F465874

General Info

Members Datasets Scaffolds Average Seq Length
579 220 1158 108

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0523462|Ga0501034_0523462_217_531
Length 104
Sequence MSAAYTADAPTREEVDAMEGPVVLEFGTSWCGFCRAAQPLIERAIPAGGVRHLKIEDGPGRPLGRSFRVKLWPTLVFLKDGREVAQVTRPRSDAEIAQALAQIA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
88 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
89 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
90 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
220 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.04
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 4.15
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0523462 3300049571 Bacteria 1097
2 MBSR1b_contig_212366 2162886012 Bacteria 997
3 rootL2_10083997 3300003322 Bacteria 1141
4 Ga0055525_1000008 3300003759 Bacteria 604287
5 Ga0065715_10113342 3300005293 Bacteria 2494
6 Ga0070658_10030293 3300005327 Bacteria 4348
7 Ga0070658_10131301 3300005327 Bacteria 2088
8 Ga0070658_11324158 3300005327 Bacteria 625
9 Ga0068869_100326347 3300005334 Bacteria 1246
10 Ga0068869_101083320 3300005334 Bacteria 700
11 Ga0070660_100005417 3300005339 Bacteria 8834
12 Ga0070660_100031938 3300005339 Bacteria 3959
13 Ga0070660_100119349 3300005339 Bacteria 2103
14 Ga0070660_100629975 3300005339 Bacteria 898
15 Ga0070661_100050323 3300005344 Bacteria 3048
16 Ga0070661_101199127 3300005344 Bacteria 635
17 Ga0070671_100361638 3300005355 Unclassified 1239
18 Ga0070674_100412387 3300005356 Bacteria 1106
19 Ga0070659_100062517 3300005366 Bacteria 2943
20 Ga0070659_100108610 3300005366 Bacteria 2238
21 Ga0070659_100287579 3300005366 Bacteria 1368
22 Ga0070662_100523777 3300005457 Bacteria 991
23 Ga0068867_100278563 3300005459 Bacteria 1371
24 Ga0070679_100996394 3300005530 Bacteria 782
25 Ga0068855_100008978 3300005563 Bacteria 12080
26 Ga0068855_101361511 3300005563 Bacteria 733
27 Ga0068855_101566253 3300005563 Bacteria 675
28 Ga0070664_100050428 3300005564 Bacteria 3522
29 Ga0070664_100080570 3300005564 Bacteria 2805
30 Ga0070664_101137959 3300005564 Bacteria 736
31 Ga0068857_102392592 3300005577 Bacteria 519
32 Ga0068852_100829808 3300005616 Bacteria 939
33 Ga0068852_100912540 3300005616 Bacteria 896
34 Ga0068871_100729175 3300006358 Bacteria 910
35 Ga0068865_101120640 3300006881 Bacteria 694
36 Ga0075435_100115820 3300007076 Bacteria 2232
37 Ga0105243_10270708 3300009148 Bacteria 1525
38 Ga0105241_10054533 3300009174 Bacteria 3060
39 Ga0105241_10173046 3300009174 Unclassified 1785
40 Ga0105242_10047019 3300009176 Bacteria 3503
41 Ga0105242_10440915 3300009176 Bacteria 1225
42 Ga0105237_10389123 3300009545 Bacteria 1399
43 Ga0105238_10267036 3300009551 Bacteria 1691
44 Ga0105246_10497424 3300011119 Bacteria 1035
45 Ga0157371_11343638 3300013102 Bacteria 554
46 Ga0157370_10932224 3300013104 Bacteria 787
47 Ga0157378_11117040 3300013297 Bacteria 826
48 Ga0157372_10195232 3300013307 Bacteria 2345
49 Ga0157372_10479569 3300013307 Bacteria 1450
50 Ga0182008_10236920 3300014497 Bacteria 938
51 Ga0157376_10003268 3300014969 Bacteria 11150
52 Ga0197907_10418301 3300020069 Bacteria 627
53 Ga0206356_10658368 3300020070 Bacteria 639
54 Ga0206355_1275605 3300020076 Bacteria 661
55 Ga0224712_10226492 3300022467 Bacteria 857
56 Ga0209563_100003 3300025230 Bacteria 1932942
57 Ga0209677_105270 3300025253 Bacteria 3424
58 Ga0209148_1000713 3300025254 Bacteria 26678
59 Ga0207655_1015019 3300025728 Bacteria 4335
60 Ga0207713_1033834 3300025735 Bacteria 2227
61 Ga0207705_10014172 3300025909 Bacteria 5742
62 Ga0207705_10115884 3300025909 Bacteria 1983
63 Ga0207705_10145072 3300025909 Bacteria 1775
64 Ga0207705_10235657 3300025909 Bacteria 1393
65 Ga0207705_10552931 3300025909 Bacteria 895
66 Ga0207705_10952923 3300025909 Bacteria 664
67 Ga0207705_11312677 3300025909 Bacteria 552
68 Ga0207654_10005952 3300025911 Bacteria 6138
69 Ga0207654_10102917 3300025911 Unclassified 1762
70 Ga0207660_10385114 3300025917 Bacteria 1128
71 Ga0207657_10004848 3300025919 Bacteria 14164
72 Ga0207657_10028807 3300025919 Bacteria 5060
73 Ga0207657_10147715 3300025919 Bacteria 1916
74 Ga0207657_10261776 3300025919 Bacteria 1376
75 Ga0207649_10033940 3300025920 Bacteria 3052
76 Ga0207650_10047828 3300025925 Bacteria 3153
77 Ga0207659_10755760 3300025926 Bacteria 834
78 Ga0207687_10165274 3300025927 Unclassified 1702
79 Ga0207687_10575446 3300025927 Bacteria 947
80 Ga0207644_10283684 3300025931 Unclassified 1330
81 Ga0207690_10034437 3300025932 Bacteria 3264
82 Ga0207706_10103043 3300025933 Bacteria 2511
83 Ga0207706_11287250 3300025933 Bacteria 604
84 Ga0207686_10033141 3300025934 Bacteria 3081
85 Ga0207709_10403687 3300025935 Bacteria 1045
86 Ga0207669_10271827 3300025937 Bacteria 1273
87 Ga0207704_10301014 3300025938 Bacteria 1228
88 Ga0207689_10222530 3300025942 Bacteria 1559
89 Ga0207661_10490842 3300025944 Bacteria 1122
90 Ga0207679_10103633 3300025945 Bacteria 2230
91 Ga0207679_10135634 3300025945 Bacteria 1981
92 Ga0207679_10270079 3300025945 Bacteria 1454
93 Ga0207667_10002368 3300025949 Bacteria 23607
94 Ga0207668_10273027 3300025972 Bacteria 1383
95 Ga0207640_11392546 3300025981 Bacteria 628
96 Ga0207639_10369898 3300026041 Bacteria 1285
97 Ga0207639_10846133 3300026041 Bacteria 854
98 Ga0207678_11217793 3300026067 Bacteria 667
