F465834

General Info

Members Datasets Scaffolds Average Seq Length
579 282 1158 461

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10076682|Ga0207707_100766822
Length 537
Sequence VGRPFSLPSGNPFAFAQLAAPHASPSAARKDPPGIAVARRLRNSGRIPLPDRGMAQQPITLIGGGLVGALLAQQLAGRGFAVDVYEKRPDPRLSGFLGRSSASCARGTRPSMDSGGRSINLALAERGLQALRTAGLADDVLQRAVMMRGRMVHDRDGHSGLQRYGVDDSEVIWSVSRGTLNMLLLDAAEAVGVRFHFGQSLVGADFGRQRIRLADEAGVQRELDAGLLIGADGAGSAVRAAMNAHAPLGERIESLGHGYKELEIPPAGELPAAVLQLSGGREQFALEPHALHIWPRGGYMCIALPNTEGSFTVTLFLPAQGAAPSFATLPDATAAAAFFREQFPGLLPLIPDFSKDFDSHPVGTLSTLYLERWHLDGRALLIGDAAHAIVPFHGQGMNCGFEDTVVLTELLAAAPDDSVGVFAEFQRMRQPNADAIAAMALENYVEMRDSVADPHYLAKRELGSALAARIPGHYMARYRLVTFTHVPYAYALERGRAQDRLLEQLLRDTPNVAEIDIDAAAQLFQSTLEPLPRLRHG

