | |||
| 709 | Ga0157370_10005668 | |||
| 710 | Ga0157370_10050405 | |||
| 711 | Ga0157370_10065362 | |||
| 712 | Ga0157369_10000364 | |||
| 713 | Ga0157369_10005722 | |||
| 714 | Ga0163162_10055455 | |||
| 715 | Ga0157372_10009601 | |||
| 716 | Ga0157372_10016735 | |||
| 717 | Ga0182008_10002089 | |||
| 718 | Ga0182008_10002596 | |||
| 719 | Ga0182008_10025633 | |||
| 720 | Ga0182006_1007530 | |||
| 721 | Ga0182006_1012898 | |||
| 722 | Ga0182007_10000353 | |||
| 723 | Ga0182007_10009307 | |||
| 724 | Ga0182007_10020351 | |||
| 725 | Ga0182005_1000004 | |||
| 726 | Ga0182005_1000344 | |||
| 727 | Ga0183369_1012 | |||
| 728 | Ga0183368_1003 | |||
| 729 | Ga0163161_10007121 | |||
| 730 | Ga0163161_10012244 | |||
| 731 | Ga0206353_11824210 | |||
| 732 | Ga0209760_100462 | |||
| 733 | Ga0209784_100016 | |||
| 734 | Ga0209674_100012 | |||
| 735 | Ga0209674_100026 | |||
| 736 | Ga0209674_100244 | |||
| 737 | Ga0209674_100318 | |||
| 738 | Ga0209674_100489 | |||
| 739 | Ga0209674_100669 | |||
| 740 | Ga0209672_100007 | |||
| 741 | Ga0209672_100016 | |||
| 742 | Ga0209672_100017 | |||
| 743 | Ga0209672_100078 | |||
| 744 | Ga0209672_100673 | |||
| 745 | Ga0209672_102112 | |||
| 746 | Ga0209563_100169 | |||
| 747 | Ga0207427_100019 | |||
| 748 | Ga0207427_100033 | |||
| 749 | Ga0207427_100050 | |||
| 750 | Ga0207427_100123 | |||
| 751 | Ga0209437_100012 | |||
| 752 | Ga0209437_100105 | |||
| 753 | Ga0209437_100120 | |||
| 754 | Ga0209437_100192 | |||
| 755 | Ga0209437_100227 | |||
| 756 | Ga0209437_102614 | |||
| 757 | Ga0209258_100012 | |||
| 758 | Ga0209258_100038 | |||
| 759 | Ga0209258_100039 | |||
| 760 | Ga0209258_100046 | |||
| 761 | Ga0209258_100095 | |||
| 762 | Ga0209258_100308 | |||
| 763 | Ga0209258_101017 | |||
| 764 | Ga0209258_104741 | |||
| 765 | Ga0207425_1000078 | |||
| 766 | Ga0209646_1000307 | |||
| 767 | Ga0209646_1000581 | |||
| 768 | Ga0209646_1006311 | |||
| 769 | Ga0209026_1000012 | |||
| 770 | Ga0209026_1000140 | |||
| 771 | Ga0209026_1000158 | |||
| 772 | Ga0209026_1000249 | |||
| 773 | Ga0209026_1000623 | |||
| 774 | Ga0209677_102331 | |||
| 775 | Ga0209677_104968 | |||
| 776 | Ga0209148_1000001 | |||
| 777 | Ga0209148_1000005 | |||
| 778 | Ga0209148_1000009 | |||
| 779 | Ga0209148_1000014 | |||
| 780 | Ga0209148_1000039 | |||
| 781 | Ga0209148_1000087 | |||
| 782 | Ga0209148_1000098 | |||
| 783 | Ga0209148_1002736 | |||
| 784 | Ga0209759_1000750 | |||
| 785 | Ga0209759_1000852 | |||
| 786 | Ga0209759_1002326 | |||
| 787 | Ga0209759_1003116 | |||
| 788 | Ga0209759_1010047 | |||
| 789 | Ga0209129_1000157 | |||
| 790 | Ga0209129_1002030 | |||
| 791 | Ga0209129_1008599 | |||
| 792 | Ga0209233_1000002 | |||
| 793 | Ga0209233_1000080 | |||
