F465987

General Info

Members Datasets Scaffolds Average Seq Length
580 287 573 215

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0229774|Ga0466967_0229774_1019_1738
Length 239
Sequence MTSARRIGAPDAKNRVLLLDAAERLMLEEGYAAVTSRRLANKAGLKPQLVHYYFRTMEELFLEVFRRRAEEALEVHAQMLKSPQPLWALWRFGTDPAFTRISMEFMALANHRKEMRAEIAYYAERFRDEQRQAVATALERYGSRIQDEGQDIDIPPVVWTVLMSSLSRFLVLEQAIGMSAGHAETLELVENYLRRLEGEPRPIEGVPDTWIVHQFRSEQSTPLGPSLDTTTAPSTARSQ

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
8 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.48
Nodule 0.17
Rhizoplane 9.14
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002176 3300000546 Bacteria 2447
2 JGI24746J21847_1016951 3300001977 Bacteria 1037
3 JGI24737J22298_10071779 3300001990 Bacteria 1033
4 JGI24750J21931_1028103 3300002070 Bacteria 816
5 JGI24745J21846_1002207 3300002073 Bacteria 1968
6 JGI24744J21845_10000316 3300002077 Bacteria 8121
7 JGI24744J21845_10023989 3300002077 Bacteria 1194
8 JGI24742J22300_10017465 3300002244 Bacteria 1213
9 JGI24742J22300_10025495 3300002244 Bacteria 1022
10 JGI24751J29686_10030464 3300002459 Bacteria 1119
11 rootH2_10113120 3300003320 Bacteria 2598
12 Ga0070676_10017688 3300005328 Bacteria 3944
13 Ga0068869_100163783 3300005334 Bacteria 1733
14 Ga0070666_10020422 3300005335 Bacteria 4282
15 Ga0070666_10200190 3300005335 Bacteria 1405
16 Ga0070666_10222102 3300005335 Bacteria 1333
17 Ga0070666_10282204 3300005335 Bacteria 1181
18 Ga0070680_100437035 3300005336 Bacteria 1117
19 Ga0070682_100132270 3300005337 Bacteria 1690
20 Ga0070682_100328810 3300005337 Bacteria 1132
21 Ga0068868_100001495 3300005338 Bacteria 16133
22 Ga0068868_100041231 3300005338 Bacteria 3596
23 Ga0070660_100196369 3300005339 Bacteria 1636
24 Ga0070689_100179182 3300005340 Bacteria 1720
25 Ga0070689_100243271 3300005340 Bacteria 1482
26 Ga0070691_10005058 3300005341 Bacteria 5992
27 Ga0070691_10112944 3300005341 Bacteria 1361
28 Ga0070687_100035626 3300005343 Bacteria 2473
29 Ga0070661_100265326 3300005344 Bacteria 1328
30 Ga0070668_100000783 3300005347 Bacteria 21957
31 Ga0070668_100003719 3300005347 Bacteria 11250
32 Ga0070669_100014426 3300005353 Bacteria 5624
33 Ga0070675_100066497 3300005354 Bacteria 2982
34 Ga0070675_100801020 3300005354 Bacteria 861
35 Ga0070671_100044151 3300005355 Bacteria 3703
36 Ga0070671_100057274 3300005355 Bacteria 3243
37 Ga0070671_100077328 3300005355 Bacteria 2781
38 Ga0070674_100015666 3300005356 Bacteria 4739
39 Ga0070674_100022230 3300005356 Bacteria 4088
40 Ga0070674_100023965 3300005356 Bacteria 3957
41 Ga0070673_100313043 3300005364 Bacteria 1385
42 Ga0070673_100343493 3300005364 Bacteria 1323
43 Ga0070673_100408529 3300005364 Bacteria 1215
44 Ga0070688_100137511 3300005365 Bacteria 1656
45 Ga0070659_100066066 3300005366 Bacteria 2866
46 Ga0070667_100000073 3300005367 Bacteria 122757
47 Ga0070667_100009799 3300005367 Bacteria 7943
48 Ga0070667_100111654 3300005367 Bacteria 2371
49 Ga0070667_100489512 3300005367 Bacteria 1127
50 Ga0070703_10056619 3300005406 Bacteria 1270
51 Ga0070709_10073864 3300005434 Bacteria 2209
52 Ga0070709_10095111 3300005434 Bacteria 1973
53 Ga0070714_100021043 3300005435 Bacteria 5333
54 Ga0070714_100668797 3300005435 Bacteria 1000
55 Ga0070714_100836877 3300005435 Bacteria 892
56 Ga0070713_100187948 3300005436 Bacteria 1860
57 Ga0070710_10009560 3300005437 Bacteria 4747
58 Ga0070710_10055578 3300005437 Bacteria 2238
59 Ga0070710_10173321 3300005437 Bacteria 1346
60 Ga0070701_10022390 3300005438 Bacteria 3029