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
75 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
153 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
233 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
234 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
235 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
236 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
237 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
238 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
239 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
240 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
241 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
242 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
243 2734482264 Dyella sp. AD052 Isolate Unclassified
244 2738543009 Luteibacter sp. OK325 Isolate Unclassified
245 2739367700 Dyella sp. YR388 Isolate Unclassified
246 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
247 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
248 2818991457 Xanthomonas translucens 569 Isolate Unclassified
249 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
250 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
251 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
252 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
253 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
254 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
255 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
256 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
257 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
258 2884411467 Dyella sp. AD56 Isolate Rhizosphere
259 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
260 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
261 2919085039 Luteibacter sp. 1214 Isolate Unclassified
262 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
263 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
264 2919404418 Luteibacter sp. 3190 Isolate Unclassified
265 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
266 2928963466 Dyella japonica 1073 Isolate Unclassified
267 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
268 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
269 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
270 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
271 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
272 2941471342 Luteibacter sp. 621 Isolate Unclassified
273 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
274 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
275 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
276 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
277 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
278 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
279 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
280 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
281 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
282 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.85
Metatranscriptomes 0.35
Isolates 8.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 23.83
Nodule 0.17
Rhizoplane 2.59
Rhizosphere 51.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10076682 3300025912 Bacteria 2917
2 JGI24739J22299_10000042 3300001989 Bacteria 34840
3 JGI24739J22299_10000993 3300001989 Bacteria 10563
4 JGI24737J22298_10009924 3300001990 Bacteria 3152
5 JGI24735J21928_10003420 3300002067 Bacteria 5412
6 JGI25156J39149_1000899 3300002705 Bacteria 14621
7 JGI25156J39149_1002483 3300002705 Bacteria 6572
8 JGI25162J39368_1000068 3300002737 Bacteria 129594
9 JGI25162J39368_1000529 3300002737 Bacteria 28464
10 JGI25162J39368_1000746 3300002737 Bacteria 22266
11 JGI25162J39368_1001106 3300002737 Bacteria 16314
12 JGI25162J39368_1001478 3300002737 Bacteria 12327
13 JGI25162J39368_1002607 3300002737 Bacteria 6750
14 JGI25157J39369_1000198 3300002741 Bacteria 50968
15 JGI25157J39369_1000446 3300002741 Bacteria 26463
16 JGI25157J39369_1000503 3300002741 Bacteria 24065
17 JGI25157J39369_1000649 3300002741 Bacteria 19381
18 JGI25157J39369_1002597 3300002741 Bacteria 4300
19 JGI25163J39215_1001143 3300002771 Bacteria 5223
20 JGI25164J39214_1000102 3300002772 Bacteria 83707
21 JGI25164J39214_1000142 3300002772 Bacteria 68956
22 JGI25164J39214_1000366 3300002772 Bacteria 26967
23 JGI25164J39214_1000443 3300002772 Bacteria 22266
24 JGI25152J39213_1000032 3300002773 Bacteria 96369
25 JGI25150J39212_1000179 3300002774 Bacteria 35481
26 JGI25151J46595_10000138 3300003187 Bacteria 96369
27 JGI25165J46597_1000058 3300003214 Bacteria 212833
28 JGI25165J46597_1000090 3300003214 Bacteria 168833
29 JGI25165J46597_1000405 3300003214 Bacteria 45672
30 JGI25165J46597_1003705 3300003214 Bacteria 3639
31 JGI25153J46596_10000102 3300003215 Bacteria 96369
32 JGI25153J46596_10016785 3300003215 Bacteria 2916
33 rootH1_10069378 3300003316 Bacteria 4391
34 rootH2_10011619 3300003320 Bacteria 16641
35 Ga0006562J51391_1070642 3300003578 Bacteria 2940
36 Ga0055538_1000912 3300003751 Bacteria 7323
37 Ga0055533_1002518 3300003756 Bacteria 4129
38 Ga0055533_1003187 3300003756 Bacteria 3407
39 Ga0055533_1005874 3300003756 Bacteria 1904
40 Ga0055525_1000282 3300003759 Bacteria 46609
41 Ga0055527_1000048 3300003760 Bacteria 105299
42 Ga0055527_1000105 3300003760 Bacteria 60329
43 Ga0055527_1000125 3300003760 Bacteria 54169
44 Ga0055527_1000630 3300003760 Bacteria 11018
45 Ga0055535_1000034 3300003761 Bacteria 181954
46 Ga0055535_1000150 3300003761 Bacteria 74086
47 Ga0055535_1000170 3300003761 Bacteria 70208
48 Ga0055535_1000765 3300003761 Bacteria 23814
49 Ga0055535_1001380 3300003761 Bacteria 12637
50 Ga0055535_1001421 3300003761 Bacteria 12270
51 Ga0055542_1000081 3300003762 Bacteria 129595
52 Ga0055542_1000112 3300003762 Bacteria 107429
53 Ga0055542_1000118 3300003762 Bacteria 105368
54 Ga0055542_1000198 3300003762 Bacteria 74085
55 Ga0055542_1000685 3300003762 Bacteria 26937
56 Ga0055542_1001350 3300003762 Bacteria 12637
57 Ga0055542_1001389 3300003762 Bacteria 12270
58 Ga0055529_1000083 3300003763 Bacteria 146729
59 Ga0055529_1000132 3300003763 Bacteria 105368
60 Ga0055529_1000305 3300003763 Bacteria 56629
61 Ga0055529_1000343 3300003763 Bacteria 51957
62 Ga0055526_1000413 3300003771 Bacteria 34618
63 Ga0055537_1000349 3300003773 Bacteria 31443
64 Ga0055524_1008744 3300003775 Bacteria 4182
65 Ga0055534_1000073 3300003784 Bacteria 77473
66 Ga0055528_1000080 3300003790 Bacteria 75390
67 Ga0055530_10001767 3300003791 Bacteria 15103
68 Ga0055530_10003477 3300003791 Bacteria 8935
69 Ga0058692_1000023 3300003856 Bacteria 237263
70 Ga0065165_1000001 3300005262 Bacteria 494087
71 Ga0065165_1003057 3300005262 Bacteria 12525
72 Ga0065704_10073413 3300005289 Bacteria 7197
73 Ga0070658_10014243 3300005327 Bacteria 6381
74 Ga0070670_100005062 3300005331 Bacteria 11088
75 Ga0070666_10000005 3300005335 Bacteria 343092
76 Ga0070680_100132190 3300005336 Bacteria 2089
77 Ga0070682_100005891 3300005337 Bacteria 6852
78 Ga0070682_100017419 3300005337 Bacteria 4188
79 Ga0070660_100016267 3300005339 Bacteria 5396
80 Ga0070689_100096116 3300005340 Bacteria 2341
81 Ga0070661_100014230 3300005344 Bacteria 5603
82 Ga0070659_100001123 3300005366 Bacteria 19527