| 794 | Ga0209233_1000174 | |||
| 795 | Ga0209233_1000184 | |||
| 796 | Ga0209233_1000283 | |||
| 797 | Ga0209565_1000022 | |||
| 798 | Ga0209455_1000010 | |||
| 799 | Ga0209455_1000032 | |||
| 800 | Ga0209455_1000034 | |||
| 801 | Ga0209455_1000039 | |||
| 802 | Ga0209455_1000126 | |||
| 803 | Ga0209455_1001030 | |||
| 804 | Ga0209455_1004445 | |||
| 805 | Ga0209673_1000087 | |||
| 806 | Ga0209130_1006405 | |||
| 807 | Ga0209675_1000060 | |||
| 808 | Ga0209025_1000054 | |||
| 809 | Ga0209564_1000302 | |||
| 810 | Ga0209758_1000062 | |||
| 811 | Ga0209758_1002406 | |||
| 812 | Ga0209758_1037412 | |||
| 813 | Ga0209050_1001760 | |||
| 814 | Ga0209050_1002154 | |||
| 815 | Ga0209256_1003341 | |||
| 816 | Ga0209256_1005490 | |||
| 817 | Ga0209256_1012323 | |||
| 818 | Ga0209051_1000606 | |||
| 819 | Ga0209257_1000014 | |||
| 820 | Ga0209257_1000121 | |||
| 821 | Ga0209257_1006948 | |||
| 822 | Ga0207713_1000507 | |||
| 823 | Ga0207713_1007579 | |||
| 824 | Ga0207680_10000005 | |||
| 825 | Ga0207647_10001002 | |||
| 826 | Ga0207647_10007576 | |||
| 827 | Ga0207647_10020707 | |||
| 828 | Ga0207705_10011525 | |||
| 829 | Ga0207705_10014974 | |||
| 830 | Ga0207707_10006499 | |||
| 831 | Ga0207695_10000294 | |||
| 832 | Ga0207695_10001068 | |||
| 833 | Ga0207695_10002599 | |||
| 834 | Ga0207695_10002825 | |||
| 835 | Ga0207695_10041406 | |||
| 836 | Ga0207695_10063941 | |||
| 837 | Ga0207695_10093960 | |||
| 838 | Ga0207671_10000020 | |||
| 839 | Ga0207671_10000033 | |||
| 840 | Ga0207671_10001191 | |||
| 841 | Ga0207693_10197695 | |||
| 842 | Ga0207657_10024290 | |||
| 843 | Ga0207652_10038799 | |||
| 844 | Ga0207694_10000332 | |||
| 845 | Ga0207650_10005976 | |||
| 846 | Ga0207664_10000036 | |||
| 847 | Ga0207690_10001378 | |||
| 848 | Ga0207690_10010521 | |||
| 849 | Ga0207690_10021020 | |||
| 850 | Ga0207690_10029938 | |||
| 851 | Ga0207709_10039628 | |||
| 852 | Ga0207670_10002849 | |||
| 853 | Ga0207667_10000130 | |||
| 854 | Ga0207667_10000293 | |||
| 855 | Ga0207667_10040028 | |||
| 856 | Ga0207667_10127990 | |||
| 857 | Ga0207640_10000103 | |||
| 858 | Ga0207640_10003468 | |||
| 859 | Ga0207640_10091996 | |||
| 860 | Ga0207639_10008066 | |||
| 861 | Ga0207678_10058827 | |||
| 862 | Ga0207702_10000290 | |||
| 863 | Ga0207702_10005453 | |||
| 864 | Ga0207674_10000218 | |||
| 865 | Ga0207674_10024726 | |||
| 866 | Ga0207674_10086415 | |||
| 867 | Ga0209371_1000059 | |||
| 868 | Ga0268266_10000004 | |||
| 869 | Ga0268265_10190811 | |||
| 870 | Ga0268256_1000055 | |||
| 871 | Ga0316181_1273914 | |||
| 872 | Ga0307412_10005560 | |||
| 873 | Ga0307412_10007331 | |||
| 874 | Ga0307412_10234954 | |||
| 875 | Ga0307416_100359095 | |||
| 876 | Ga0307414_10049447 | |||