61 Ga0070711_100061683 3300005439 Bacteria 2611
62 Ga0070705_100088457 3300005440 Bacteria 1923
63 Ga0070700_100078182 3300005441 Bacteria 2129
64 Ga0070694_100018878 3300005444 Bacteria 4381
65 Ga0070694_100262384 3300005444 Bacteria 1311
66 Ga0070708_100852835 3300005445 Bacteria 856
67 Ga0070663_100019188 3300005455 Bacteria 4500
68 Ga0070663_100238170 3300005455 Bacteria 1435
69 Ga0070663_100294216 3300005455 Bacteria 1298
70 Ga0070678_100000501 3300005456 Bacteria 18833
71 Ga0070678_100094977 3300005456 Bacteria 2296
72 Ga0070662_100075466 3300005457 Bacteria 2497
73 Ga0068867_100074364 3300005459 Bacteria 2547
74 Ga0068867_100188205 3300005459 Bacteria 1645
75 Ga0070685_10057168 3300005466 Bacteria 2270
76 Ga0070685_10097165 3300005466 Bacteria 1793
77 Ga0070685_10110263 3300005466 Bacteria 1694
78 Ga0070685_10252116 3300005466 Bacteria 1170
79 Ga0068853_100514628 3300005539 Bacteria 1131
80 Ga0068853_100692348 3300005539 Bacteria 972
81 Ga0070695_100001861 3300005545 Bacteria 11918
82 Ga0070695_100354725 3300005545 Bacteria 1100
83 Ga0070696_100312646 3300005546 Bacteria 1206
84 Ga0070696_100536246 3300005546 Bacteria 936
85 Ga0070693_100010072 3300005547 Bacteria 4719
86 Ga0070693_100097421 3300005547 Bacteria 1785
87 Ga0070665_100010228 3300005548 Bacteria 9491
88 Ga0070665_100061435 3300005548 Bacteria 3767
89 Ga0070665_100111578 3300005548 Bacteria 2737
90 Ga0070704_100333206 3300005549 Bacteria 1275
91 Ga0068855_100424022 3300005563 Bacteria 1455
92 Ga0068855_101037312 3300005563 Bacteria 860
93 Ga0070664_100241320 3300005564 Bacteria 1622
94 Ga0068854_100002504 3300005578 Bacteria 11390
95 Ga0068854_100024955 3300005578 Bacteria 4100
96 Ga0070702_100020309 3300005615 Bacteria 3477
97 Ga0068852_100155991 3300005616 Bacteria 2127
98 Ga0068852_100157472 3300005616 Bacteria 2117
99 Ga0068859_100000223 3300005617 Bacteria 56082
100 Ga0068859_100008823 3300005617 Bacteria 10180
101 Ga0068859_100113717 3300005617 Bacteria 2770
102 Ga0068864_100314231 3300005618 Bacteria 1470
103 Ga0068866_10001113 3300005718 Bacteria 11805
104 Ga0068866_10074122 3300005718 Bacteria 1808
105 Ga0068861_100002059 3300005719 Bacteria 13039
106 Ga0068861_100073442 3300005719 Bacteria 2657
107 Ga0068863_100001282 3300005841 Bacteria 25087
108 Ga0068863_100003966 3300005841 Bacteria 14617
109 Ga0068863_100183668 3300005841 Bacteria 2008
110 Ga0068858_100011570 3300005842 Bacteria 8322
111 Ga0068858_100015499 3300005842 Bacteria 7169
112 Ga0068858_100805532 3300005842 Bacteria 916
113 Ga0068860_100000127 3300005843 Bacteria 122766
114 Ga0068860_100008110 3300005843 Bacteria 10460
115 Ga0068860_100072044 3300005843 Bacteria 3283
116 Ga0068860_100140177 3300005843 Bacteria 2324
117 Ga0068862_100000052 3300005844 Bacteria 144622
118 Ga0068862_100028247 3300005844 Bacteria 4722
119 Ga0068862_100073627 3300005844 Bacteria 2952
120 Ga0081455_10013790 3300005937 Bacteria 7953
121 Ga0075365_10049552 3300006038 Bacteria 2768
122 Ga0075365_10085563 3300006038 Bacteria 2141
123 Ga0075365_10089023 3300006038 Bacteria 2101
124 Ga0075365_10134475 3300006038 Bacteria 1713
125 Ga0075365_10144935 3300006038 Bacteria 1650
126 Ga0075363_100006604 3300006048 Bacteria 5284
127 Ga0075363_100013738 3300006048 Bacteria 3938
128 Ga0075363_100023622 3300006048 Bacteria 3119
129 Ga0075363_100056693 3300006048 Bacteria 2101
130 Ga0075363_100065906 3300006048 Bacteria 1959
131 Ga0075363_100071350 3300006048 Bacteria 1888
132 Ga0075363_100095308 3300006048 Bacteria 1641