99 Ga0207648_10154351 3300026089 Bacteria 2026
100 Ga0207674_10234007 3300026116 Bacteria 1785
101 Ga0207698_10503243 3300026142 Bacteria 1179
102 Ga0207698_11093343 3300026142 Bacteria 810
103 Ga0209371_1013584 3300027312 Bacteria 2276
104 Ga0268256_1012572 3300030500 Bacteria 2611
105 Ga0316182_1122691 3300030745 Bacteria 631
106 Ga0307408_102490404 3300031548 Bacteria 503
107 Ga0307413_10543940 3300031824 Bacteria 941
108 Ga0307412_10161622 3300031911 Bacteria 1665
109 Ga0307412_11282952 3300031911 Bacteria 659
110 Ga0307409_100654706 3300031995 Bacteria 1045
111 Ga0307416_100557634 3300032002 Bacteria 1220
112 Ga0307416_101198511 3300032002 Bacteria 865
113 Ga0307414_10045226 3300032004 Bacteria 3013
114 Ga0395899_0000012 3300037312 Bacteria 517561
115 Ga0395899_0001058 3300037312 Bacteria 24879
116 Ga0395899_0008719 3300037312 Bacteria 7807
117 Ga0395899_0010046 3300037312 Bacteria 7255
118 Ga0395899_0022872 3300037312 Bacteria 4736
119 Ga0395899_0185640 3300037312 Bacteria 1457
120 Ga0395899_0200600 3300037312 Bacteria 1391
121 Ga0395899_0463723 3300037312 Bacteria 827
122 Ga0395900_0000164 3300037418 Bacteria 108590
123 Ga0395900_0000177 3300037418 Bacteria 102548
124 Ga0395900_0013689 3300037418 Bacteria 8281
125 Ga0395900_0021594 3300037418 Bacteria 6581
126 Ga0395900_0084660 3300037418 Bacteria 3258
127 Ga0395900_0117506 3300037418 Bacteria 2728
128 Ga0395900_0154597 3300037418 Bacteria 2343
129 Ga0395900_0374279 3300037418 Bacteria 1393
130 Ga0395900_0439428 3300037418 Bacteria 1262
131 Ga0395900_0553614 3300037418 Bacteria 1094
132 Ga0395900_0751315 3300037418 Bacteria 905
133 Ga0395900_0973416 3300037418 Bacteria 769
134 Ga0395898_0001793 3300037466 Bacteria 27870
135 Ga0395898_0065111 3300037466 Bacteria 3534
136 Ga0395898_0095992 3300037466 Bacteria 2848
137 Ga0395898_0160446 3300037466 Bacteria 2150
138 Ga0395898_0865734 3300037466 Bacteria 842
139 Ga0395898_1558917 3300037466 Bacteria 585
140 Ga0395898_1879056 3300037466 Bacteria 519
141 Ga0395905_0000043 3300037471 Bacteria 247469
142 Ga0395905_0005011 3300037471 Bacteria 13641
143 Ga0395905_0027412 3300037471 Bacteria 5372
144 Ga0395905_0045711 3300037471 Bacteria 4106
145 Ga0395905_0111756 3300037471 Bacteria 2565
146 Ga0395905_0130201 3300037471 Bacteria 2366
147 Ga0395905_0378360 3300037471 Bacteria 1309
148 Ga0395905_1407013 3300037471 Bacteria 601
149 Ga0395905_1566246 3300037471 Bacteria 564
150 Ga0395901_0000226 3300038443 Bacteria 70810
151 Ga0395901_0000263 3300038443 Bacteria 65735
152 Ga0395901_0135363 3300038443 Bacteria 2590
153 Ga0395901_0160619 3300038443 Bacteria 2360
154 Ga0395901_0200776 3300038443 Bacteria 2090
155 Ga0395901_0353686 3300038443 Bacteria 1516
156 Ga0395901_0358118 3300038443 Bacteria 1505
157 Ga0395901_0467934 3300038443 Bacteria 1287
158 Ga0395901_0685911 3300038443 Bacteria 1023
159 Ga0395901_1084737 3300038443 Bacteria 772
160 Ga0395901_1118136 3300038443 Bacteria 757
161 Ga0395901_1847424 3300038443 Bacteria 552
162 Ga0439448_0010443 3300042005 Bacteria 2755
163 Ga0439448_0136598 3300042005 Bacteria 847
164 Ga0439450_001479 3300042008 Bacteria 3455
165 Ga0439450_035143 3300042008 Bacteria 1142
166 Ga0439455_0002348 3300042012 Bacteria 3416
167 Ga0439455_0043743 3300042012 Bacteria 1154
168 Ga0450920_084357 3300042122 Bacteria 652
169 Ga0450895_021713 3300042132 Bacteria 598
170 Ga0450898_073202 3300042134 Bacteria 689
171 Ga0450906_090147 3300042145 Bacteria 556
172 Ga0439458_0003470 3300042157 Bacteria 3681
173 Ga0439458_0015004 3300042157 Bacteria 1751
174 Ga0450918_061758 3300042531 Unclassified 693
175 Ga0466969_0078468 3300044656 Bacteria 1579
176 Ga0466969_0079813 3300044656 Bacteria 1563
177 Ga0466969_0210167 3300044656 Bacteria 886
178 Ga0466969_0474230 3300044656 Bacteria 570
179 Ga0466972_0064212 3300044658 Bacteria 1757
180 Ga0466972_0243385 3300044658 Bacteria 841
181 Ga0466972_0265935 3300044658 Bacteria 801
182 Ga0466965_0008520 3300044683 Bacteria 4742
183 Ga0466965_0015437 3300044683 Bacteria 3629
184 Ga0466965_0099456 3300044683 Bacteria 1486
185 Ga0466965_0869455 3300044683 Bacteria 524
186 Ga0466966_0010211 3300044684 Bacteria 6228
187 Ga0466966_0014914 3300044684 Bacteria 5142
188 Ga0466966_0019251 3300044684 Bacteria 4493
189 Ga0466966_0022601 3300044684 Bacteria 4125
190 Ga0466966_0192244 3300044684 Bacteria 1236
191 Ga0466961_0026543 3300044693 Bacteria 3723
192 Ga0466961_0055432 3300044693 Bacteria 2527
193 Ga0466961_0125816 3300044693 Bacteria 1608
194 Ga0466961_0610707 3300044693 Bacteria 655
195 Ga0466963_0130707 3300044694 Bacteria 1734
196 Ga0466963_0723955 3300044694 Bacteria 702
197 Ga0466964_0000096 3300044706 Bacteria 21121
198 Ga0466964_0000364 3300044706 Bacteria 13656
199 Ga0466964_0115239 3300044706 Bacteria 1204
200 Ga0466971_0334940 3300044719 Bacteria 730
201 Ga0466971_0432194 3300044719 Bacteria 644
202 Ga0466971_0666944 3300044719 Bacteria 521
203 Ga0466968_0000568 3300044735 Bacteria 12567
204 Ga0466968_0046091 3300044735 Bacteria 1852
205 Ga0466968_0113070 3300044735 Bacteria 1222
206 Ga0466970_0082359 3300044765 Bacteria 1740
207 Ga0466970_0096217 3300044765 Bacteria 1610
208 Ga0466970_0119190 3300044765 Bacteria 1445
209 Ga0466970_0407812 3300044765 Bacteria 776
210 Ga0466957_0000103 3300044842 Bacteria 34469