| 877 | Ga0395899_0000046 | |||
| 878 | Ga0395899_0000175 | |||
| 879 | Ga0395899_0009328 | |||
| 880 | Ga0395899_0077296 | |||
| 881 | Ga0395899_0109019 | |||
| 882 | Ga0395900_0000012 | |||
| 883 | Ga0395900_0000039 | |||
| 884 | Ga0395900_0020607 | |||
| 885 | Ga0395900_0056221 | |||
| 886 | Ga0395898_0000034 | |||
| 887 | Ga0395898_0000197 | |||
| 888 | Ga0395898_0053114 | |||
| 889 | Ga0395898_0053718 | |||
| 890 | Ga0395898_0113447 | |||
| 891 | Ga0395898_0147621 | |||
| 892 | Ga0395901_0005891 | |||
| 893 | Ga0395901_0060044 | |||
| 894 | Ga0395901_0134582 | |||
| 895 | Ga0395901_0186022 | |||
| 896 | Ga0395901_0326608 | |||
| 897 | Ga0237819_00252 | |||
| 898 | Ga0439436_0000014 | |||
| 899 | Ga0439465_0003345 | |||
| 900 | Ga0451791_0221684 | |||
| 901 | Ga0451793_0417357 | |||
| 902 | Ga0451800_0139849 | |||
| 903 | Ga0451807_0813515 | |||
| 904 | Ga0451833_0048849 | |||
| 905 | Ga0451837_1456316 | |||
| 906 | Ga0451843_0383473 | |||
| 907 | Ga0450908_000020 | |||
| 908 | Ga0466969_0006890 | |||
| 909 | Ga0466969_0011780 | |||
| 910 | Ga0466972_0001559 | |||
| 911 | Ga0466975_0039304 | |||
| 912 | Ga0466982_0001571 | |||
| 913 | Ga0466966_0015868 | |||
| 914 | Ga0466966_0030247 | |||
| 915 | Ga0466961_0000983 | |||
| 916 | Ga0466961_0009198 | |||
| 917 | Ga0466961_0011333 | |||
| 918 | Ga0466961_0031621 | |||
| 919 | Ga0466961_0083008 | |||
| 920 | Ga0466963_0135867 | |||
| 921 | Ga0466971_0004168 | |||
| 922 | Ga0466971_0009512 | |||
| 923 | Ga0466971_0013357 | |||
| 924 | Ga0466968_0008983 | |||
| 925 | Ga0466970_0001017 | |||
| 926 | Ga0466970_0013560 | |||
| 927 | Ga0466970_0039510 | |||
| 928 | Ga0466970_0046877 | |||
| 929 | Ga0466970_0104067 | |||
| 930 | Ga0466957_0006091 | |||
| 931 | Ga0466957_0100543 | |||
| 932 | Ga0466959_0054207 | |||
| 933 | Ga0466959_0055550 | |||
| 934 | Ga0466959_0081593 | |||
| 935 | Ga0466958_0005201 | |||
| 936 | Ga0466958_0115596 | |||
| 937 | Ga0466967_0084458 | |||
| 938 | Ga0495617_000411 | |||
| 939 | Ga0495617_010690 | |||
| 940 | Ga0495590_0036029 | |||
| 941 | Ga0495638_0000159 | |||
| 942 | Ga0495638_0000161 | |||
| 943 | Ga0495638_0000246 | |||
| 944 | Ga0495638_0001421 | |||
| 945 | Ga0495650_0000197 | |||
| 946 | Ga0495650_0000590 | |||
| 947 | Ga0495650_0001258 | |||
| 948 | Ga0495584_0002602 | |||
| 949 | Ga0495585_0000623 | |||
| 950 | Ga0495585_0001230 | |||
| 951 | Ga0495607_0000046 | |||
| 952 | Ga0495607_0000508 | |||
| 953 | Ga0495607_0003198 | |||
| 954 | Ga0495583_0032424 | |||
| 955 | Ga0495606_0000356 | |||
| 956 | Ga0495606_0000940 | |||
| 957 | Ga0495606_0001458 | |||
| 958 | Ga0495606_0009272 | |||
| 959 | Ga0495606_0048591 | |||
| 960 | Ga0495610_0002744 | |||