133 Ga0075363_100299646 3300006048 Bacteria 933
134 Ga0075363_100365128 3300006048 Bacteria 845
135 Ga0075364_10005662 3300006051 Bacteria 7283
136 Ga0075364_10007711 3300006051 Bacteria 6404
137 Ga0075364_10020279 3300006051 Bacteria 4180
138 Ga0075364_10031438 3300006051 Bacteria 3410
139 Ga0075364_10045093 3300006051 Bacteria 2870
140 Ga0075364_10110545 3300006051 Bacteria 1834
141 Ga0075364_10137128 3300006051 Bacteria 1644
142 Ga0070716_100014974 3300006173 Bacteria 3978
143 Ga0070712_100019330 3300006175 Bacteria 4442
144 Ga0070712_100048619 3300006175 Bacteria 2941
145 Ga0075362_10050307 3300006177 Bacteria 1863
146 Ga0075362_10066849 3300006177 Bacteria 1634
147 Ga0075362_10221904 3300006177 Bacteria 924
148 Ga0075367_10028997 3300006178 Bacteria 3162
149 Ga0075367_10054198 3300006178 Bacteria 2378
150 Ga0075367_10125645 3300006178 Bacteria 1583
151 Ga0075369_10001688 3300006186 Bacteria 7627
152 Ga0075369_10004739 3300006186 Bacteria 5048
153 Ga0075369_10006908 3300006186 Bacteria 4309
154 Ga0075369_10008590 3300006186 Bacteria 3935
155 Ga0075369_10085012 3300006186 Bacteria 1407
156 Ga0075369_10158723 3300006186 Bacteria 1036
157 Ga0075369_10256327 3300006186 Bacteria 813
158 Ga0075366_10236581 3300006195 Bacteria 1113
159 Ga0075370_10001453 3300006353 Bacteria 10286
160 Ga0075370_10019258 3300006353 Bacteria 3715
161 Ga0075370_10021785 3300006353 Bacteria 3513
162 Ga0075370_10155733 3300006353 Bacteria 1340
163 Ga0075370_10205736 3300006353 Bacteria 1161
164 Ga0075428_100005457 3300006844 Bacteria 14138
165 Ga0075430_100455820 3300006846 Bacteria 1055
166 Ga0075431_100174664 3300006847 Bacteria 2207
167 Ga0075434_100352450 3300006871 Bacteria 1493
168 Ga0068865_100033143 3300006881 Bacteria 3456
169 Ga0097620_100000223 3300006931 Bacteria 56082
170 Ga0097620_100008823 3300006931 Bacteria 10180
171 Ga0097620_100113717 3300006931 Bacteria 2770
172 Ga0075435_101079922 3300007076 Bacteria 701
173 Ga0111539_10256005 3300009094 Bacteria 2038
174 Ga0111539_11114981 3300009094 Bacteria 917
175 Ga0105245_10739475 3300009098 Bacteria 1019
176 Ga0105245_10812132 3300009098 Bacteria 974
177 Ga0105247_10000066 3300009101 Bacteria 121025
178 Ga0105247_10071029 3300009101 Bacteria 2176
179 Ga0105247_10075075 3300009101 Bacteria 2121
180 Ga0114129_10077725 3300009147 Bacteria 4616
181 Ga0105243_10005180 3300009148 Bacteria 10207
182 Ga0105243_10158367 3300009148 Bacteria 1950
183 Ga0105241_10596877 3300009174 Bacteria 997
184 Ga0105242_10001265 3300009176 Bacteria 19971
185 Ga0105242_10553813 3300009176 Bacteria 1103
186 Ga0105248_10000144 3300009177 Bacteria 81953
187 Ga0105248_10025545 3300009177 Bacteria 6567
188 Ga0105248_10286967 3300009177 Bacteria 1853
189 Ga0105248_10594467 3300009177 Bacteria 1249
190 Ga0105237_10233829 3300009545 Bacteria 1839
191 Ga0105237_10366623 3300009545 Bacteria 1445
192 Ga0105237_10785112 3300009545 Bacteria 959
193 Ga0105238_10195401 3300009551 Bacteria 1999
194 Ga0105249_10000093 3300009553 Bacteria 122840
195 Ga0105249_10010343 3300009553 Bacteria 8201
196 Ga0105249_10017377 3300009553 Bacteria 6385
197 Ga0105249_10067733 3300009553 Bacteria 3290
198 Ga0105249_10784709 3300009553 Bacteria 1016
199 Ga0099796_10087690 3300010159 Bacteria 1152
200 Ga0105239_10065105 3300010375 Bacteria 4002
201 Ga0105239_10083690 3300010375 Bacteria 3514
202 Ga0105239_10098380 3300010375 Bacteria 3234
203 Ga0105246_10008144 3300011119 Bacteria 6435
204 Ga0157369_10784791 3300013105 Bacteria 979
205 Ga0157374_10138778 3300013296 Bacteria 2358