211 Ga0466957_0031865 3300044842 Bacteria 3153
212 Ga0466957_0156559 3300044842 Bacteria 1477
213 Ga0466957_0321524 3300044842 Bacteria 1044
214 Ga0466957_0341454 3300044842 Bacteria 1014
215 Ga0466960_0426146 3300044901 Bacteria 768
216 Ga0466959_0042252 3300045049 Bacteria 3362
217 Ga0466959_0278614 3300045049 Bacteria 1148
218 Ga0466959_0538949 3300045049 Bacteria 787
219 Ga0466958_0007154 3300045836 Bacteria 6118
220 Ga0466958_0012640 3300045836 Bacteria 4786
221 Ga0466958_0160266 3300045836 Bacteria 1421
222 Ga0466967_0010138 3300045976 Bacteria 7047
223 Ga0466967_0145535 3300045976 Bacteria 2210
224 Ga0466967_0319977 3300045976 Bacteria 1496
225 Ga0466967_1035683 3300045976 Bacteria 817
226 Ga0495603_0041696 3300046455 Bacteria 2744
227 Ga0495603_0263733 3300046455 Bacteria 991
228 Ga0495590_0079399 3300046457 Bacteria 1155
229 Ga0495590_0079841 3300046457 Bacteria 1152
230 Ga0495590_0185424 3300046457 Bacteria 762
231 Ga0495629_0105288 3300046459 Bacteria 1967
232 Ga0495629_0272256 3300046459 Bacteria 1163
233 Ga0495638_0001785 3300046460 Bacteria 18780
234 Ga0495638_0267258 3300046460 Bacteria 935
235 Ga0495653_0018973 3300046463 Bacteria 5581
236 Ga0495653_0072332 3300046463 Bacteria 2575
237 Ga0495580_0049246 3300046472 Bacteria 2981
238 Ga0495580_0132554 3300046472 Bacteria 1728
239 Ga0495580_0361006 3300046472 Bacteria 983
240 Ga0495582_0115423 3300046473 Bacteria 1510
241 Ga0495605_0000015 3300046474 Bacteria 300227
242 Ga0495605_0000227 3300046474 Bacteria 69646
243 Ga0495605_0027572 3300046474 Bacteria 2942
244 Ga0495605_0143510 3300046474 Bacteria 1069
245 Ga0495664_0232449 3300046477 Bacteria 1116
246 Ga0495584_0000002 3300046491 Bacteria 512179
247 Ga0495584_0000343 3300046491 Bacteria 32238
248 Ga0495584_0001416 3300046491 Bacteria 14450
249 Ga0495584_0002846 3300046491 Bacteria 9661
250 Ga0495584_0262164 3300046491 Bacteria 878
251 Ga0495584_0361385 3300046491 Bacteria 737
252 Ga0495584_0566358 3300046491 Bacteria 579
253 Ga0495585_0000003 3300046492 Bacteria 406344
254 Ga0495585_0000039 3300046492 Bacteria 131202
255 Ga0495585_0000364 3300046492 Bacteria 43911
256 Ga0495585_0012529 3300046492 Bacteria 4994
257 Ga0495585_0021203 3300046492 Bacteria 3732
258 Ga0495585_0065934 3300046492 Bacteria 1983
259 Ga0495585_0099732 3300046492 Bacteria 1554
260 Ga0495585_0441470 3300046492 Bacteria 623
261 Ga0495594_0004487 3300046499 Bacteria 7176
262 Ga0495594_0015748 3300046499 Bacteria 3976
263 Ga0495594_0112810 3300046499 Bacteria 1533
264 Ga0495594_0141744 3300046499 Bacteria 1363
265 Ga0495594_0455081 3300046499 Bacteria 727
266 Ga0495596_0000044 3300046500 Bacteria 90299
267 Ga0495596_0000890 3300046500 Bacteria 18003
268 Ga0495596_0015449 3300046500 Bacteria 3196
269 Ga0495596_0021762 3300046500 Bacteria 2614
270 Ga0495596_0028271 3300046500 Bacteria 2252
271 Ga0495596_0039289 3300046500 Bacteria 1869
272 Ga0495607_0000878 3300046501 Bacteria 28026
273 Ga0495607_0032012 3300046501 Bacteria 3215
274 Ga0495607_0100633 3300046501 Bacteria 1548
275 Ga0495607_0114572 3300046501 Bacteria 1424
276 Ga0495607_0170632 3300046501 Bacteria 1099
277 Ga0495607_0322044 3300046501 Bacteria 721
278 Ga0495583_0000617 3300046506 Bacteria 47939
279 Ga0495583_0000782 3300046506 Bacteria 39742
280 Ga0495583_0016962 3300046506 Bacteria 3887
281 Ga0495583_0030048 3300046506 Bacteria 2652
282 Ga0495583_0037504 3300046506 Bacteria 2297
283 Ga0495583_0072210 3300046506 Bacteria 1514
284 Ga0495606_0008518 3300046507 Bacteria 8893
285 Ga0495606_0014664 3300046507 Bacteria 6096
286 Ga0495606_0016313 3300046507 Bacteria 5670
287 Ga0495606_0035528 3300046507 Bacteria 3405
288 Ga0495606_0047879 3300046507 Bacteria 2816
289 Ga0495616_0000228 3300046513 Bacteria 46105
290 Ga0495616_0004421 3300046513 Bacteria 8862
291 Ga0495616_0009854 3300046513 Bacteria 5560
292 Ga0495616_0126993 3300046513 Bacteria 1172
293 Ga0495616_0267076 3300046513 Bacteria 730
294 Ga0495616_0342893 3300046513 Bacteria 623
295 Ga0495620_0002886 3300046515 Bacteria 9879
296 Ga0495630_0057374 3300046517 Bacteria 2918
297 Ga0495630_0129380 3300046517 Bacteria 1917
298 Ga0495631_0005926 3300046518 Bacteria 6360
299 Ga0495631_0008141 3300046518 Bacteria 5292
300 Ga0495631_0065040 3300046518 Bacteria 1578
301 Ga0495631_0141483 3300046518 Bacteria 1033
302 Ga0495632_0003285 3300046519 Bacteria 11551
303 Ga0495632_0009210 3300046519 Bacteria 5968
304 Ga0495637_0214066 3300046520 Bacteria 703
305 Ga0495643_0000521 3300046522 Bacteria 47921
306 Ga0495643_0014225 3300046522 Bacteria 4738
307 Ga0495643_0016872 3300046522 Bacteria 4282
308 Ga0495643_0029642 3300046522 Bacteria 3060
309 Ga0495643_0058797 3300046522 Bacteria 2044
310 Ga0495643_0068766 3300046522 Bacteria 1863
311 Ga0495643_0220422 3300046522 Bacteria 900
312 Ga0495644_0008523 3300046523 Bacteria 3949
313 Ga0495644_0010987 3300046523 Bacteria 3490
314 Ga0495644_0097503 3300046523 Bacteria 1111
315 Ga0495644_0196926 3300046523 Bacteria 776
316 Ga0495648_0000171 3300046524 Bacteria 74494
317 Ga0495648_0012407 3300046524 Bacteria 6362
318 Ga0495648_0028818 3300046524 Bacteria 3694
319 Ga0495648_0032446 3300046524 Bacteria 3426
320 Ga0495663_0008820 3300046525 Bacteria 2797
321 Ga0495666_0063574 3300046526 Bacteria 1761
322 Ga0495666_0227808 3300046526 Bacteria 852
323 Ga0495666_0292594 3300046526 Bacteria 737