83 Ga0070659_100091641 3300005366 Bacteria 2436
84 Ga0070667_100018857 3300005367 Bacteria 5721
85 Ga0070714_100000939 3300005435 Bacteria 20729
86 Ga0070714_100007346 3300005435 Bacteria 8570
87 Ga0070713_100002465 3300005436 Bacteria 12079
88 Ga0070681_10003155 3300005458 Bacteria 15329
89 Ga0070685_10001904 3300005466 Bacteria 10846
90 Ga0068853_100006103 3300005539 Bacteria 9541
91 Ga0068853_100032558 3300005539 Bacteria 4416
92 Ga0070696_100008073 3300005546 Bacteria 7035
93 Ga0070696_100017249 3300005546 Bacteria 4872
94 Ga0070665_100016441 3300005548 Bacteria 7418
95 Ga0070665_100062091 3300005548 Bacteria 3746
96 Ga0068855_100039384 3300005563 Bacteria 5610
97 Ga0068855_100084500 3300005563 Bacteria 3674
98 Ga0068855_100088408 3300005563 Bacteria 3579
99 Ga0068854_100007994 3300005578 Bacteria 6775
100 Ga0068856_100002390 3300005614 Bacteria 19310
101 Ga0068856_100002901 3300005614 Bacteria 17553
102 Ga0068856_100040275 3300005614 Bacteria 4588
103 Ga0068858_100019131 3300005842 Bacteria 6407
104 Ga0068862_100130201 3300005844 Bacteria 2225
105 Ga0075364_10015664 3300006051 Bacteria 4705
106 Ga0075367_10026170 3300006178 Bacteria 3306
107 Ga0105251_10000108 3300009011 Bacteria 81679
108 Ga0105251_10006958 3300009011 Bacteria 7082
109 Ga0105240_10013498 3300009093 Bacteria 11219
110 Ga0105240_10072871 3300009093 Bacteria 4243
111 Ga0105240_10086921 3300009093 Bacteria 3829
112 Ga0105240_10092054 3300009093 Bacteria 3703
113 Ga0105240_10132088 3300009093 Bacteria 2994
114 Ga0105243_10067280 3300009148 Bacteria 2883
115 Ga0105237_10000023 3300009545 Bacteria 226144
116 Ga0105237_10001198 3300009545 Bacteria 34705
117 Ga0105238_10000060 3300009551 Bacteria 129934
118 Ga0105238_10070855 3300009551 Bacteria 3484
119 Ga0105239_10000044 3300010375 Bacteria 187680
120 Ga0157373_10010095 3300013100 Bacteria 6957
121 Ga0157373_10014543 3300013100 Bacteria 5769
122 Ga0157373_10029899 3300013100 Bacteria 3922
123 Ga0157373_10051211 3300013100 Bacteria 2941
124 Ga0157373_10079818 3300013100 Bacteria 2308
125 Ga0157371_10003647 3300013102 Bacteria 13861
126 Ga0157371_10014602 3300013102 Bacteria 5920
127 Ga0157371_10026030 3300013102 Bacteria 4257
128 Ga0157371_10075801 3300013102 Bacteria 2382
129 Ga0157370_10001227 3300013104 Bacteria 32113
130 Ga0157370_10005668 3300013104 Bacteria 13956
131 Ga0157370_10050405 3300013104 Bacteria 3979
132 Ga0157370_10065362 3300013104 Bacteria 3441
133 Ga0157369_10000364 3300013105 Bacteria 60361
134 Ga0157369_10005722 3300013105 Bacteria 14438
135 Ga0163162_10055455 3300013306 Bacteria 3990
136 Ga0157372_10009601 3300013307 Bacteria 10283
137 Ga0157372_10016735 3300013307 Bacteria 7871
138 Ga0182008_10002089 3300014497 Bacteria 12754
139 Ga0182008_10002596 3300014497 Bacteria 11222
140 Ga0182008_10025633 3300014497 Bacteria 2995
141 Ga0182006_1007530 3300015261 Bacteria 4975
142 Ga0182006_1012898 3300015261 Bacteria 3646
143 Ga0182007_10000353 3300015262 Bacteria 29023
144 Ga0182007_10009307 3300015262 Bacteria 3971
145 Ga0182007_10020351 3300015262 Bacteria 2373
146 Ga0182005_1000004 3300015265 Bacteria 609645
147 Ga0182005_1000344 3300015265 Bacteria 26562
148 Ga0183369_1012 3300015685 Bacteria 251554
149 Ga0183368_1003 3300015687 Bacteria 1276390
150 Ga0163161_10007121 3300017792 Bacteria 7732
151 Ga0163161_10012244 3300017792 Bacteria 5951
152 Ga0206353_11824210 3300020082 Bacteria 2260
153 Ga0209760_100462 3300025207 Bacteria 9090
154 Ga0209784_100016 3300025224 Bacteria 481036
155 Ga0209674_100012 3300025226 Bacteria 950162
156 Ga0209674_100026 3300025226 Bacteria 490631
157 Ga0209674_100244 3300025226 Bacteria 45968
158 Ga0209674_100318 3300025226 Bacteria 31053
159 Ga0209674_100489 3300025226 Bacteria 16826
160 Ga0209674_100669 3300025226 Bacteria 12224
161 Ga0209672_100007 3300025228 Bacteria 959482
162 Ga0209672_100016 3300025228 Bacteria 522604
163 Ga0209672_100017 3300025228 Bacteria 514236
164 Ga0209672_100078 3300025228 Bacteria 156926
165 Ga0209672_100673 3300025228 Bacteria 17260
166 Ga0209672_102112 3300025228 Bacteria 5305
167 Ga0209563_100169 3300025230 Bacteria 46948
168 Ga0207427_100019 3300025231 Bacteria 513977
169 Ga0207427_100033 3300025231 Bacteria 338459
170 Ga0207427_100050 3300025231 Bacteria 227233
171 Ga0207427_100123 3300025231 Bacteria 98859
172 Ga0209437_100012 3300025233 Bacteria 792625
173 Ga0209437_100105 3300025233 Bacteria 220034
174 Ga0209437_100120 3300025233 Bacteria 205054
175 Ga0209437_100192 3300025233 Bacteria 122888
176 Ga0209437_100227 3300025233 Bacteria 98939
177 Ga0209437_102614 3300025233 Bacteria 3448
178 Ga0209258_100012 3300025242 Bacteria 825544
179 Ga0209258_100038 3300025242 Bacteria 398959
180 Ga0209258_100039 3300025242 Bacteria 386366
181 Ga0209258_100046 3300025242 Bacteria 369794
182 Ga0209258_100095 3300025242 Bacteria 223270
183 Ga0209258_100308 3300025242 Bacteria 77195
184 Ga0209258_101017 3300025242 Bacteria 12688
185 Ga0209258_104741 3300025242 Bacteria 2488
186 Ga0207425_1000078 3300025245 Bacteria 104429
187 Ga0209646_1000307 3300025246 Bacteria 39199
188 Ga0209646_1000581 3300025246 Bacteria 15100
189 Ga0209646_1006311 3300025246 Bacteria 1998
190 Ga0209026_1000012 3300025250 Bacteria 480426
191 Ga0209026_1000140 3300025250 Bacteria 115081
192 Ga0209026_1000158 3300025250 Bacteria 106333
193 Ga0209026_1000249 3300025250 Bacteria 68455
194 Ga0209026_1000623 3300025250 Bacteria 22318
195 Ga0209677_102331 3300025253 Bacteria 7288
196 Ga0209677_104968 3300025253 Bacteria 3623
197 Ga0209148_1000001 3300025254 Bacteria 2545271
198 Ga0209148_1000005 3300025254 Bacteria 1806504
199 Ga0209148_1000009 3300025254 Bacteria 1395625
200 Ga0209148_1000014 3300025254 Bacteria 925277
201 Ga0209148_1000039 3300025254 Bacteria 482479
202 Ga0209148_1000087 3300025254 Bacteria 260905
203 Ga0209148_1000098 3300025254 Bacteria 233172
204 Ga0209148_1002736 3300025254 Bacteria 5601
205 Ga0209759_1000750 3300025256 Bacteria 28083
206 Ga0209759_1000852 3300025256 Bacteria 23718
207 Ga0209759_1002326 3300025256 Bacteria 8526
208 Ga0209759_1003116 3300025256 Bacteria 6798
209 Ga0209759_1010047 3300025256 Bacteria 2808
210 Ga0209129_1000157 3300025258 Bacteria 105043
211 Ga0209129_1002030 3300025258 Bacteria 10476
212 Ga0209129_1008599 3300025258 Bacteria 2821
213 Ga0209233_1000002 3300025261 Bacteria 2501366
214 Ga0209233_1000080 3300025261 Bacteria 338459
215 Ga0209233_1000174 3300025261 Bacteria 144639
216 Ga0209233_1000184 3300025261 Bacteria 134246
217 Ga0209233_1000283 3300025261 Bacteria 70137
218 Ga0209565_1000022 3300025263 Bacteria 390888
219 Ga0209455_1000010 3300025272 Bacteria 959482
220 Ga0209455_1000032 3300025272 Bacteria 514243
221 Ga0209455_1000034 3300025272 Bacteria 483129
222 Ga0209455_1000039 3300025272 Bacteria 437734
223 Ga0209455_1000126 3300025272 Bacteria 165771
224 Ga0209455_1001030 3300025272 Bacteria 13880
225 Ga0209455_1004445 3300025272 Bacteria 4585
226 Ga0209673_1000087 3300025273 Bacteria 205213
227 Ga0209130_1006405 3300025284 Bacteria 3832
228 Ga0209675_1000060 3300025291 Bacteria 184316
229 Ga0209025_1000054 3300025294 Bacteria 317002
230 Ga0209564_1000302 3300025295 Bacteria 97770
231 Ga0209758_1000062 3300025297 Bacteria 317002
232 Ga0209758_1002406 3300025297 Bacteria 19172
233 Ga0209758_1037412 3300025297 Bacteria 1877