206 Ga0157374_10510725 3300013296 Bacteria 1207
207 Ga0157378_10005801 3300013297 Bacteria 10820
208 Ga0157378_10043286 3300013297 Bacteria 3997
209 Ga0163162_10083823 3300013306 Bacteria 3262
210 Ga0163162_10157947 3300013306 Bacteria 2388
211 Ga0163162_10312469 3300013306 Bacteria 1704
212 Ga0163162_10351783 3300013306 Bacteria 1606
213 Ga0163162_10565186 3300013306 Bacteria 1265
214 Ga0163162_10733299 3300013306 Bacteria 1108
215 Ga0157372_10023638 3300013307 Bacteria 6667
216 Ga0157372_10597592 3300013307 Bacteria 1286
217 Ga0157375_10021798 3300013308 Bacteria 5884
218 Ga0157375_10033105 3300013308 Bacteria 4908
219 Ga0157375_10485297 3300013308 Bacteria 1401
220 Ga0163163_10077208 3300014325 Bacteria 3326
221 Ga0163163_10123874 3300014325 Bacteria 2621
222 Ga0157380_10004282 3300014326 Bacteria 9881
223 Ga0157380_10533748 3300014326 Bacteria 1147
224 Ga0182008_10061117 3300014497 Bacteria 1857
225 Ga0157379_10016326 3300014968 Bacteria 6531
226 Ga0157379_10025675 3300014968 Bacteria 5236
227 Ga0157379_10077493 3300014968 Bacteria 2976
228 Ga0163161_10015015 3300017792 Bacteria 5396
229 Ga0163161_10026591 3300017792 Bacteria 4099
230 Ga0163161_10143081 3300017792 Bacteria 1812
231 Ga0213876_10006661 3300021384 Bacteria 6304
232 Ga0213876_10013586 3300021384 Bacteria 4319
233 Ga0213876_10050116 3300021384 Bacteria 2206
234 Ga0213876_10313239 3300021384 Bacteria 834
235 Ga0213875_10042878 3300021388 Bacteria 2125
236 Ga0207653_10023312 3300025885 Bacteria 1971
237 Ga0207692_10066928 3300025898 Bacteria 1879
238 Ga0207642_10000575 3300025899 Bacteria 11305
239 Ga0207642_10116703 3300025899 Bacteria 1369
240 Ga0207710_10000090 3300025900 Bacteria 121405
241 Ga0207710_10011885 3300025900 Bacteria 3663
242 Ga0207710_10072953 3300025900 Bacteria 1577
243 Ga0207688_10140344 3300025901 Bacteria 1422
244 Ga0207680_10505033 3300025903 Bacteria 861
245 Ga0207647_10070846 3300025904 Bacteria 2105
246 Ga0207699_10067524 3300025906 Bacteria 2174
247 Ga0207699_10293131 3300025906 Bacteria 1134
248 Ga0207645_10055165 3300025907 Bacteria 2537
249 Ga0207645_10088521 3300025907 Bacteria 1990
250 Ga0207671_10385702 3300025914 Bacteria 1113
251 Ga0207693_10000428 3300025915 Bacteria 38211
252 Ga0207693_10003739 3300025915 Bacteria 12973
253 Ga0207663_10461405 3300025916 Bacteria 981
254 Ga0207663_10578995 3300025916 Bacteria 880
255 Ga0207660_10067205 3300025917 Bacteria 2595
256 Ga0207662_10106023 3300025918 Bacteria 1747
257 Ga0207657_10110869 3300025919 Bacteria 2266
258 Ga0207649_10192964 3300025920 Bacteria 1434
259 Ga0207681_10009333 3300025923 Bacteria 5994
260 Ga0207681_10023815 3300025923 Bacteria 3921
261 Ga0207694_10091957 3300025924 Bacteria 2394
262 Ga0207659_10053405 3300025926 Bacteria 2882
263 Ga0207659_10710127 3300025926 Bacteria 861
264 Ga0207687_10012498 3300025927 Bacteria 5546
265 Ga0207687_10135411 3300025927 Bacteria 1862
266 Ga0207664_10014274 3300025929 Bacteria 5729
267 Ga0207664_10639054 3300025929 Bacteria 956
268 Ga0207644_10069103 3300025931 Bacteria 2579
269 Ga0207644_10538101 3300025931 Bacteria 966
270 Ga0207690_10022015 3300025932 Bacteria 3959
271 Ga0207690_10045255 3300025932 Bacteria 2906
272 Ga0207706_10001922 3300025933 Bacteria 20409
273 Ga0207706_10005781 3300025933 Bacteria 11505
274 Ga0207686_10010548 3300025934 Bacteria 5034
275 Ga0207709_10002942 3300025935 Bacteria 10394
276 Ga0207709_10084979 3300025935 Bacteria 2050
277 Ga0207709_10092748 3300025935 Bacteria 1978
278 Ga0207670_10050743 3300025936 Bacteria 2782