| 961 | Ga0495616_0000062 | |||
| 962 | Ga0495616_0018719 | |||
| 963 | Ga0495620_0002390 | |||
| 964 | Ga0495631_0000157 | |||
| 965 | Ga0495631_0003247 | |||
| 966 | Ga0495632_0000003 | |||
| 967 | Ga0495632_0006126 | |||
| 968 | Ga0495637_0019037 | |||
| 969 | Ga0495643_0003481 | |||
| 970 | Ga0495648_0002187 | |||
| 971 | Ga0495648_0002466 | |||
| 972 | Ga0495609_0007018 | |||
| 973 | Ga0495668_0003971 | |||
| 974 | Ga0495611_0000001 | |||
| 975 | Ga0495611_0000258 | |||
| 976 | Ga0495625_0000001 | |||
| 977 | Ga0495625_0013224 | |||
| 978 | Ga0495625_0021685 | |||
| 979 | Ga0495625_0031562 | |||
| 980 | Ga0495625_0108521 | |||
| 981 | Ga0495661_0025776 | |||
| 982 | Ga0495670_0001900 | |||
| 983 | Ga0495670_0002153 | |||
| 984 | Ga0495671_0000634 | |||
| 985 | Ga0495649_0002293 | |||
| 986 | Ga0495649_0044406 | |||
| 987 | Ga0495589_0000314 | |||
| 988 | Ga0495660_0002147 | |||
| 989 | Ga0495660_0002345 | |||
| 990 | Ga0495672_0000455 | |||
| 991 | Ga0495683_0004404 | |||
| 992 | Ga0495679_000001 | |||
| 993 | Ga0495673_0000001 | |||
| 994 | Ga0495673_0000030 | |||
| 995 | Ga0495673_0000562 | |||
| 996 | Ga0495686_0000019 | |||
| 997 | Ga0495686_0000175 | |||
| 998 | Ga0495686_0004837 | |||
| 999 | Ga0495686_0010033 | |||
| 1000 | Ga0495686_0074523 | |||
| 1001 | Ga0496101_0016276 | |||
| 1002 | Ga0496105_0016340 | |||
| 1003 | Ga0496105_0017638 | |||
| 1004 | Ga0496106_0005098 | |||
| 1005 | Ga0496106_0051486 | |||
| 1006 | Ga0496113_0022124 | |||
| 1007 | Ga0496114_0092116 | |||
| 1008 | Ga0496115_0000974 | |||
| 1009 | Ga0496115_0001165 | |||
| 1010 | Ga0496115_0024163 | |||
| 1011 | Ga0496115_0033324 | |||
| 1012 | Ga0496116_0008342 | |||
| 1013 | Ga0496116_0009818 | |||
| 1014 | Ga0496116_0033151 | |||
| 1015 | Ga0496117_0005879 | |||
| 1016 | Ga0496117_0009735 | |||
| 1017 | Ga0496117_0010591 | |||
| 1018 | Ga0496117_0013334 | |||
| 1019 | Ga0496118_0000362 | |||
| 1020 | Ga0496118_0001376 | |||
| 1021 | Ga0496118_0002751 | |||
| 1022 | Ga0496118_0008539 | |||
| 1023 | Ga0496118_0030076 | |||
| 1024 | Ga0496118_0033110 | |||
| 1025 | Ga0496118_0048926 | |||
| 1026 | Ga0496118_0054469 | |||
| 1027 | Ga0496119_0000851 | |||
| 1028 | Ga0496119_0001095 | |||
| 1029 | Ga0496119_0005052 | |||
| 1030 | Ga0496119_0006339 | |||
| 1031 | Ga0496120_0001387 | |||
| 1032 | Ga0496120_0002462 | |||
| 1033 | Ga0496120_0004003 | |||
| 1034 | Ga0496120_0013968 | |||
| 1035 | Ga0496121_0000376 | |||
| 1036 | Ga0496121_0001290 | |||
| 1037 | Ga0496121_0004611 | |||
| 1038 | Ga0496121_0007636 | |||
| 1039 | Ga0496121_0009617 | |||
| 1040 | Ga0496121_0014077 | |||
| 1041 | Ga0496121_0031203 | |||
| 1042 | Ga0496121_0038544 | |||
| 1043 | Ga0496122_0003014 | |||