234 Ga0209050_1001760 3300025298 Bacteria 21464
235 Ga0209050_1002154 3300025298 Bacteria 17919
236 Ga0209256_1003341 3300025299 Bacteria 11380
237 Ga0209256_1005490 3300025299 Bacteria 7267
238 Ga0209256_1012323 3300025299 Bacteria 3295
239 Ga0209051_1000606 3300025303 Bacteria 41704
240 Ga0209257_1000014 3300025304 Bacteria 946850
241 Ga0209257_1000121 3300025304 Bacteria 222588
242 Ga0209257_1006948 3300025304 Bacteria 7058
243 Ga0207713_1000507 3300025735 Bacteria 39676
244 Ga0207713_1007579 3300025735 Bacteria 6371
245 Ga0207680_10000005 3300025903 Bacteria 660983
246 Ga0207647_10001002 3300025904 Bacteria 21914
247 Ga0207647_10007576 3300025904 Bacteria 7831
248 Ga0207647_10020707 3300025904 Bacteria 4406
249 Ga0207705_10011525 3300025909 Bacteria 6394
250 Ga0207705_10014974 3300025909 Bacteria 5575
251 Ga0207707_10006499 3300025912 Bacteria 10209
252 Ga0207695_10000294 3300025913 Bacteria 123676
253 Ga0207695_10001068 3300025913 Bacteria 47945
254 Ga0207695_10002599 3300025913 Bacteria 26471
255 Ga0207695_10002825 3300025913 Bacteria 25239
256 Ga0207695_10041406 3300025913 Bacteria 4931
257 Ga0207695_10063941 3300025913 Bacteria 3791
258 Ga0207695_10093960 3300025913 Bacteria 3007
259 Ga0207671_10000020 3300025914 Bacteria 309636
260 Ga0207671_10000033 3300025914 Bacteria 245869
261 Ga0207671_10001191 3300025914 Bacteria 30871
262 Ga0207693_10197695 3300025915 Bacteria 1581
263 Ga0207657_10024290 3300025919 Bacteria 5619
264 Ga0207652_10038799 3300025921 Bacteria 4039
265 Ga0207694_10000332 3300025924 Bacteria 44554
266 Ga0207650_10005976 3300025925 Bacteria 8307
267 Ga0207664_10000036 3300025929 Bacteria 173396
268 Ga0207690_10001378 3300025932 Bacteria 15253
269 Ga0207690_10010521 3300025932 Bacteria 5504
270 Ga0207690_10021020 3300025932 Bacteria 4042
271 Ga0207690_10029938 3300025932 Bacteria 3466
272 Ga0207709_10039628 3300025935 Bacteria 2815
273 Ga0207670_10002849 3300025936 Bacteria 9128
274 Ga0207667_10000130 3300025949 Bacteria 115321
275 Ga0207667_10000293 3300025949 Bacteria 69188
276 Ga0207667_10040028 3300025949 Bacteria 4990
277 Ga0207667_10127990 3300025949 Bacteria 2616
278 Ga0207640_10000103 3300025981 Bacteria 65214
279 Ga0207640_10003468 3300025981 Bacteria 8492
280 Ga0207640_10091996 3300025981 Bacteria 2103
281 Ga0207639_10008066 3300026041 Bacteria 7199
282 Ga0207678_10058827 3300026067 Bacteria 3307
283 Ga0207702_10000290 3300026078 Bacteria 58330
284 Ga0207702_10005453 3300026078 Bacteria 11129
285 Ga0207674_10000218 3300026116 Bacteria 71563
286 Ga0207674_10024726 3300026116 Bacteria 6411
287 Ga0207674_10086415 3300026116 Bacteria 3131
288 Ga0209371_1000059 3300027312 Bacteria 237154
289 Ga0268266_10000004 3300028379 Bacteria 1495817
290 Ga0268265_10190811 3300028380 Bacteria 1769
291 Ga0268256_1000055 3300030500 Bacteria 237299
292 Ga0316181_1273914 3300030744 Bacteria 4325
293 Ga0307412_10005560 3300031911 Bacteria 7075
294 Ga0307412_10007331 3300031911 Bacteria 6255
295 Ga0307412_10234954 3300031911 Bacteria 1414
296 Ga0307416_100359095 3300032002 Bacteria 1478
297 Ga0307414_10049447 3300032004 Bacteria 2907
298 Ga0395899_0000046 3300037312 Bacteria 242486
299 Ga0395899_0000175 3300037312 Bacteria 95781
300 Ga0395899_0009328 3300037312 Bacteria 7536
301 Ga0395899_0077296 3300037312 Bacteria 2428
302 Ga0395899_0109019 3300037312 Bacteria 1992
303 Ga0395900_0000012 3300037418 Bacteria 401198
304 Ga0395900_0000039 3300037418 Bacteria 248722
305 Ga0395900_0020607 3300037418 Bacteria 6735
306 Ga0395900_0056221 3300037418 Bacteria 4051
307 Ga0395898_0000034 3300037466 Bacteria 356745
308 Ga0395898_0000197 3300037466 Bacteria 155187
309 Ga0395898_0053114 3300037466 Bacteria 3957
310 Ga0395898_0053718 3300037466 Bacteria 3934
311 Ga0395898_0113447 3300037466 Bacteria 2597
312 Ga0395898_0147621 3300037466 Bacteria 2250
313 Ga0395901_0005891 3300038443 Bacteria 12404
314 Ga0395901_0060044 3300038443 Bacteria 3956
315 Ga0395901_0134582 3300038443 Bacteria 2597
316 Ga0395901_0186022 3300038443 Bacteria 2178
317 Ga0395901_0326608 3300038443 Bacteria 1587
318 Ga0237819_00252 3300038705 Bacteria 19595
319 Ga0439436_0000014 3300041404 Bacteria 90241
320 Ga0439465_0003345 3300041413 Bacteria 5237
321 Ga0451791_0221684 3300041451 Bacteria 3164
322 Ga0451793_0417357 3300041452 Bacteria 1836
323 Ga0451800_0139849 3300041459 Bacteria 5083
324 Ga0451807_0813515 3300041486 Bacteria 2540
325 Ga0451833_0048849 3300041491 Bacteria 1662
326 Ga0451837_1456316 3300041494 Bacteria 4960
327 Ga0451843_0383473 3300041509 Bacteria 2929
328 Ga0450908_000020 3300042184 Bacteria 37390
329 Ga0466969_0006890 3300044656 Bacteria 6049
330 Ga0466969_0011780 3300044656 Bacteria 4624
331 Ga0466972_0001559 3300044658 Bacteria 11179
332 Ga0466975_0039304 3300044661 Bacteria 3339
333 Ga0466982_0001571 3300044672 Bacteria 8499
334 Ga0466966_0015868 3300044684 Bacteria 4979
335 Ga0466966_0030247 3300044684 Bacteria 3516
336 Ga0466961_0000983 3300044693 Bacteria 17675
337 Ga0466961_0009198 3300044693 Bacteria 6290
338 Ga0466961_0011333 3300044693 Bacteria 5701
339 Ga0466961_0031621 3300044693 Bacteria 3402
340 Ga0466961_0083008 3300044693 Bacteria 2026
341 Ga0466963_0135867 3300044694 Bacteria 1701
342 Ga0466971_0004168 3300044719 Bacteria 6230
343 Ga0466971_0009512 3300044719 Bacteria 4244
344 Ga0466971_0013357 3300044719 Bacteria 3606
345 Ga0466968_0008983 3300044735 Bacteria 3841
346 Ga0466970_0001017 3300044765 Bacteria 13518
347 Ga0466970_0013560 3300044765 Bacteria 4181
348 Ga0466970_0039510 3300044765 Bacteria 2503
349 Ga0466970_0046877 3300044765 Bacteria 2302
350 Ga0466970_0104067 3300044765 Bacteria 1547
351 Ga0466957_0006091 3300044842 Bacteria 6808
352 Ga0466957_0100543 3300044842 Bacteria 1822
353 Ga0466959_0054207 3300045049 Bacteria 2930
354 Ga0466959_0055550 3300045049 Bacteria 2890
355 Ga0466959_0081593 3300045049 Bacteria 2330
356 Ga0466958_0005201 3300045836 Bacteria 6972
357 Ga0466958_0115596 3300045836 Bacteria 1676
358 Ga0466967_0084458 3300045976 Bacteria 2873
359 Ga0495617_000411 3300046452 Bacteria 23420
360 Ga0495617_010690 3300046452 Bacteria 3143
361 Ga0495590_0036029 3300046457 Bacteria 1726
362 Ga0495638_0000159 3300046460 Bacteria 106490
363 Ga0495638_0000161 3300046460 Bacteria 104406
364 Ga0495638_0000246 3300046460 Bacteria 74281
365 Ga0495638_0001421 3300046460 Bacteria 21733
366 Ga0495650_0000197 3300046471 Bacteria 131300
367 Ga0495650_0000590 3300046471 Bacteria 50202
368 Ga0495650_0001258 3300046471 Bacteria 26169
369 Ga0495584_0002602 3300046491 Bacteria 10162
370 Ga0495585_0000623 3300046492 Bacteria 32946
371 Ga0495585_0001230 3300046492 Bacteria 20734
372 Ga0495607_0000046 3300046501 Bacteria 123998
373 Ga0495607_0000508 3300046501 Bacteria 38562
374 Ga0495607_0003198 3300046501 Bacteria 12654
375 Ga0495583_0032424 3300046506 Bacteria 2521
376 Ga0495606_0000356 3300046507 Bacteria 78185
377 Ga0495606_0000940 3300046507 Bacteria 42915
378 Ga0495606_0001458 3300046507 Bacteria 31590
379 Ga0495606_0009272 3300046507 Bacteria 8352
380 Ga0495606_0048591 3300046507 Bacteria 2789
381 Ga0495610_0002744 3300046512 Bacteria 14471
382 Ga0495616_0000062 3300046513 Bacteria 91197
383 Ga0495616_0018719 3300046513 Bacteria 3794
384 Ga0495620_0002390 3300046515 Bacteria 10873
385 Ga0495631_0000157 3300046518 Bacteria 45751