279 Ga0207670_10245607 3300025936 Bacteria 1381
280 Ga0207669_10001292 3300025937 Bacteria 10625
281 Ga0207669_10019081 3300025937 Bacteria 3561
282 Ga0207704_10005436 3300025938 Bacteria 5878
283 Ga0207665_10008506 3300025939 Bacteria 6756
284 Ga0207665_10018260 3300025939 Bacteria 4607
285 Ga0207691_10113196 3300025940 Bacteria 2411
286 Ga0207711_10000183 3300025941 Bacteria 67270
287 Ga0207711_10243986 3300025941 Bacteria 1648
288 Ga0207661_10354693 3300025944 Bacteria 1324
289 Ga0207667_11018917 3300025949 Bacteria 814
290 Ga0207651_10607915 3300025960 Bacteria 956
291 Ga0207712_10000073 3300025961 Bacteria 123046
292 Ga0207712_10030405 3300025961 Bacteria 3630
293 Ga0207712_10428225 3300025961 Bacteria 1118
294 Ga0207668_10000804 3300025972 Bacteria 19218
295 Ga0207668_10005657 3300025972 Bacteria 7357
296 Ga0207668_10210348 3300025972 Bacteria 1555
297 Ga0207668_10225298 3300025972 Bacteria 1508
298 Ga0207668_10438795 3300025972 Bacteria 1112
299 Ga0207640_10127817 3300025981 Bacteria 1832
300 Ga0207640_10175390 3300025981 Bacteria 1602
301 Ga0207640_11131171 3300025981 Bacteria 694
302 Ga0207658_10000304 3300025986 Bacteria 50815
303 Ga0207658_10008729 3300025986 Bacteria 6885
304 Ga0207658_10336223 3300025986 Bacteria 1311
305 Ga0207658_10350038 3300025986 Bacteria 1286
306 Ga0207658_10617685 3300025986 Bacteria 975
307 Ga0207677_10020820 3300026023 Bacteria 3993
308 Ga0207677_10025297 3300026023 Bacteria 3701
309 Ga0207703_10016203 3300026035 Bacteria 5810
310 Ga0207703_10034314 3300026035 Bacteria 4025
311 Ga0207703_11169748 3300026035 Bacteria 739
312 Ga0207639_10016205 3300026041 Bacteria 5267
313 Ga0207678_10017856 3300026067 Bacteria 6231
314 Ga0207678_10159080 3300026067 Bacteria 1929
315 Ga0207678_10396601 3300026067 Bacteria 1194
316 Ga0207708_10001568 3300026075 Bacteria 17075
317 Ga0207708_10027129 3300026075 Bacteria 4337
318 Ga0207641_10000413 3300026088 Bacteria 49861
319 Ga0207641_10027640 3300026088 Bacteria 4685
320 Ga0207641_10174931 3300026088 Bacteria 1962
321 Ga0207648_10017088 3300026089 Bacteria 6612
322 Ga0207648_10028388 3300026089 Bacteria 4960
323 Ga0207676_10833429 3300026095 Bacteria 901
324 Ga0207675_100000876 3300026118 Bacteria 30016
325 Ga0207675_100021869 3300026118 Bacteria 5954
326 Ga0207675_100244324 3300026118 Bacteria 1735
327 Ga0207675_101478523 3300026118 Bacteria 700
328 Ga0207683_10001137 3300026121 Bacteria 24171
329 Ga0207698_10091578 3300026142 Bacteria 2489
330 Ga0207698_10116832 3300026142 Bacteria 2249
331 Ga0207428_10588650 3300027907 Bacteria 802
332 Ga0268266_10052494 3300028379 Bacteria 3501
333 Ga0268266_10082887 3300028379 Bacteria 2798
334 Ga0268266_10108114 3300028379 Bacteria 2460
335 Ga0268265_10000063 3300028380 Bacteria 144643
336 Ga0268265_10270093 3300028380 Bacteria 1516
337 Ga0268264_10000007 3300028381 Bacteria 815790
338 Ga0268264_10022353 3300028381 Bacteria 5165
339 Ga0268264_10119260 3300028381 Bacteria 2323
340 Ga0307410_10274001 3300031852 Bacteria 1321
341 Ga0307410_10523279 3300031852 Bacteria 979
342 Ga0307406_10067866 3300031901 Bacteria 2326
343 Ga0307409_100302813 3300031995 Bacteria 1488
344 Ga0373961_0162226 3300035241 Bacteria 768
345 Ga0373931_0120332 3300035691 Bacteria 1500
346 Ga0436364_0045315 3300037853 Bacteria 1048
347 Ga0436364_0218929 3300037853 Bacteria 25746
348 Ga0436364_0559448 3300037853 Bacteria 8381
349 Ga0436365_0456575 3300039437 Bacteria 43610
350 Ga0436365_0464410 3300039437 Bacteria 5847