324 Ga0495642_0005891 3300046528 Bacteria 4699
325 Ga0495642_0014331 3300046528 Bacteria 3071
326 Ga0495642_0022678 3300046528 Bacteria 2474
327 Ga0495642_0058136 3300046528 Bacteria 1600
328 Ga0495642_0132005 3300046528 Bacteria 1075
329 Ga0495642_0184126 3300046528 Bacteria 909
330 Ga0495642_0201580 3300046528 Bacteria 867
331 Ga0495642_0388046 3300046528 Bacteria 615
332 Ga0495642_0518004 3300046528 Bacteria 528
333 Ga0495665_0000965 3300046531 Bacteria 15222
334 Ga0495665_0038430 3300046531 Bacteria 2551
335 Ga0495665_0041326 3300046531 Bacteria 2454
336 Ga0495665_0068810 3300046531 Bacteria 1866
337 Ga0495586_0055848 3300046535 Bacteria 2140
338 Ga0495586_0093751 3300046535 Bacteria 1660
339 Ga0495586_0112843 3300046535 Bacteria 1513
340 Ga0495587_0016850 3300046536 Bacteria 4544
341 Ga0495587_0596740 3300046536 Bacteria 608
342 Ga0495609_0000001 3300046538 Bacteria 1060094
343 Ga0495609_0011277 3300046538 Bacteria 4262
344 Ga0495609_0117144 3300046538 Bacteria 1147
345 Ga0495609_0146209 3300046538 Bacteria 1007
346 Ga0495609_0240017 3300046538 Bacteria 748
347 Ga0495597_0000579 3300046542 Bacteria 30352
348 Ga0495597_0017466 3300046542 Bacteria 3375
349 Ga0495597_0051516 3300046542 Bacteria 1814
350 Ga0495597_0107912 3300046542 Bacteria 1169
351 Ga0495597_0110300 3300046542 Bacteria 1154
352 Ga0495597_0122448 3300046542 Bacteria 1083
353 Ga0495597_0130976 3300046542 Bacteria 1040
354 Ga0495597_0170700 3300046542 Bacteria 883
355 Ga0495597_0190238 3300046542 Bacteria 826
356 Ga0495645_0138922 3300046543 Bacteria 1697
357 Ga0495645_0713838 3300046543 Bacteria 608
358 Ga0495622_0005665 3300046557 Bacteria 5790
359 Ga0495622_0020741 3300046557 Bacteria 3059
360 Ga0495622_0065160 3300046557 Bacteria 1684
361 Ga0495622_0066384 3300046557 Bacteria 1668
362 Ga0495622_0262093 3300046557 Bacteria 758
363 Ga0495633_0006601 3300046558 Bacteria 6849
364 Ga0495633_0013183 3300046558 Bacteria 4366
365 Ga0495633_0013203 3300046558 Bacteria 4362
366 Ga0495633_0017846 3300046558 Bacteria 3615
367 Ga0495633_0023558 3300046558 Bacteria 3049
368 Ga0495633_0164657 3300046558 Bacteria 1022
369 Ga0495633_0172891 3300046558 Bacteria 995
370 Ga0495633_0320760 3300046558 Bacteria 703
371 Ga0495633_0376566 3300046558 Bacteria 642
372 Ga0495667_0227908 3300046559 Bacteria 1188
373 Ga0495656_0001262 3300046615 Bacteria 8216
374 Ga0495656_0043701 3300046615 Bacteria 1883
375 Ga0495656_0070336 3300046615 Bacteria 1552
376 Ga0495656_0606642 3300046615 Bacteria 586
377 Ga0495668_0000706 3300046616 Bacteria 40250
378 Ga0495668_0014156 3300046616 Bacteria 4687
379 Ga0495668_0070507 3300046616 Bacteria 1921
380 Ga0495668_0102275 3300046616 Bacteria 1567
381 Ga0495611_0002466 3300046648 Bacteria 8450
382 Ga0495611_0007312 3300046648 Bacteria 4691
383 Ga0495611_0009370 3300046648 Bacteria 4138
384 Ga0495611_0013495 3300046648 Bacteria 3479
385 Ga0495611_0550686 3300046648 Bacteria 522
386 Ga0495625_0019424 3300046660 Bacteria 5270
387 Ga0495625_0283479 3300046660 Bacteria 1065
388 Ga0495625_0363442 3300046660 Bacteria 912
389 Ga0495625_0838800 3300046660 Bacteria 531
390 Ga0495635_0846935 3300046663 Bacteria 587
391 Ga0495659_0074334 3300046664 Bacteria 1278
392 Ga0495661_0000260 3300046665 Bacteria 60822
393 Ga0495661_0010185 3300046665 Bacteria 6425
394 Ga0495661_0018384 3300046665 Bacteria 4599
395 Ga0495661_0034244 3300046665 Bacteria 3196
396 Ga0495661_0042044 3300046665 Bacteria 2821
397 Ga0495661_0096161 3300046665 Bacteria 1675
398 Ga0495661_0116672 3300046665 Bacteria 1480
399 Ga0495661_0126234 3300046665 Bacteria 1407
400 Ga0495661_0135525 3300046665 Bacteria 1344
401 Ga0495661_0434923 3300046665 Bacteria 633
402 Ga0495661_0578712 3300046665 Bacteria 529
403 Ga0495588_0000095 3300046674 Bacteria 175627
404 Ga0495588_0033525 3300046674 Bacteria 2594
405 Ga0495588_0086197 3300046674 Bacteria 1642
406 Ga0495588_0232971 3300046674 Bacteria 971
407 Ga0495588_0312657 3300046674 Unclassified 826
408 Ga0495588_0558964 3300046674 Bacteria 599
409 Ga0495623_0061783 3300046679 Bacteria 2348
410 Ga0495623_0106388 3300046679 Bacteria 1704
411 Ga0495623_0134235 3300046679 Bacteria 1478
412 Ga0495623_0141390 3300046679 Bacteria 1431
413 Ga0495669_0000029 3300046684 Bacteria 105945
414 Ga0495669_0018343 3300046684 Bacteria 3008
415 Ga0495669_0038088 3300046684 Bacteria 2129
416 Ga0495669_0304849 3300046684 Bacteria 768
417 Ga0495669_0366551 3300046684 Bacteria 697
418 Ga0495613_0171990 3300046689 Bacteria 1537
419 Ga0495624_0023543 3300046690 Bacteria 4061
420 Ga0495670_0002448 3300046691 Bacteria 9172
421 Ga0495670_0059219 3300046691 Bacteria 1923
422 Ga0495670_0074076 3300046691 Bacteria 1726
423 Ga0495670_0221324 3300046691 Bacteria 1005
424 Ga0495670_0412265 3300046691 Bacteria 730
425 Ga0495670_0477694 3300046691 Bacteria 676
426 Ga0495670_0599671 3300046691 Bacteria 600
427 Ga0495670_0646570 3300046691 Bacteria 576
428 Ga0495670_0824340 3300046691 Bacteria 506
429 Ga0495671_0375395 3300046692 Bacteria 681
430 Ga0495649_0052059 3300046694 Bacteria 2219
431 Ga0495649_0065481 3300046694 Bacteria 1950
432 Ga0495589_0000029 3300046794 Bacteria 173640
433 Ga0495589_0000412 3300046794 Bacteria 32186
434 Ga0495589_0004833 3300046794 Bacteria 7155
435 Ga0495589_0087766 3300046794 Bacteria 1510
436 Ga0495589_0129284 3300046794 Bacteria 1213