386 Ga0495631_0003247 3300046518 Bacteria 8939
387 Ga0495632_0000003 3300046519 Bacteria 396071
388 Ga0495632_0006126 3300046519 Bacteria 7795
389 Ga0495637_0019037 3300046520 Bacteria 3179
390 Ga0495643_0003481 3300046522 Bacteria 11485
391 Ga0495648_0002187 3300046524 Bacteria 18314
392 Ga0495648_0002466 3300046524 Bacteria 17025
393 Ga0495609_0007018 3300046538 Bacteria 5677
394 Ga0495668_0003971 3300046616 Bacteria 10778
395 Ga0495611_0000001 3300046648 Bacteria 2628469
396 Ga0495611_0000258 3300046648 Bacteria 36465
397 Ga0495625_0000001 3300046660 Bacteria 1641829
398 Ga0495625_0013224 3300046660 Bacteria 6645
399 Ga0495625_0021685 3300046660 Bacteria 4941
400 Ga0495625_0031562 3300046660 Bacteria 3938
401 Ga0495625_0108521 3300046660 Bacteria 1899
402 Ga0495661_0025776 3300046665 Bacteria 3793
403 Ga0495670_0001900 3300046691 Bacteria 10296
404 Ga0495670_0002153 3300046691 Bacteria 9738
405 Ga0495671_0000634 3300046692 Bacteria 25637
406 Ga0495649_0002293 3300046694 Bacteria 13595
407 Ga0495649_0044406 3300046694 Bacteria 2426
408 Ga0495589_0000314 3300046794 Bacteria 38602
409 Ga0495660_0002147 3300046810 Bacteria 12713
410 Ga0495660_0002345 3300046810 Bacteria 12113
411 Ga0495672_0000455 3300047320 Bacteria 48439
412 Ga0495683_0004404 3300047323 Bacteria 8002
413 Ga0495679_000001 3300047446 Bacteria 1607568
414 Ga0495673_0000001 3300047469 Bacteria 1630730
415 Ga0495673_0000030 3300047469 Bacteria 468915
416 Ga0495673_0000562 3300047469 Bacteria 37800
417 Ga0495686_0000019 3300047472 Bacteria 434054
418 Ga0495686_0000175 3300047472 Bacteria 122163
419 Ga0495686_0004837 3300047472 Bacteria 10873
420 Ga0495686_0010033 3300047472 Bacteria 6765
421 Ga0495686_0074523 3300047472 Bacteria 2082
422 Ga0496101_0016276 3300048904 Bacteria 5019
423 Ga0496105_0016340 3300048908 Bacteria 5924
424 Ga0496105_0017638 3300048908 Bacteria 5727
425 Ga0496106_0005098 3300048909 Bacteria 9726
426 Ga0496106_0051486 3300048909 Bacteria 3105
427 Ga0496113_0022124 3300048916 Bacteria 4492
428 Ga0496114_0092116 3300048917 Bacteria 2575
429 Ga0496115_0000974 3300048918 Bacteria 20806
430 Ga0496115_0001165 3300048918 Bacteria 18867
431 Ga0496115_0024163 3300048918 Bacteria 4722
432 Ga0496115_0033324 3300048918 Bacteria 4066
433 Ga0496116_0008342 3300048919 Bacteria 9004
434 Ga0496116_0009818 3300048919 Bacteria 8110
435 Ga0496116_0033151 3300048919 Bacteria 3668
436 Ga0496117_0005879 3300048920 Bacteria 12682
437 Ga0496117_0009735 3300048920 Bacteria 8868
438 Ga0496117_0010591 3300048920 Bacteria 8379
439 Ga0496117_0013334 3300048920 Bacteria 7177
440 Ga0496118_0000362 3300048921 Bacteria 76786
441 Ga0496118_0001376 3300048921 Bacteria 36678
442 Ga0496118_0002751 3300048921 Bacteria 23098
443 Ga0496118_0008539 3300048921 Bacteria 10565
444 Ga0496118_0030076 3300048921 Bacteria 4542
445 Ga0496118_0033110 3300048921 Bacteria 4247
446 Ga0496118_0048926 3300048921 Bacteria 3259
447 Ga0496118_0054469 3300048921 Bacteria 3029
448 Ga0496119_0000851 3300048922 Bacteria 40261
449 Ga0496119_0001095 3300048922 Bacteria 34129
450 Ga0496119_0005052 3300048922 Bacteria 12826
451 Ga0496119_0006339 3300048922 Bacteria 11010
452 Ga0496120_0001387 3300048923 Bacteria 29403
453 Ga0496120_0002462 3300048923 Bacteria 18657
454 Ga0496120_0004003 3300048923 Bacteria 12799
455 Ga0496120_0013968 3300048923 Bacteria 5374
456 Ga0496121_0000376 3300048924 Bacteria 91480
457 Ga0496121_0001290 3300048924 Bacteria 43154
458 Ga0496121_0004611 3300048924 Bacteria 18358
459 Ga0496121_0007636 3300048924 Bacteria 12994
460 Ga0496121_0009617 3300048924 Bacteria 11074
461 Ga0496121_0014077 3300048924 Bacteria 8532
462 Ga0496121_0031203 3300048924 Bacteria 4873
463 Ga0496121_0038544 3300048924 Bacteria 4228
464 Ga0496122_0003014 3300048925 Bacteria 22846
465 Ga0496122_0012864 3300048925 Bacteria 8272
466 Ga0496122_0018868 3300048925 Bacteria 6339
467 Ga0496122_0022593 3300048925 Bacteria 5584
468 Ga0496123_0000619 3300048926 Bacteria 59624
469 Ga0496123_0005952 3300048926 Bacteria 12009
470 Ga0496123_0011606 3300048926 Bacteria 7615
471 Ga0496123_0038701 3300048926 Bacteria 3347
472 Ga0496123_0041655 3300048926 Bacteria 3179
473 Ga0496123_0064454 3300048926 Bacteria 2335
474 Ga0496123_0067236 3300048926 Bacteria 2264
475 Ga0496123_0139534 3300048926 Bacteria 1328
476 Ga0496124_0000411 3300048927 Bacteria 76929
477 Ga0496124_0000808 3300048927 Bacteria 50879
478 Ga0496124_0008706 3300048927 Bacteria 10546
479 Ga0496124_0009017 3300048927 Bacteria 10320
480 Ga0496124_0009858 3300048927 Bacteria 9770
481 Ga0496124_0015807 3300048927 Bacteria 7211
482 Ga0496124_0022121 3300048927 Bacteria 5837
483 Ga0496124_0028626 3300048927 Bacteria 4981
484 Ga0496124_0044067 3300048927 Bacteria 3830
485 Ga0496125_0000344 3300048928 Bacteria 88380
486 Ga0496125_0009078 3300048928 Bacteria 10287
487 Ga0496125_0009310 3300048928 Bacteria 10130
488 Ga0496125_0013084 3300048928 Bacteria 8182
489 Ga0496125_0014372 3300048928 Bacteria 7713
490 Ga0496125_0023264 3300048928 Bacteria 5723
491 Ga0496126_0003518 3300048929 Bacteria 19705
492 Ga0496126_0010449 3300048929 Bacteria 9727
493 Ga0496126_0036762 3300048929 Bacteria 4576
494 Ga0496126_0048515 3300048929 Bacteria 3879
495 Ga0496126_0071889 3300048929 Bacteria 3078
496 Ga0496126_0121700 3300048929 Bacteria 2262
497 Ga0496126_0224678 3300048929 Bacteria 1575
498 Ga0495678_000296 3300049459 Bacteria 54659
499 Ga0495682_0009360 3300049460 Bacteria 3823
500 Ga0495682_0015347 3300049460 Bacteria 2902
501 Ga0501031_0121698 3300049568 Bacteria 1705
502 Ga0501032_0046667 3300049569 Bacteria 2927
503 Ga0501032_0066247 3300049569 Bacteria 2414
504 Ga0501033_0000550 3300049570 Bacteria 34940
505 Ga0501034_0016514 3300049571 Bacteria 7573
506 Ga0501034_0095519 3300049571 Bacteria 2969
507 Ga0501034_0129629 3300049571 Bacteria 2506
508 Ga0501036_0036107 3300049572 Bacteria 4181
509 Ga0501037_0046330 3300049573 Bacteria 3189
510 Ga0501038_0094206 3300049574 Bacteria 2504
511 Ga0501038_0188767 3300049574 Bacteria 1659
512 Ga0501043_0033733 3300049579 Bacteria 4028
513 Ga0501043_0036992 3300049579 Bacteria 3840
514 Ga0501047_0038762 3300049581 Bacteria 4610
515 Ga0501048_0053386 3300049582 Bacteria 2874
516 Ga0501070_0007853 3300049586 Bacteria 9042
517 Ga0501070_0089761 3300049586 Bacteria 2543
518 Ga0501035_0005508 3300049822 Bacteria 11963
519 Ga0501035_0056441 3300049822 Bacteria 3503
520 Ga0501035_0128459 3300049822 Bacteria 2211
521 Ga0501044_0034823 3300049823 Bacteria 5278
522 Ga0501044_0128406 3300049823 Bacteria 2531
523 Ga0501044_0171424 3300049823 Bacteria 2141
524 Ga0501044_0241477 3300049823 Bacteria 1750
525 Ga0500643_000002 3300053087 Bacteria 1277657
526 Ga0500651_0000413 3300053093 Bacteria 23063
527 Ga0500555_000631 3300053103 Bacteria 13597
528 Ga0500645_001002 3300053730 Bacteria 15937
529 2525556790 2524614729 Bacteria 3091755
530 2538834049 2537561836 Bacteria 3910579
531 2578457869 2576861471 Bacteria 4648976
532 2595445928 2593339238 Bacteria 4182970
533 2595452653 2593339239 Bacteria 4124669
534 2630648386 2627854209 Bacteria 3093011
535 2643830711 2643221562 Bacteria 4048635
536 2643894089 2643221577 Bacteria 3710843
537 2644476292 2643221685 Bacteria 3673288
538 2687582860 2687453130 Bacteria 4227172
539 2721027698 2718218334 Bacteria 4765486