351 Ga0436365_1302860 3300039437 Bacteria 3152
352 Ga0436365_1319574 3300039437 Bacteria 2454
353 Ga0436365_1352201 3300039437 Bacteria 6227
354 Ga0436365_1765865 3300039437 Bacteria 11286
355 Ga0439461_0025583 3300041410 Bacteria 1199
356 Ga0439466_0012644 3300041411 Bacteria 3103
357 Ga0439466_0018266 3300041411 Bacteria 2517
358 Ga0439465_0010197 3300041413 Bacteria 2952
359 Ga0439465_0127072 3300041413 Bacteria 897
360 Ga0451855_1772296 3300041511 Bacteria 1244
361 Ga0439431_0144666 3300041997 Bacteria 673
362 Ga0439445_0002473 3300042004 Bacteria 4117
363 Ga0439445_0013044 3300042004 Bacteria 2006
364 Ga0439448_0063764 3300042005 Bacteria 1221
365 Ga0439434_0024358 3300042435 Bacteria 1825
366 Ga0439434_0071524 3300042435 Bacteria 1092
367 Ga0466969_0088649 3300044656 Bacteria 1468
368 Ga0466972_0004838 3300044658 Bacteria 6756
369 Ga0466972_0025438 3300044658 Bacteria 2935
370 Ga0466972_0072915 3300044658 Bacteria 1637
371 Ga0466972_0078539 3300044658 Bacteria 1572
372 Ga0466965_0001888 3300044683 Bacteria 8728
373 Ga0466966_0008407 3300044684 Bacteria 6828
374 Ga0466961_0005701 3300044693 Bacteria 7877
375 Ga0466963_0015491 3300044694 Bacteria 4723
376 Ga0466963_0041783 3300044694 Bacteria 3008
377 Ga0466963_0298266 3300044694 Bacteria 1133
378 Ga0466968_0000457 3300044735 Bacteria 13772
379 Ga0466968_0031496 3300044735 Bacteria 2201
380 Ga0466968_0043155 3300044735 Bacteria 1908
381 Ga0466968_0201137 3300044735 Bacteria 933
382 Ga0466970_0005515 3300044765 Bacteria 6282
383 Ga0466970_0060060 3300044765 Bacteria 2036
384 Ga0466957_0006255 3300044842 Bacteria 6719
385 Ga0466957_0012416 3300044842 Bacteria 4929
386 Ga0466957_0013759 3300044842 Bacteria 4700
387 Ga0466957_0026915 3300044842 Bacteria 3414
388 Ga0466960_0000688 3300044901 Bacteria 11777
389 Ga0466960_0001536 3300044901 Bacteria 8424
390 Ga0466960_0002878 3300044901 Bacteria 6532
391 Ga0466960_0018037 3300044901 Bacteria 3088
392 Ga0466959_0003108 3300045049 Bacteria 10762
393 Ga0466959_0018065 3300045049 Bacteria 5175
394 Ga0466959_0081491 3300045049 Bacteria 2332
395 Ga0466958_0000569 3300045836 Bacteria 15728
396 Ga0466958_0042518 3300045836 Bacteria 2736
397 Ga0466967_0007445 3300045976 Bacteria 7898
398 Ga0466967_0060633 3300045976 Bacteria 3353
399 Ga0466967_0079233 3300045976 Bacteria 2961
400 Ga0466967_0229774 3300045976 Bacteria 1766
401 Ga0466967_0257586 3300045976 Bacteria 1668
402 Ga0495603_0265882 3300046455 Bacteria 987
403 Ga0495629_0011744 3300046459 Bacteria 6356
404 Ga0495638_0001056 3300046460 Bacteria 27089
405 Ga0495638_0068791 3300046460 Bacteria 2170
406 Ga0495638_0102273 3300046460 Bacteria 1712
407 Ga0495653_0031275 3300046463 Bacteria 4231
408 Ga0495582_0064233 3300046473 Bacteria 2027
409 Ga0495662_0367136 3300046476 Bacteria 707
410 Ga0495583_0248818 3300046506 Bacteria 713
411 Ga0495606_0354595 3300046507 Bacteria 777
412 Ga0495630_0114797 3300046517 Bacteria 2041
413 Ga0495665_0355783 3300046531 Bacteria 745
414 Ga0495640_0095527 3300046533 Bacteria 1956
415 Ga0495586_0305544 3300046535 Bacteria 912
416 Ga0495622_0238536 3300046557 Bacteria 802
417 Ga0495667_0151162 3300046559 Bacteria 1495
418 Ga0495668_0118527 3300046616 Bacteria 1448
419 Ga0495625_0204006 3300046660 Bacteria 1303
420 Ga0495657_0090627 3300046675 Bacteria 1962
421 Ga0495649_0045101 3300046694 Bacteria 2405
422 Ga0495600_0103642 3300046809 Bacteria 1854
423 Ga0495660_0263985 3300046810 Bacteria 794
424 Ga0495581_0067137 3300047315 Bacteria 2074
425 Ga0495604_0167185 3300047317 Bacteria 1550