| 1044 | Ga0496122_0012864 | |||
| 1045 | Ga0496122_0018868 | |||
| 1046 | Ga0496122_0022593 | |||
| 1047 | Ga0496123_0000619 | |||
| 1048 | Ga0496123_0005952 | |||
| 1049 | Ga0496123_0011606 | |||
| 1050 | Ga0496123_0038701 | |||
| 1051 | Ga0496123_0041655 | |||
| 1052 | Ga0496123_0064454 | |||
| 1053 | Ga0496123_0067236 | |||
| 1054 | Ga0496123_0139534 | |||
| 1055 | Ga0496124_0000411 | |||
| 1056 | Ga0496124_0000808 | |||
| 1057 | Ga0496124_0008706 | |||
| 1058 | Ga0496124_0009017 | |||
| 1059 | Ga0496124_0009858 | |||
| 1060 | Ga0496124_0015807 | |||
| 1061 | Ga0496124_0022121 | |||
| 1062 | Ga0496124_0028626 | |||
| 1063 | Ga0496124_0044067 | |||
| 1064 | Ga0496125_0000344 | |||
| 1065 | Ga0496125_0009078 | |||
| 1066 | Ga0496125_0009310 | |||
| 1067 | Ga0496125_0013084 | |||
| 1068 | Ga0496125_0014372 | |||
| 1069 | Ga0496125_0023264 | |||
| 1070 | Ga0496126_0003518 | |||
| 1071 | Ga0496126_0010449 | |||
| 1072 | Ga0496126_0036762 | |||
| 1073 | Ga0496126_0048515 | |||
| 1074 | Ga0496126_0071889 | |||
| 1075 | Ga0496126_0121700 | |||
| 1076 | Ga0496126_0224678 | |||
| 1077 | Ga0495678_000296 | |||
| 1078 | Ga0495682_0009360 | |||
| 1079 | Ga0495682_0015347 | |||
| 1080 | Ga0501031_0121698 | |||
| 1081 | Ga0501032_0046667 | |||
| 1082 | Ga0501032_0066247 | |||
| 1083 | Ga0501033_0000550 | |||
| 1084 | Ga0501034_0016514 | |||
| 1085 | Ga0501034_0095519 | |||
| 1086 | Ga0501034_0129629 | |||
| 1087 | Ga0501036_0036107 | |||
| 1088 | Ga0501037_0046330 | |||
| 1089 | Ga0501038_0094206 | |||
| 1090 | Ga0501038_0188767 | |||
| 1091 | Ga0501043_0033733 | |||
| 1092 | Ga0501043_0036992 | |||
| 1093 | Ga0501047_0038762 | |||
| 1094 | Ga0501048_0053386 | |||
| 1095 | Ga0501070_0007853 | |||
| 1096 | Ga0501070_0089761 | |||
| 1097 | Ga0501035_0005508 | |||
| 1098 | Ga0501035_0056441 | |||
| 1099 | Ga0501035_0128459 | |||
| 1100 | Ga0501044_0034823 | |||
| 1101 | Ga0501044_0128406 | |||
| 1102 | Ga0501044_0171424 | |||
| 1103 | Ga0501044_0241477 | |||
| 1104 | Ga0500643_000002 | |||
| 1105 | Ga0500651_0000413 | |||
| 1106 | Ga0500555_000631 | |||
| 1107 | Ga0500645_001002 | |||
| 1108 | 2525556790 | |||
| 1109 | 2538834049 | |||
| 1110 | 2578457869 | |||
| 1111 | 2595445928 | |||
| 1112 | 2595452653 | |||
| 1113 | 2630648386 | |||
| 1114 | 2643830711 | |||
| 1115 | 2643894089 | |||
| 1116 | 2644476292 | |||
| 1117 | 2687582860 | |||
| 1118 | 2721027698 | |||
| 1119 | 2735836742 | |||
| 1120 | 2739228659 | |||
| 1121 | 2739731745 | |||
| 1122 | 2748015777 | |||
| 1123 | 2819562978 | |||
| 1124 | 2819663036 | |||
| 1125 | 2842391887 | |||
| 1126 | 2842760159 | |||
| 1127 | 2842916278 | |||
| 1128 | 2842918904 | |||
| 1129 | 2852650306 | |||
| 1130 | 2852685971 | |||