540 2735836742 2734482264 Unclassified 5014763
541 2739228659 2738543009 Bacteria 4944499
542 2739731745 2739367700 Bacteria 4747630
543 2748015777 2747842501 Bacteria 5293829
544 2819562978 2818991440 Bacteria 4774720
545 2819663036 2818991457 Bacteria 5323295
546 2842391887 2842391507 Bacteria 4486072
547 2842760159 2842757796 Bacteria 3981385
548 2842916278 2842914999 Bacteria 4419378
549 2842918904 2842918807 Bacteria 4289178
550 2852650306 2852649853 Bacteria 4036942
551 2852685971 2852684882 Bacteria 5463342
552 2857446784 2857442823 Bacteria 4562550
553 2874222321 2874220319 Bacteria 4594709
554 2884340339 2884338543 Bacteria 4610696
555 2884414073 2884411467 Bacteria 5246714
556 2895396706 2895395659 Bacteria 3983269
557 2904463590 2904463128 Bacteria 4775606
558 2919085587 2919085039 Bacteria 4532964
559 2919091096 2919089067 Bacteria 4560942
560 2919133509 2919130084 Bacteria 5301837
561 2919405227 2919404418 Bacteria 4232372
562 2928497646 2928496128 Bacteria 4631123
563 2928967350 2928963466 Bacteria 5165703
564 2929197437 2929195423 Bacteria 5325372
565 2937613290 2937610967 Bacteria 4618818
566 2939592928 2939589442 Bacteria 4214238
567 2939614506 2939611941 Bacteria 3892017
568 2939628954 2939626828 Bacteria 4695272
569 2941473457 2941471342 Bacteria 5018624
570 2941476389 2941475908 Bacteria 4145589
571 2953994808 2953994433 Bacteria 4303959
572 2961049086 2961047084 Bacteria 4594415
573 2961066218 2961064222 Bacteria 4749990
574 2974308469 2974307012 Bacteria 4172388
575 2977249223 2977247770 Bacteria 4160543
576 2984516321 2984514374 Bacteria 4172479
577 8021624229 8021622325 Bacteria 4844743
578 8021628275 8021626552 Bacteria 4665214
579 8021652026 8021648035 Bacteria 4772378
580 Ga0207707_10076682
581 JGI24739J22299_10000042
582 JGI24739J22299_10000993
583 JGI24737J22298_10009924
584 JGI24735J21928_10003420
585 JGI25156J39149_1000899
586 JGI25156J39149_1002483
587 JGI25162J39368_1000068
588 JGI25162J39368_1000529
589 JGI25162J39368_1000746
590 JGI25162J39368_1001106
591 JGI25162J39368_1001478
592 JGI25162J39368_1002607
593 JGI25157J39369_1000198
594 JGI25157J39369_1000446
595 JGI25157J39369_1000503
596 JGI25157J39369_1000649
597 JGI25157J39369_1002597
598 JGI25163J39215_1001143
599 JGI25164J39214_1000102
600 JGI25164J39214_1000142
601 JGI25164J39214_1000366
602 JGI25164J39214_1000443
603 JGI25152J39213_1000032
604 JGI25150J39212_1000179
605 JGI25151J46595_10000138
606 JGI25165J46597_1000058
607 JGI25165J46597_1000090
608 JGI25165J46597_1000405
609 JGI25165J46597_1003705
610 JGI25153J46596_10000102
611 JGI25153J46596_10016785
612 rootH1_10069378
613 rootH2_10011619
614 Ga0006562J51391_1070642
615 Ga0055538_1000912
616 Ga0055533_1002518
617 Ga0055533_1003187
618 Ga0055533_1005874
619 Ga0055525_1000282
620 Ga0055527_1000048
621 Ga0055527_1000105
622 Ga0055527_1000125
623 Ga0055527_1000630
624 Ga0055535_1000034
625 Ga0055535_1000150
626 Ga0055535_1000170
627 Ga0055535_1000765
628 Ga0055535_1001380
629 Ga0055535_1001421
630 Ga0055542_1000081
631 Ga0055542_1000112
632 Ga0055542_1000118
633 Ga0055542_1000198
634 Ga0055542_1000685
635 Ga0055542_1001350
636 Ga0055542_1001389
637 Ga0055529_1000083
638 Ga0055529_1000132
639 Ga0055529_1000305
640 Ga0055529_1000343
641 Ga0055526_1000413
642 Ga0055537_1000349
643 Ga0055524_1008744
644 Ga0055534_1000073
645 Ga0055528_1000080
646 Ga0055530_10001767
647 Ga0055530_10003477
648 Ga0058692_1000023
649 Ga0065165_1000001
650 Ga0065165_1003057
651 Ga0065704_10073413
652 Ga0070658_10014243
653 Ga0070670_100005062
654 Ga0070666_10000005
655 Ga0070680_100132190
656 Ga0070682_100005891
657 Ga0070682_100017419
658 Ga0070660_100016267
659 Ga0070689_100096116
660 Ga0070661_100014230
661 Ga0070659_100001123
662 Ga0070659_100091641
663 Ga0070667_100018857
664 Ga0070714_100000939
665 Ga0070714_100007346
666 Ga0070713_100002465
667 Ga0070681_10003155
668 Ga0070685_10001904
669 Ga0068853_100006103
670 Ga0068853_100032558
671 Ga0070696_100008073
672 Ga0070696_100017249
673 Ga0070665_100016441
674 Ga0070665_100062091
675 Ga0068855_100039384
676 Ga0068855_100084500
677 Ga0068855_100088408
678 Ga0068854_100007994
679 Ga0068856_100002390
680 Ga0068856_100002901
681 Ga0068856_100040275
682 Ga0068858_100019131
683 Ga0068862_100130201
684 Ga0075364_10015664
685 Ga0075367_10026170
686 Ga0105251_10000108
687 Ga0105251_10006958
688 Ga0105240_10013498
689 Ga0105240_10072871
690 Ga0105240_10086921
691 Ga0105240_10092054
692 Ga0105240_10132088
693 Ga0105243_10067280
694 Ga0105237_10000023
695 Ga0105237_10001198
696 Ga0105238_10000060
697 Ga0105238_10070855
698 Ga0105239_10000044
699 Ga0157373_10010095
700 Ga0157373_10014543
701 Ga0157373_10029899
702 Ga0157373_10051211
703 Ga0157373_10079818
704 Ga0157371_10003647
705 Ga0157371_10014602
706 Ga0157371_10026030
707 Ga0157371_10075801
708 Ga0157370_10001227
709 Ga0157370_10005668
710 Ga0157370_10050405
711 Ga0157370_10065362
712 Ga0157369_10000364
713 Ga0157369_10005722
714 Ga0163162_10055455
715 Ga0157372_10009601
716 Ga0157372_10016735
717 Ga0182008_10002089
718 Ga0182008_10002596
719 Ga0182008_10025633
720 Ga0182006_1007530
721 Ga0182006_1012898
722 Ga0182007_10000353
723 Ga0182007_10009307
724 Ga0182007_10020351
725 Ga0182005_1000004
726 Ga0182005_1000344
727 Ga0183369_1012
728 Ga0183368_1003
729 Ga0163161_10007121
730 Ga0163161_10012244
731 Ga0206353_11824210
732 Ga0209760_100462
733 Ga0209784_100016
734 Ga0209674_100012
735 Ga0209674_100026
736 Ga0209674_100244
737 Ga0209674_100318
738 Ga0209674_100489
739 Ga0209674_100669
740 Ga0209672_100007
741 Ga0209672_100016
742 Ga0209672_100017
743 Ga0209672_100078
744 Ga0209672_100673
745 Ga0209672_102112
746 Ga0209563_100169
747 Ga0207427_100019
748 Ga0207427_100033
749 Ga0207427_100050
750 Ga0207427_100123
751 Ga0209437_100012
752 Ga0209437_100105
753 Ga0209437_100120
754 Ga0209437_100192
755 Ga0209437_100227
756 Ga0209437_102614
757 Ga0209258_100012
758 Ga0209258_100038
759 Ga0209258_100039
760 Ga0209258_100046
761 Ga0209258_100095
762 Ga0209258_100308
763 Ga0209258_101017
764 Ga0209258_104741
765 Ga0207425_1000078
766 Ga0209646_1000307
767 Ga0209646_1000581
768 Ga0209646_1006311
769 Ga0209026_1000012
770 Ga0209026_1000140
771 Ga0209026_1000158
772 Ga0209026_1000249
773 Ga0209026_1000623
774 Ga0209677_102331
775 Ga0209677_104968
776 Ga0209148_1000001
777 Ga0209148_1000005
778 Ga0209148_1000009
779 Ga0209148_1000014
780 Ga0209148_1000039
781 Ga0209148_1000087
782 Ga0209148_1000098
783 Ga0209148_1002736
784 Ga0209759_1000750
785 Ga0209759_1000852
786 Ga0209759_1002326
787 Ga0209759_1003116
788 Ga0209759_1010047
789 Ga0209129_1000157
790 Ga0209129_1002030
791 Ga0209129_1008599
792 Ga0209233_1000002
793 Ga0209233_1000080
794 Ga0209233_1000174
795 Ga0209233_1000184
796 Ga0209233_1000283
797 Ga0209565_1000022
798 Ga0209455_1000010
799 Ga0209455_1000032
800 Ga0209455_1000034
801 Ga0209455_1000039
802 Ga0209455_1000126
803 Ga0209455_1001030
804 Ga0209455_1004445
805 Ga0209673_1000087
806 Ga0209130_1006405
807 Ga0209675_1000060
808 Ga0209025_1000054
809 Ga0209564_1000302
810 Ga0209758_1000062
811 Ga0209758_1002406
812 Ga0209758_1037412
813 Ga0209050_1001760
814 Ga0209050_1002154
815 Ga0209256_1003341
816 Ga0209256_1005490
817 Ga0209256_1012323
818 Ga0209051_1000606
819 Ga0209257_1000014
820 Ga0209257_1000121
821 Ga0209257_1006948