437 Ga0495589_0529402 3300046794 Bacteria 537
438 Ga0495600_0005879 3300046809 Bacteria 7421
439 Ga0495600_0526948 3300046809 Bacteria 724
440 Ga0495660_0000033 3300046810 Bacteria 212425
441 Ga0495660_0077124 3300046810 Bacteria 1754
442 Ga0495660_0253925 3300046810 Bacteria 814
443 Ga0495660_0348033 3300046810 Bacteria 659
444 Ga0495660_0440824 3300046810 Bacteria 564
445 Ga0495581_0002799 3300047315 Bacteria 9953
446 Ga0495581_0043672 3300047315 Bacteria 2592
447 Ga0495581_0229664 3300047315 Bacteria 1085
448 Ga0495581_0360974 3300047315 Bacteria 848
449 Ga0495604_0009216 3300047317 Bacteria 7814
450 Ga0495604_0766203 3300047317 Bacteria 609
451 Ga0495636_0006597 3300047318 Bacteria 4563
452 Ga0495636_0015661 3300047318 Bacteria 3022
453 Ga0495636_0155154 3300047318 Bacteria 1029
454 Ga0495636_0219201 3300047318 Bacteria 873
455 Ga0495674_0021167 3300047319 Bacteria 6015
456 Ga0495672_0016778 3300047320 Bacteria 4916
457 Ga0495672_0359404 3300047320 Bacteria 674
458 Ga0495672_0443559 3300047320 Bacteria 586
459 Ga0495672_0473272 3300047320 Bacteria 561
460 Ga0495676_0026427 3300047321 Bacteria 4997
461 Ga0495676_0097705 3300047321 Bacteria 2181
462 Ga0495676_0500717 3300047321 Bacteria 797
463 Ga0495683_0000007 3300047323 Bacteria 268546
464 Ga0495683_0005914 3300047323 Bacteria 6722
465 Ga0495683_0039587 3300047323 Bacteria 2382
466 Ga0495683_0130428 3300047323 Bacteria 1186
467 Ga0495683_0320227 3300047323 Bacteria 661
468 Ga0495687_000003 3300047443 Bacteria 859509
469 Ga0495687_000950 3300047443 Bacteria 29856
470 Ga0495687_000963 3300047443 Bacteria 29355
471 Ga0495687_074642 3300047443 Bacteria 1348
472 Ga0495675_0006330 3300047444 Bacteria 7248
473 Ga0495675_0049033 3300047444 Bacteria 2685
474 Ga0495675_0168793 3300047444 Bacteria 1344
475 Ga0495677_0000001 3300047445 Bacteria 715000
476 Ga0495677_0000214 3300047445 Bacteria 26463
477 Ga0495677_0002944 3300047445 Bacteria 6622
478 Ga0495677_0004794 3300047445 Bacteria 5156
479 Ga0495677_0059972 3300047445 Bacteria 1410
480 Ga0495677_0070520 3300047445 Bacteria 1302
481 Ga0495677_0216060 3300047445 Bacteria 746
482 Ga0495679_011283 3300047446 Bacteria 3458
483 Ga0495679_073925 3300047446 Bacteria 977
484 Ga0495685_097011 3300047447 Bacteria 974
485 Ga0495685_172927 3300047447 Bacteria 697
486 Ga0495685_293032 3300047447 Bacteria 512
487 Ga0495685_297480 3300047447 Bacteria 507
488 Ga0495681_0007714 3300047470 Bacteria 6824
489 Ga0495681_0025159 3300047470 Bacteria 3119
490 Ga0495681_0172803 3300047470 Bacteria 893
491 Ga0495681_0346696 3300047470 Bacteria 565
492 Ga0495681_0392731 3300047470 Bacteria 520
493 Ga0495686_0000015 3300047472 Bacteria 471703
494 Ga0495593_0007764 3300047673 Bacteria 6252
495 Ga0495593_0016031 3300047673 Bacteria 4230
496 Ga0495593_0295167 3300047673 Bacteria 810
497 Ga0495602_0011432 3300048088 Bacteria 9181
498 Ga0495614_0038149 3300048089 Bacteria 2062
499 Ga0495614_0296675 3300048089 Bacteria 746
500 Ga0495615_0000435 3300048090 Bacteria 6142
501 Ga0495615_0323496 3300048090 Bacteria 504
502 Ga0495626_0000160 3300048091 Bacteria 83120
503 Ga0495626_0001725 3300048091 Bacteria 16725
504 Ga0495626_0004329 3300048091 Bacteria 8751
505 Ga0495626_0004800 3300048091 Bacteria 8156
506 Ga0495626_0009079 3300048091 Bacteria 5393
507 Ga0495626_0010260 3300048091 Bacteria 5013
508 Ga0495626_0016989 3300048091 Bacteria 3683
509 Ga0495626_0035338 3300048091 Bacteria 2385
510 Ga0495626_0059075 3300048091 Bacteria 1750
511 Ga0495626_0119849 3300048091 Bacteria 1132
512 Ga0495626_0125231 3300048091 Bacteria 1101
513 Ga0495626_0128147 3300048091 Bacteria 1086
514 Ga0495626_0137195 3300048091 Bacteria 1039
515 Ga0496100_0098293 3300048903 Bacteria 2012
516 Ga0496101_0039471 3300048904 Bacteria 3358
517 Ga0496102_0006653 3300048905 Bacteria 9878
518 Ga0496102_0036902 3300048905 Bacteria 4406
519 Ga0496102_0073377 3300048905 Bacteria 3145
520 Ga0496102_0543241 3300048905 Bacteria 1085
521 Ga0496103_0006143 3300048906 Bacteria 7177
522 Ga0496103_0216357 3300048906 Bacteria 1232
523 Ga0496105_0370131 3300048908 Bacteria 1142
524 Ga0496107_0197707 3300048910 Bacteria 1494
525 Ga0496108_0496472 3300048911 Bacteria 1066
526 Ga0496109_0193607 3300048912 Bacteria 1911
527 Ga0496110_0204948 3300048913 Bacteria 1792
528 Ga0496110_0386363 3300048913 Bacteria 1276
529 Ga0496110_1060891 3300048913 Bacteria 718
530 Ga0496110_1062576 3300048913 Bacteria 717
531 Ga0496110_1371414 3300048913 Bacteria 616
532 Ga0496112_0131685 3300048915 Bacteria 2472
533 Ga0496113_0007993 3300048916 Bacteria 6854
534 Ga0496113_0147600 3300048916 Bacteria 1854
535 Ga0496114_0105928 3300048917 Bacteria 2405
536 Ga0496115_0070880 3300048918 Bacteria 2826
537 Ga0496115_0156343 3300048918 Bacteria 1884
538 Ga0496115_0207283 3300048918 Bacteria 1619
539 Ga0496121_0361086 3300048924 Bacteria 964
540 Ga0496122_0003642 3300048925 Bacteria 20025
541 Ga0496122_0128925 3300048925 Bacteria 1612
542 Ga0496122_0327511 3300048925 Bacteria 811
543 Ga0496123_0002957 3300048926 Bacteria 19806
544 Ga0496123_0342784 3300048926 Bacteria 698
545 Ga0496124_0003878 3300048927 Bacteria 17884
546 Ga0496124_0018343 3300048927 Bacteria 6554
547 Ga0496124_0040776 3300048927 Bacteria 4013
548 Ga0496124_0108484 3300048927 Bacteria 2239
549 Ga0496124_0131184 3300048927 Bacteria 1991