426 Ga0495674_0153209 3300047319 Bacteria 1932
427 Ga0495672_0021028 3300047320 Bacteria 4262
428 Ga0495672_0119899 3300047320 Bacteria 1400
429 Ga0495686_0038665 3300047472 Bacteria 3050
430 Ga0495686_0125386 3300047472 Bacteria 1527
431 Ga0496100_0005502 3300048903 Bacteria 6830
432 Ga0496100_0025472 3300048903 Bacteria 3618
433 Ga0496100_0033526 3300048903 Bacteria 3214
434 Ga0496100_0101067 3300048903 Bacteria 1987
435 Ga0496101_0004333 3300048904 Bacteria 8904
436 Ga0496101_0007372 3300048904 Bacteria 7125
437 Ga0496101_0019605 3300048904 Bacteria 4620
438 Ga0496101_0273729 3300048904 Bacteria 1318
439 Ga0496102_0000168 3300048905 Bacteria 88511
440 Ga0496102_0001819 3300048905 Bacteria 18419
441 Ga0496102_0055058 3300048905 Bacteria 3628
442 Ga0496102_0498566 3300048905 Bacteria 1140
443 Ga0496102_0576384 3300048905 Bacteria 1048
444 Ga0496103_0000550 3300048906 Bacteria 29973
445 Ga0496103_0002065 3300048906 Bacteria 12847
446 Ga0496104_0001250 3300048907 Bacteria 21900
447 Ga0496104_0589941 3300048907 Bacteria 1022
448 Ga0496105_0025816 3300048908 Bacteria 4786
449 Ga0496105_0181249 3300048908 Bacteria 1725
450 Ga0496105_0262294 3300048908 Bacteria 1397
451 Ga0496106_0001250 3300048909 Bacteria 19036
452 Ga0496106_0017361 3300048909 Bacteria 5325
453 Ga0496106_0051295 3300048909 Bacteria 3110
454 Ga0496106_0115196 3300048909 Bacteria 2096
455 Ga0496106_0759995 3300048909 Bacteria 770
456 Ga0496107_0000831 3300048910 Bacteria 18014
457 Ga0496107_0015968 3300048910 Bacteria 5268
458 Ga0496107_0032518 3300048910 Bacteria 3729
459 Ga0496107_0309520 3300048910 Bacteria 1176
460 Ga0496107_0434793 3300048910 Bacteria 975
461 Ga0496108_0000223 3300048911 Bacteria 50671
462 Ga0496108_0067427 3300048911 Bacteria 3018
463 Ga0496109_0020947 3300048912 Bacteria 5779
464 Ga0496109_0060320 3300048912 Bacteria 3466
465 Ga0496109_0353927 3300048912 Bacteria 1387
466 Ga0496109_0808242 3300048912 Bacteria 876
467 Ga0496109_1064948 3300048912 Bacteria 746
468 Ga0496110_0171341 3300048913 Bacteria 1969
469 Ga0496110_0640225 3300048913 Bacteria 963
470 Ga0496112_0004133 3300048915 Bacteria 12213
471 Ga0496112_0024856 3300048915 Bacteria 5746
472 Ga0496112_0065410 3300048915 Bacteria 3588
473 Ga0496113_0016603 3300048916 Bacteria 5089
474 Ga0496113_0033773 3300048916 Bacteria 3728
475 Ga0496113_0049411 3300048916 Bacteria 3132
476 Ga0496113_0068065 3300048916 Bacteria 2702
477 Ga0496114_0000320 3300048917 Bacteria 35231
478 Ga0496114_0018865 3300048917 Bacteria 5585
479 Ga0496114_0057404 3300048917 Bacteria 3250
480 Ga0496115_0008280 3300048918 Bacteria 7685
481 Ga0496115_0470535 3300048918 Bacteria 1013
482 Ga0496115_0475300 3300048918 Bacteria 1007
483 Ga0496115_0604152 3300048918 Bacteria 872
484 Ga0496117_0000869 3300048920 Bacteria 46596
485 Ga0496118_0000171 3300048921 Bacteria 117495
486 Ga0496119_0017669 3300048922 Bacteria 5354
487 Ga0496120_0094625 3300048923 Bacteria 1590
488 Ga0496121_0013171 3300048924 Bacteria 8916
489 Ga0496122_0036885 3300048925 Bacteria 3944
490 Ga0496123_0020808 3300048926 Bacteria 5119
491 Ga0496124_0084821 3300048927 Bacteria 2596
492 Ga0496125_0020492 3300048928 Bacteria 6204
493 Ga0496125_0053441 3300048928 Bacteria 3311
494 Ga0496125_0219837 3300048928 Bacteria 1225
495 Ga0496126_0005442 3300048929 Bacteria 14520
496 Ga0496126_0006823 3300048929 Bacteria 12667
497 Ga0496126_0025483 3300048929 Bacteria 5689
498 Ga0501032_0117028 3300049569 Bacteria 1762
499 Ga0501033_0132369 3300049570 Bacteria 1806