822 Ga0207713_1000507
823 Ga0207713_1007579
824 Ga0207680_10000005
825 Ga0207647_10001002
826 Ga0207647_10007576
827 Ga0207647_10020707
828 Ga0207705_10011525
829 Ga0207705_10014974
830 Ga0207707_10006499
831 Ga0207695_10000294
832 Ga0207695_10001068
833 Ga0207695_10002599
834 Ga0207695_10002825
835 Ga0207695_10041406
836 Ga0207695_10063941
837 Ga0207695_10093960
838 Ga0207671_10000020
839 Ga0207671_10000033
840 Ga0207671_10001191
841 Ga0207693_10197695
842 Ga0207657_10024290
843 Ga0207652_10038799
844 Ga0207694_10000332
845 Ga0207650_10005976
846 Ga0207664_10000036
847 Ga0207690_10001378
848 Ga0207690_10010521
849 Ga0207690_10021020
850 Ga0207690_10029938
851 Ga0207709_10039628
852 Ga0207670_10002849
853 Ga0207667_10000130
854 Ga0207667_10000293
855 Ga0207667_10040028
856 Ga0207667_10127990
857 Ga0207640_10000103
858 Ga0207640_10003468
859 Ga0207640_10091996
860 Ga0207639_10008066
861 Ga0207678_10058827
862 Ga0207702_10000290
863 Ga0207702_10005453
864 Ga0207674_10000218
865 Ga0207674_10024726
866 Ga0207674_10086415
867 Ga0209371_1000059
868 Ga0268266_10000004
869 Ga0268265_10190811
870 Ga0268256_1000055
871 Ga0316181_1273914
872 Ga0307412_10005560
873 Ga0307412_10007331
874 Ga0307412_10234954
875 Ga0307416_100359095
876 Ga0307414_10049447
877 Ga0395899_0000046
878 Ga0395899_0000175
879 Ga0395899_0009328
880 Ga0395899_0077296
881 Ga0395899_0109019
882 Ga0395900_0000012
883 Ga0395900_0000039
884 Ga0395900_0020607
885 Ga0395900_0056221
886 Ga0395898_0000034
887 Ga0395898_0000197
888 Ga0395898_0053114
889 Ga0395898_0053718
890 Ga0395898_0113447
891 Ga0395898_0147621
892 Ga0395901_0005891
893 Ga0395901_0060044
894 Ga0395901_0134582
895 Ga0395901_0186022
896 Ga0395901_0326608
897 Ga0237819_00252
898 Ga0439436_0000014
899 Ga0439465_0003345
900 Ga0451791_0221684
901 Ga0451793_0417357
902 Ga0451800_0139849
903 Ga0451807_0813515
904 Ga0451833_0048849
905 Ga0451837_1456316
906 Ga0451843_0383473
907 Ga0450908_000020
908 Ga0466969_0006890
909 Ga0466969_0011780
910 Ga0466972_0001559
911 Ga0466975_0039304
912 Ga0466982_0001571
913 Ga0466966_0015868
914 Ga0466966_0030247
915 Ga0466961_0000983
916 Ga0466961_0009198
917 Ga0466961_0011333
918 Ga0466961_0031621
919 Ga0466961_0083008
920 Ga0466963_0135867
921 Ga0466971_0004168
922 Ga0466971_0009512
923 Ga0466971_0013357
924 Ga0466968_0008983
925 Ga0466970_0001017
926 Ga0466970_0013560
927 Ga0466970_0039510
928 Ga0466970_0046877
929 Ga0466970_0104067
930 Ga0466957_0006091
931 Ga0466957_0100543
932 Ga0466959_0054207
933 Ga0466959_0055550
934 Ga0466959_0081593
935 Ga0466958_0005201
936 Ga0466958_0115596
937 Ga0466967_0084458
938 Ga0495617_000411
939 Ga0495617_010690
940 Ga0495590_0036029
941 Ga0495638_0000159
942 Ga0495638_0000161
943 Ga0495638_0000246
944 Ga0495638_0001421
945 Ga0495650_0000197
946 Ga0495650_0000590
947 Ga0495650_0001258
948 Ga0495584_0002602
949 Ga0495585_0000623
950 Ga0495585_0001230
951 Ga0495607_0000046
952 Ga0495607_0000508
953 Ga0495607_0003198
954 Ga0495583_0032424
955 Ga0495606_0000356
956 Ga0495606_0000940
957 Ga0495606_0001458
958 Ga0495606_0009272
959 Ga0495606_0048591
960 Ga0495610_0002744
961 Ga0495616_0000062
962 Ga0495616_0018719
963 Ga0495620_0002390
964 Ga0495631_0000157
965 Ga0495631_0003247
966 Ga0495632_0000003
967 Ga0495632_0006126
968 Ga0495637_0019037
969 Ga0495643_0003481
970 Ga0495648_0002187
971 Ga0495648_0002466
972 Ga0495609_0007018
973 Ga0495668_0003971
974 Ga0495611_0000001
975 Ga0495611_0000258
976 Ga0495625_0000001
977 Ga0495625_0013224
978 Ga0495625_0021685
979 Ga0495625_0031562
980 Ga0495625_0108521
981 Ga0495661_0025776
982 Ga0495670_0001900
983 Ga0495670_0002153
984 Ga0495671_0000634
985 Ga0495649_0002293
986 Ga0495649_0044406
987 Ga0495589_0000314
988 Ga0495660_0002147
989 Ga0495660_0002345
990 Ga0495672_0000455
991 Ga0495683_0004404
992 Ga0495679_000001
993 Ga0495673_0000001
994 Ga0495673_0000030
995 Ga0495673_0000562
996 Ga0495686_0000019
997 Ga0495686_0000175
998 Ga0495686_0004837
999 Ga0495686_0010033
1000 Ga0495686_0074523
1001 Ga0496101_0016276
1002 Ga0496105_0016340
1003 Ga0496105_0017638
1004 Ga0496106_0005098
1005 Ga0496106_0051486
1006 Ga0496113_0022124
1007 Ga0496114_0092116
1008 Ga0496115_0000974
1009 Ga0496115_0001165
1010 Ga0496115_0024163
1011 Ga0496115_0033324
1012 Ga0496116_0008342
1013 Ga0496116_0009818
1014 Ga0496116_0033151
1015 Ga0496117_0005879
1016 Ga0496117_0009735
1017 Ga0496117_0010591
1018 Ga0496117_0013334
1019 Ga0496118_0000362
1020 Ga0496118_0001376
1021 Ga0496118_0002751
1022 Ga0496118_0008539
1023 Ga0496118_0030076
1024 Ga0496118_0033110
1025 Ga0496118_0048926
1026 Ga0496118_0054469
1027 Ga0496119_0000851
1028 Ga0496119_0001095
1029 Ga0496119_0005052
1030 Ga0496119_0006339
1031 Ga0496120_0001387
1032 Ga0496120_0002462
1033 Ga0496120_0004003
1034 Ga0496120_0013968
1035 Ga0496121_0000376
1036 Ga0496121_0001290
1037 Ga0496121_0004611
1038 Ga0496121_0007636
1039 Ga0496121_0009617
1040 Ga0496121_0014077
1041 Ga0496121_0031203
1042 Ga0496121_0038544
1043 Ga0496122_0003014
1044 Ga0496122_0012864
1045 Ga0496122_0018868
1046 Ga0496122_0022593
1047 Ga0496123_0000619
1048 Ga0496123_0005952
1049 Ga0496123_0011606
1050 Ga0496123_0038701
1051 Ga0496123_0041655
1052 Ga0496123_0064454
1053 Ga0496123_0067236
1054 Ga0496123_0139534
1055 Ga0496124_0000411
1056 Ga0496124_0000808
1057 Ga0496124_0008706
1058 Ga0496124_0009017
1059 Ga0496124_0009858
1060 Ga0496124_0015807
1061 Ga0496124_0022121
1062 Ga0496124_0028626
1063 Ga0496124_0044067
1064 Ga0496125_0000344
1065 Ga0496125_0009078
1066 Ga0496125_0009310
1067 Ga0496125_0013084
1068 Ga0496125_0014372
1069 Ga0496125_0023264
1070 Ga0496126_0003518
1071 Ga0496126_0010449
1072 Ga0496126_0036762
1073 Ga0496126_0048515
1074 Ga0496126_0071889
1075 Ga0496126_0121700
1076 Ga0496126_0224678
1077 Ga0495678_000296
1078 Ga0495682_0009360
1079 Ga0495682_0015347
1080 Ga0501031_0121698
1081 Ga0501032_0046667
1082 Ga0501032_0066247
1083 Ga0501033_0000550
1084 Ga0501034_0016514
1085 Ga0501034_0095519
1086 Ga0501034_0129629
1087 Ga0501036_0036107
1088 Ga0501037_0046330
1089 Ga0501038_0094206
1090 Ga0501038_0188767
1091 Ga0501043_0033733
1092 Ga0501043_0036992
1093 Ga0501047_0038762
1094 Ga0501048_0053386
1095 Ga0501070_0007853
1096 Ga0501070_0089761
1097 Ga0501035_0005508
1098 Ga0501035_0056441
1099 Ga0501035_0128459
1100 Ga0501044_0034823
1101 Ga0501044_0128406
1102 Ga0501044_0171424
1103 Ga0501044_0241477
1104 Ga0500643_000002
1105 Ga0500651_0000413
1106 Ga0500555_000631
1107 Ga0500645_001002
1108 2525556790
1109 2538834049
1110 2578457869
1111 2595445928
1112 2595452653
1113 2630648386
1114 2643830711
1115 2643894089
1116 2644476292
1117 2687582860
1118 2721027698
1119 2735836742
1120 2739228659
1121 2739731745
1122 2748015777
1123 2819562978
1124 2819663036
1125 2842391887
1126 2842760159
1127 2842916278
1128 2842918904
1129 2852650306
1130 2852685971
1131 2857446784
1132 2874222321
1133 2884340339
1134 2884414073
1135 2895396706
1136 2904463590
1137 2919085587
1138 2919091096
1139 2919133509
1140 2919405227
1141 2928497646
1142 2928967350
1143 2929197437
1144 2937613290
1145 2939592928
1146 2939614506
1147 2939628954
1148 2941473457
1149 2941476389
1150 2953994808
1151 2961049086
1152 2961066218
1153 2974308469
1154 2977249223
1155 2984516321
1156 8021624229
1157 8021628275
1158 8021652026