550 Ga0496124_0165608 3300048927 Bacteria 1718
551 Ga0496124_0205220 3300048927 Bacteria 1495
552 Ga0496125_0051321 3300048928 Bacteria 3403
553 Ga0496125_0304565 3300048928 Bacteria 974
554 Ga0496126_0509884 3300048929 Bacteria 960
555 Ga0501308_055996 3300049128 Bacteria 586
556 Ga0495682_0003938 3300049460 Bacteria 6479
557 Ga0495682_0025866 3300049460 Bacteria 2182
558 Ga0495682_0234048 3300049460 Bacteria 650
559 Ga0501315_100411 3300049531 Bacteria 511
560 Ga0501036_0817499 3300049572 Bacteria 767
561 Ga0501038_0042837 3300049574 Bacteria 3941
562 Ga0501043_0058766 3300049579 Bacteria 3018
563 Ga0501046_0222907 3300049580 Bacteria 1395
564 Ga0501047_0118751 3300049581 Bacteria 2526
565 Ga0501047_0933182 3300049581 Bacteria 681
566 Ga0501067_0549529 3300049583 Bacteria 647
567 Ga0501073_0106024 3300049589 Bacteria 1950
568 Ga0501080_0399579 3300049742 Bacteria 1236
569 Ga0501035_0001065 3300049822 Bacteria 28753
570 Ga0501035_0057748 3300049822 Bacteria 3459
571 Ga0501044_0087456 3300049823 Bacteria 3148
572 Ga0501044_0339094 3300049823 Bacteria 1424
573 nmdc:mga0rr50_346423_c1 3300050513 Bacteria 1249
574 nmdc:mga0a205_380762_c1 3300050515 Unclassified 1276
575 Ga0500556_0001839 3300053104 Bacteria 7728
576 Ga0501082_0468495 3300060353 Bacteria 1101
577 Ga0466962_0315548 3300061719 Bacteria 775
578 2673165395 2671180531 Bacteria 9045424
579 2881103049 2881101125 Bacteria 4590519
580 Ga0501034_0523462
581 MBSR1b_contig_212366
582 rootL2_10083997
583 Ga0055525_1000008
584 Ga0065715_10113342
585 Ga0070658_10030293
586 Ga0070658_10131301
587 Ga0070658_11324158
588 Ga0068869_100326347
589 Ga0068869_101083320
590 Ga0070660_100005417
591 Ga0070660_100031938
592 Ga0070660_100119349
593 Ga0070660_100629975
594 Ga0070661_100050323
595 Ga0070661_101199127
596 Ga0070671_100361638
597 Ga0070674_100412387
598 Ga0070659_100062517
599 Ga0070659_100108610
600 Ga0070659_100287579
601 Ga0070662_100523777
602 Ga0068867_100278563
603 Ga0070679_100996394
604 Ga0068855_100008978
605 Ga0068855_101361511
606 Ga0068855_101566253
607 Ga0070664_100050428
608 Ga0070664_100080570
609 Ga0070664_101137959
610 Ga0068857_102392592
611 Ga0068852_100829808
612 Ga0068852_100912540
613 Ga0068871_100729175
614 Ga0068865_101120640
615 Ga0075435_100115820
616 Ga0105243_10270708
617 Ga0105241_10054533
618 Ga0105241_10173046
619 Ga0105242_10047019
620 Ga0105242_10440915
621 Ga0105237_10389123
622 Ga0105238_10267036
623 Ga0105246_10497424
624 Ga0157371_11343638
625 Ga0157370_10932224
626 Ga0157378_11117040
627 Ga0157372_10195232
628 Ga0157372_10479569
629 Ga0182008_10236920
630 Ga0157376_10003268
631 Ga0197907_10418301
632 Ga0206356_10658368
633 Ga0206355_1275605
634 Ga0224712_10226492
635 Ga0209563_100003
636 Ga0209677_105270
637 Ga0209148_1000713
638 Ga0207655_1015019
639 Ga0207713_1033834
640 Ga0207705_10014172
641 Ga0207705_10115884
642 Ga0207705_10145072
643 Ga0207705_10235657
644 Ga0207705_10552931
645 Ga0207705_10952923
646 Ga0207705_11312677
647 Ga0207654_10005952
648 Ga0207654_10102917
649 Ga0207660_10385114
650 Ga0207657_10004848
651 Ga0207657_10028807
652 Ga0207657_10147715
653 Ga0207657_10261776
654 Ga0207649_10033940
655 Ga0207650_10047828
656 Ga0207659_10755760
657 Ga0207687_10165274
658 Ga0207687_10575446
659 Ga0207644_10283684
660 Ga0207690_10034437
661 Ga0207706_10103043
662 Ga0207706_11287250
663 Ga0207686_10033141
664 Ga0207709_10403687
665 Ga0207669_10271827
666 Ga0207704_10301014
667 Ga0207689_10222530
668 Ga0207661_10490842
669 Ga0207679_10103633
670 Ga0207679_10135634
671 Ga0207679_10270079
672 Ga0207667_10002368
673 Ga0207668_10273027
674 Ga0207640_11392546
675 Ga0207639_10369898
676 Ga0207639_10846133
677 Ga0207678_11217793
678 Ga0207648_10154351
679 Ga0207674_10234007
680 Ga0207698_10503243
681 Ga0207698_11093343
682 Ga0209371_1013584
683 Ga0268256_1012572
684 Ga0316182_1122691
685 Ga0307408_102490404
686 Ga0307413_10543940
687 Ga0307412_10161622
688 Ga0307412_11282952
689 Ga0307409_100654706
690 Ga0307416_100557634
691 Ga0307416_101198511
692 Ga0307414_10045226
693 Ga0395899_0000012
694 Ga0395899_0001058
695 Ga0395899_0008719
696 Ga0395899_0010046
697 Ga0395899_0022872
698 Ga0395899_0185640
699 Ga0395899_0200600
700 Ga0395899_0463723
701 Ga0395900_0000164
702 Ga0395900_0000177
703 Ga0395900_0013689
704 Ga0395900_0021594
705 Ga0395900_0084660
706 Ga0395900_0117506
707 Ga0395900_0154597
708 Ga0395900_0374279
709 Ga0395900_0439428
710 Ga0395900_0553614
711 Ga0395900_0751315
712 Ga0395900_0973416
713 Ga0395898_0001793
714 Ga0395898_0065111
715 Ga0395898_0095992
716 Ga0395898_0160446
717 Ga0395898_0865734
718 Ga0395898_1558917
719 Ga0395898_1879056
720 Ga0395905_0000043
721 Ga0395905_0005011
722 Ga0395905_0027412
723 Ga0395905_0045711
724 Ga0395905_0111756
725 Ga0395905_0130201
726 Ga0395905_0378360
727 Ga0395905_1407013
728 Ga0395905_1566246
729 Ga0395901_0000226
730 Ga0395901_0000263
731 Ga0395901_0135363
732 Ga0395901_0160619
733 Ga0395901_0200776
734 Ga0395901_0353686
735 Ga0395901_0358118
736 Ga0395901_0467934
737 Ga0395901_0685911
738 Ga0395901_1084737
739 Ga0395901_1118136
740 Ga0395901_1847424
741 Ga0439448_0010443
742 Ga0439448_0136598
743 Ga0439450_001479
744 Ga0439450_035143
745 Ga0439455_0002348
746 Ga0439455_0043743
747 Ga0450920_084357
748 Ga0450895_021713
749 Ga0450898_073202