| 1131 | 2857446784 | |||
| 1132 | 2874222321 | |||
| 1133 | 2884340339 | |||
| 1134 | 2884414073 | |||
| 1135 | 2895396706 | |||
| 1136 | 2904463590 | |||
| 1137 | 2919085587 | |||
| 1138 | 2919091096 | |||
| 1139 | 2919133509 | |||
| 1140 | 2919405227 | |||
| 1141 | 2928497646 | |||
| 1142 | 2928967350 | |||
| 1143 | 2929197437 | |||
| 1144 | 2937613290 | |||
| 1145 | 2939592928 | |||
| 1146 | 2939614506 | |||
| 1147 | 2939628954 | |||
| 1148 | 2941473457 | |||
| 1149 | 2941476389 | |||
| 1150 | 2953994808 | |||
| 1151 | 2961049086 | |||
| 1152 | 2961066218 | |||
| 1153 | 2974308469 | |||
| 1154 | 2977249223 | |||
| 1155 | 2984516321 | |||
| 1156 | 8021624229 | |||
| 1157 | 8021628275 | |||
| 1158 | 8021652026 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c79-assembly1.cif.gz_B | crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph | 0.9659 | 8 | 37 |
| 8a5z-assembly1.cif.gz_A | imine reductase from ensifer adhaerens a208n mutant in complex with nadp+ | 0.9598 | 6 | 37 |
| 7bkd-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) | 0.9596 | 8 | 38 |
| 5x6p-assembly2.cif.gz_B | crystal structure of pseudomonas fluorescens kmo | 0.9589 | 8 | 465 |
| 8a3x-assembly1.cif.gz_B | imine reductase from ensifer adhaerens in complex with nadp+ | 0.9574 | 7 | 36 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9455 | 8 | 382 | 3.50.50.60 |
| af_Q4D0X5_1_185_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9437 | 7 | 37 | 3.40.50.720 |
| 5y8iB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9429 | 6 | 36 | 3.40.50.720 |
| 6fqxH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9429 | 8 | 37 | 3.40.50.720 |
| af_F4IAP5_3_165_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9424 | 7 | 36 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B9E1R9-F1-model_v4 | Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) | 0.9782 | 6 | 470 |
GO:0004502
GO:0006569 GO:0019805 GO:0034354 GO:0043420 GO:0070189 GO:0071949 |
| AF-A0A154R2R4-F1-model_v4 | Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) | 0.9729 | 1 | 470 |
GO:0004502
GO:0006569 GO:0019805 GO:0034354 GO:0043420 GO:0070189 GO:0071949 |
| AF-A0A5B9E1R9-F1-model_v4 | Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) | 0.9718 | 6 | 470 |
GO:0004502
GO:0006569 GO:0019805 GO:0034354 GO:0043420 GO:0070189 GO:0071949 |
| AF-A0A7V8JF61-F1-model_v4 | Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) | 0.9715 | 4 | 465 |
GO:0004502
GO:0006569 GO:0019805 GO:0034354 GO:0043420 GO:0070189 GO:0071949 |
| AF-A0A7X5UBP5-F1-model_v4 | Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) | 0.971 | 4 | 465 |
GO:0004502
GO:0006569 GO:0019805 GO:0034354 GO:0043420 GO:0070189 GO:0071949 |