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

61

99

0.95

PF01494

FAD_binding_3

FAD binding domain

350

438

0.85

PF01494

FAD_binding_3

FAD binding domain

114

263

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.9659 8 37
8a5z-assembly1.cif.gz_A imine reductase from ensifer adhaerens a208n mutant in complex with nadp+ 0.9598 6 37
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9596 8 38
5x6p-assembly2.cif.gz_B crystal structure of pseudomonas fluorescens kmo 0.9589 8 465
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9574 7 36
ID Description Score Start End Superfamily
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9455 8 382 3.50.50.60
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9437 7 37 3.40.50.720
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 6 36 3.40.50.720
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9429 8 37 3.40.50.720
af_F4IAP5_3_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 7 36 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5B9E1R9-F1-model_v4 Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) 0.9782 6 470 GO:0004502
GO:0006569
GO:0019805
GO:0034354
GO:0043420
GO:0070189
GO:0071949
AF-A0A154R2R4-F1-model_v4 Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) 0.9729 1 470 GO:0004502
GO:0006569
GO:0019805
GO:0034354
GO:0043420
GO:0070189
GO:0071949
AF-A0A5B9E1R9-F1-model_v4 Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) 0.9718 6 470 GO:0004502
GO:0006569
GO:0019805
GO:0034354
GO:0043420
GO:0070189
GO:0071949
AF-A0A7V8JF61-F1-model_v4 Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) 0.9715 4 465 GO:0004502
GO:0006569
GO:0019805
GO:0034354
GO:0043420
GO:0070189
GO:0071949
AF-A0A7X5UBP5-F1-model_v4 Kynurenine 3-monooxygenase (EC 1.14.13.9) (Kynurenine 3-hydroxylase) 0.971 4 465 GO:0004502
GO:0006569
GO:0019805
GO:0034354
GO:0043420
GO:0070189
GO:0071949

Map