750 Ga0450906_090147
751 Ga0439458_0003470
752 Ga0439458_0015004
753 Ga0450918_061758
754 Ga0466969_0078468
755 Ga0466969_0079813
756 Ga0466969_0210167
757 Ga0466969_0474230
758 Ga0466972_0064212
759 Ga0466972_0243385
760 Ga0466972_0265935
761 Ga0466965_0008520
762 Ga0466965_0015437
763 Ga0466965_0099456
764 Ga0466965_0869455
765 Ga0466966_0010211
766 Ga0466966_0014914
767 Ga0466966_0019251
768 Ga0466966_0022601
769 Ga0466966_0192244
770 Ga0466961_0026543
771 Ga0466961_0055432
772 Ga0466961_0125816
773 Ga0466961_0610707
774 Ga0466963_0130707
775 Ga0466963_0723955
776 Ga0466964_0000096
777 Ga0466964_0000364
778 Ga0466964_0115239
779 Ga0466971_0334940
780 Ga0466971_0432194
781 Ga0466971_0666944
782 Ga0466968_0000568
783 Ga0466968_0046091
784 Ga0466968_0113070
785 Ga0466970_0082359
786 Ga0466970_0096217
787 Ga0466970_0119190
788 Ga0466970_0407812
789 Ga0466957_0000103
790 Ga0466957_0031865
791 Ga0466957_0156559
792 Ga0466957_0321524
793 Ga0466957_0341454
794 Ga0466960_0426146
795 Ga0466959_0042252
796 Ga0466959_0278614
797 Ga0466959_0538949
798 Ga0466958_0007154
799 Ga0466958_0012640
800 Ga0466958_0160266
801 Ga0466967_0010138
802 Ga0466967_0145535
803 Ga0466967_0319977
804 Ga0466967_1035683
805 Ga0495603_0041696
806 Ga0495603_0263733
807 Ga0495590_0079399
808 Ga0495590_0079841
809 Ga0495590_0185424
810 Ga0495629_0105288
811 Ga0495629_0272256
812 Ga0495638_0001785
813 Ga0495638_0267258
814 Ga0495653_0018973
815 Ga0495653_0072332
816 Ga0495580_0049246
817 Ga0495580_0132554
818 Ga0495580_0361006
819 Ga0495582_0115423
820 Ga0495605_0000015
821 Ga0495605_0000227
822 Ga0495605_0027572
823 Ga0495605_0143510
824 Ga0495664_0232449
825 Ga0495584_0000002
826 Ga0495584_0000343
827 Ga0495584_0001416
828 Ga0495584_0002846
829 Ga0495584_0262164
830 Ga0495584_0361385
831 Ga0495584_0566358
832 Ga0495585_0000003
833 Ga0495585_0000039
834 Ga0495585_0000364
835 Ga0495585_0012529
836 Ga0495585_0021203
837 Ga0495585_0065934
838 Ga0495585_0099732
839 Ga0495585_0441470
840 Ga0495594_0004487
841 Ga0495594_0015748
842 Ga0495594_0112810
843 Ga0495594_0141744
844 Ga0495594_0455081
845 Ga0495596_0000044
846 Ga0495596_0000890
847 Ga0495596_0015449
848 Ga0495596_0021762
849 Ga0495596_0028271
850 Ga0495596_0039289
851 Ga0495607_0000878
852 Ga0495607_0032012
853 Ga0495607_0100633
854 Ga0495607_0114572
855 Ga0495607_0170632
856 Ga0495607_0322044
857 Ga0495583_0000617
858 Ga0495583_0000782
859 Ga0495583_0016962
860 Ga0495583_0030048
861 Ga0495583_0037504
862 Ga0495583_0072210
863 Ga0495606_0008518
864 Ga0495606_0014664
865 Ga0495606_0016313
866 Ga0495606_0035528
867 Ga0495606_0047879
868 Ga0495616_0000228
869 Ga0495616_0004421
870 Ga0495616_0009854
871 Ga0495616_0126993
872 Ga0495616_0267076
873 Ga0495616_0342893
874 Ga0495620_0002886
875 Ga0495630_0057374
876 Ga0495630_0129380
877 Ga0495631_0005926
878 Ga0495631_0008141
879 Ga0495631_0065040
880 Ga0495631_0141483
881 Ga0495632_0003285
882 Ga0495632_0009210
883 Ga0495637_0214066
884 Ga0495643_0000521
885 Ga0495643_0014225
886 Ga0495643_0016872
887 Ga0495643_0029642
888 Ga0495643_0058797
889 Ga0495643_0068766
890 Ga0495643_0220422
891 Ga0495644_0008523
892 Ga0495644_0010987
893 Ga0495644_0097503
894 Ga0495644_0196926
895 Ga0495648_0000171
896 Ga0495648_0012407
897 Ga0495648_0028818
898 Ga0495648_0032446
899 Ga0495663_0008820
900 Ga0495666_0063574
901 Ga0495666_0227808
902 Ga0495666_0292594
903 Ga0495642_0005891
904 Ga0495642_0014331
905 Ga0495642_0022678
906 Ga0495642_0058136
907 Ga0495642_0132005
908 Ga0495642_0184126
909 Ga0495642_0201580
910 Ga0495642_0388046
911 Ga0495642_0518004
912 Ga0495665_0000965
913 Ga0495665_0038430
914 Ga0495665_0041326
915 Ga0495665_0068810
916 Ga0495586_0055848
917 Ga0495586_0093751
918 Ga0495586_0112843
919 Ga0495587_0016850
920 Ga0495587_0596740
921 Ga0495609_0000001
922 Ga0495609_0011277
923 Ga0495609_0117144
924 Ga0495609_0146209
925 Ga0495609_0240017
926 Ga0495597_0000579
927 Ga0495597_0017466
928 Ga0495597_0051516
929 Ga0495597_0107912
930 Ga0495597_0110300
931 Ga0495597_0122448
932 Ga0495597_0130976
933 Ga0495597_0170700
934 Ga0495597_0190238
935 Ga0495645_0138922
936 Ga0495645_0713838
937 Ga0495622_0005665
938 Ga0495622_0020741
939 Ga0495622_0065160
940 Ga0495622_0066384
941 Ga0495622_0262093
942 Ga0495633_0006601
943 Ga0495633_0013183
944 Ga0495633_0013203
945 Ga0495633_0017846
946 Ga0495633_0023558
947 Ga0495633_0164657
948 Ga0495633_0172891
949 Ga0495633_0320760
950 Ga0495633_0376566
951 Ga0495667_0227908
952 Ga0495656_0001262
953 Ga0495656_0043701
954 Ga0495656_0070336
955 Ga0495656_0606642
956 Ga0495668_0000706
957 Ga0495668_0014156
958 Ga0495668_0070507
959 Ga0495668_0102275
960 Ga0495611_0002466
961 Ga0495611_0007312
962 Ga0495611_0009370
963 Ga0495611_0013495
964 Ga0495611_0550686
965 Ga0495625_0019424
966 Ga0495625_0283479
967 Ga0495625_0363442
968 Ga0495625_0838800
969 Ga0495635_0846935
970 Ga0495659_0074334
971 Ga0495661_0000260
972 Ga0495661_0010185
973 Ga0495661_0018384
974 Ga0495661_0034244
975 Ga0495661_0042044
976 Ga0495661_0096161
977 Ga0495661_0116672
978 Ga0495661_0126234
979 Ga0495661_0135525
980 Ga0495661_0434923
981 Ga0495661_0578712
982 Ga0495588_0000095
983 Ga0495588_0033525
984 Ga0495588_0086197
985 Ga0495588_0232971
986 Ga0495588_0312657
987 Ga0495588_0558964
988 Ga0495623_0061783
989 Ga0495623_0106388
990 Ga0495623_0134235
991 Ga0495623_0141390
992 Ga0495669_0000029
993 Ga0495669_0018343
994 Ga0495669_0038088
995 Ga0495669_0304849
996 Ga0495669_0366551
997 Ga0495613_0171990
998 Ga0495624_0023543
999 Ga0495670_0002448
1000 Ga0495670_0059219
1001 Ga0495670_0074076
1002 Ga0495670_0221324
1003 Ga0495670_0412265
1004 Ga0495670_0477694
1005 Ga0495670_0599671
1006 Ga0495670_0646570
1007 Ga0495670_0824340
1008 Ga0495671_0375395
1009 Ga0495649_0052059
1010 Ga0495649_0065481
1011 Ga0495589_0000029
1012 Ga0495589_0000412
1013 Ga0495589_0004833
1014 Ga0495589_0087766
1015 Ga0495589_0129284
1016 Ga0495589_0529402
1017 Ga0495600_0005879
1018 Ga0495600_0526948
1019 Ga0495660_0000033
1020 Ga0495660_0077124
1021 Ga0495660_0253925
1022 Ga0495660_0348033
1023 Ga0495660_0440824
1024 Ga0495581_0002799
1025 Ga0495581_0043672
1026 Ga0495581_0229664
1027 Ga0495581_0360974
1028 Ga0495604_0009216
1029 Ga0495604_0766203
1030 Ga0495636_0006597
1031 Ga0495636_0015661
1032 Ga0495636_0155154
1033 Ga0495636_0219201
1034 Ga0495674_0021167
1035 Ga0495672_0016778
1036 Ga0495672_0359404
1037 Ga0495672_0443559
1038 Ga0495672_0473272
1039 Ga0495676_0026427
1040 Ga0495676_0097705
1041 Ga0495676_0500717
1042 Ga0495683_0000007
1043 Ga0495683_0005914
1044 Ga0495683_0039587
1045 Ga0495683_0130428
1046 Ga0495683_0320227
1047 Ga0495687_000003
1048 Ga0495687_000950
1049 Ga0495687_000963
1050 Ga0495687_074642
1051 Ga0495675_0006330
1052 Ga0495675_0049033
1053 Ga0495675_0168793
1054 Ga0495677_0000001
1055 Ga0495677_0000214
1056 Ga0495677_0002944
1057 Ga0495677_0004794
1058 Ga0495677_0059972
1059 Ga0495677_0070520
1060 Ga0495677_0216060
1061 Ga0495679_011283
1062 Ga0495679_073925
1063 Ga0495685_097011
1064 Ga0495685_172927
1065 Ga0495685_293032
1066 Ga0495685_297480
1067 Ga0495681_0007714
1068 Ga0495681_0025159
1069 Ga0495681_0172803
1070 Ga0495681_0346696
1071 Ga0495681_0392731
1072 Ga0495686_0000015
1073 Ga0495593_0007764
1074 Ga0495593_0016031
1075 Ga0495593_0295167
1076 Ga0495602_0011432
1077 Ga0495614_0038149
1078 Ga0495614_0296675
1079 Ga0495615_0000435
1080 Ga0495615_0323496
1081 Ga0495626_0000160
1082 Ga0495626_0001725
1083 Ga0495626_0004329
1084 Ga0495626_0004800
1085 Ga0495626_0009079
1086 Ga0495626_0010260
1087 Ga0495626_0016989
1088 Ga0495626_0035338
1089 Ga0495626_0059075
1090 Ga0495626_0119849
1091 Ga0495626_0125231
1092 Ga0495626_0128147
1093 Ga0495626_0137195
1094 Ga0496100_0098293
1095 Ga0496101_0039471
1096 Ga0496102_0006653
1097 Ga0496102_0036902
1098 Ga0496102_0073377
1099 Ga0496102_0543241
1100 Ga0496103_0006143
1101 Ga0496103_0216357
1102 Ga0496105_0370131
1103 Ga0496107_0197707
1104 Ga0496108_0496472
1105 Ga0496109_0193607
1106 Ga0496110_0204948
1107 Ga0496110_0386363
1108 Ga0496110_1060891
1109 Ga0496110_1062576
1110 Ga0496110_1371414
1111 Ga0496112_0131685
1112 Ga0496113_0007993
1113 Ga0496113_0147600
1114 Ga0496114_0105928
1115 Ga0496115_0070880
1116 Ga0496115_0156343
1117 Ga0496115_0207283
1118 Ga0496121_0361086
1119 Ga0496122_0003642
1120 Ga0496122_0128925
1121 Ga0496122_0327511
1122 Ga0496123_0002957
1123 Ga0496123_0342784
1124 Ga0496124_0003878
1125 Ga0496124_0018343
1126 Ga0496124_0040776
1127 Ga0496124_0108484
1128 Ga0496124_0131184
1129 Ga0496124_0165608
1130 Ga0496124_0205220
1131 Ga0496125_0051321
1132 Ga0496125_0304565
1133 Ga0496126_0509884
1134 Ga0501308_055996
1135 Ga0495682_0003938
1136 Ga0495682_0025866
1137 Ga0495682_0234048
1138 Ga0501315_100411
1139 Ga0501036_0817499
1140 Ga0501038_0042837
1141 Ga0501043_0058766
1142 Ga0501046_0222907
1143 Ga0501047_0118751
1144 Ga0501047_0933182
1145 Ga0501067_0549529
1146 Ga0501073_0106024
1147 Ga0501080_0399579
1148 Ga0501035_0001065
1149 Ga0501035_0057748
1150 Ga0501044_0087456
1151 Ga0501044_0339094
1152 nmdc:mga0rr50_346423_c1
1153 nmdc:mga0a205_380762_c1
1154 Ga0500556_0001839
1155 Ga0501082_0468495
1156 Ga0466962_0315548
1157 2673165395
1158 2881103049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

2

102

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lrc-assembly1.cif.gz_A structure of thioredoxin 2 from pseudomonas aeruginosa pao1 in its reduced form 0.8908 1 106
1r26-assembly1.cif.gz_A crystal structure of thioredoxin from trypanosoma brucei brucei 0.8769 13 102
2lrc-assembly1.cif.gz_A structure of thioredoxin 2 from pseudomonas aeruginosa pao1 in its reduced form 0.8757 1 106
7q3j-assembly2.cif.gz_B computationally designed thioredoxin subjected to stability optimizing mutations. 0.8682 21 104
7vqv-assembly1.cif.gz_A de novo design based on 1r26 0.8653 14 103
ID Description Score Start End Superfamily
2lrcA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8908 1 106 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8841 21 103 3.40.30.10
1r26A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8769 13 102 3.40.30.10
2lrcA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8757 1 106 3.40.30.10
af_O76877_42_160_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8722 18 104 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A558CU30-F1-model_v4 Thioredoxin family protein 0.9924 1 80
AF-S6J327-F1-model_v4 Thioredoxin domain-containing protein 0.9897 2 101
AF-A0A7S9C9C0-F1-model_v4 Thioredoxin family protein 0.9863 3 102
AF-A0A7T2X2I9-F1-model_v4 merged 0.9861 3 99
AF-A0A1H8BA79-F1-model_v4 Thioredoxin 1 0.9859 8 105

Map