500 Ga0501033_0516439 3300049570 Bacteria 825
501 Ga0501034_0005982 3300049571 Bacteria 13160
502 Ga0501034_0140724 3300049571 Bacteria 2393
503 Ga0501034_0160037 3300049571 Bacteria 2223
504 Ga0501034_0293644 3300049571 Bacteria 1563
505 Ga0501036_0661303 3300049572 Bacteria 865
506 Ga0501037_0044169 3300049573 Bacteria 3273
507 Ga0501046_0003366 3300049580 Bacteria 14687
508 Ga0501047_0027428 3300049581 Bacteria 5486
509 Ga0501048_0011970 3300049582 Bacteria 6468
510 Ga0501070_0001967 3300049586 Bacteria 18122
511 Ga0501070_0490708 3300049586 Bacteria 987
512 Ga0501080_0145210 3300049742 Bacteria 2193
513 Ga0501035_0000556 3300049822 Bacteria 41478
514 Ga0501035_0007575 3300049822 Bacteria 10145
515 Ga0501044_0000797 3300049823 Bacteria 38010
516 Ga0501044_0000935 3300049823 Bacteria 35094
517 nmdc:mga03n38_13639_c1 3300050490 Bacteria 3093
518 nmdc:mga03n38_26817_c1 3300050490 Bacteria 2383
519 nmdc:mga03n38_44530_c1 3300050490 Bacteria 1950
520 nmdc:mga03n38_7596_c1 3300050490 Bacteria 3844
521 nmdc:mga00v17_141698_c1 3300050491 Bacteria 1542
522 nmdc:mga00v17_147144_c1 3300050491 Bacteria 1512
523 nmdc:mga00v17_21928_c1 3300050491 Bacteria 3679
524 nmdc:mga00v17_2306_c1 3300050491 Bacteria 9788
525 nmdc:mga00v17_260_c1 3300050491 Bacteria 31041
526 nmdc:mga00v17_432888_c1 3300050491 Bacteria 854
527 nmdc:mga00v17_85546_c1 3300050491 Bacteria 1974
528 nmdc:mga0yw44_130684_c1 3300050492 Bacteria 1625
529 nmdc:mga0yw44_211674_c1 3300050492 Bacteria 1282
530 nmdc:mga0yw44_33275_c1 3300050492 Bacteria 3010
531 nmdc:mga0yw44_52524_c1 3300050492 Bacteria 2471
532 nmdc:mga0yw44_57308_c1 3300050492 Bacteria 2376
533 nmdc:mga0yw44_67901_c1 3300050492 Bacteria 2204
534 nmdc:mga0k408_111190_c1 3300050493 Bacteria 1619
535 nmdc:mga06z11_139089_c1 3300050494 Bacteria 1371
536 nmdc:mga06z11_145050_c1 3300050494 Bacteria 1345
537 nmdc:mga06z11_17661_c1 3300050494 Bacteria 3243
538 nmdc:mga06z11_202363_c1 3300050494 Bacteria 1154
539 nmdc:mga06z11_233082_c1 3300050494 Bacteria 1079
540 nmdc:mga07m45_205785_c1 3300050496 Bacteria 1145
541 nmdc:mga07m45_211266_c1 3300050496 Bacteria 1129
542 nmdc:mga07m45_38224_c1 3300050496 Bacteria 2678
543 nmdc:mga05p37_1121643_c1 3300050507 Bacteria 821
544 nmdc:mga05p37_214516_c1 3300050507 Bacteria 2325
545 nmdc:mga0qj67_472924_c1 3300050509 Bacteria 1009
546 nmdc:mga06r32_161127_c1 3300050510 Bacteria 2226
547 nmdc:mga08y16_5095_c1 3300050511 Bacteria 13734
548 nmdc:mga08y16_826551_c1 3300050511 Bacteria 917
549 nmdc:mga08y16_859511_c1 3300050511 Bacteria 896
550 nmdc:mga0n895_336904_c1 3300050512 Bacteria 1528
551 nmdc:mga0rr50_1086162_c1 3300050513 Bacteria 681
552 nmdc:mga0sz30_18694_c1 3300050516 Bacteria 2776
553 nmdc:mga0sz30_1955_c1 3300050516 Bacteria 7365
554 nmdc:mga0sz30_223918_c1 3300050516 Bacteria 836
555 nmdc:mga0sz30_27919_c1 3300050516 Bacteria 2320
556 nmdc:mga0sz30_28780_c1 3300050516 Bacteria 2287
557 Ga0495655_0009755 3300053083 Bacteria 1872
558 Ga0495595_0085128 3300053084 Bacteria 1511
559 Ga0500643_001380 3300053087 Bacteria 14057
560 Ga0500643_030047 3300053087 Bacteria 1667
561 Ga0500556_0018092 3300053104 Bacteria 2218
562 Ga0500562_012179 3300053108 Bacteria 2186
563 Ga0500642_0038329 3300053130 Bacteria 2054
564 Ga0500568_0081606 3300053139 Bacteria 1227
565 Ga0500604_0069518 3300053151 Bacteria 1120
566 Ga0500616_0007077 3300053153 Bacteria 7197
567 Ga0500627_0019443 3300053158 Bacteria 2707
568 Ga0500627_0068059 3300053158 Bacteria 1574
569 Ga0500611_053902 3300053727 Bacteria 931
570 Ga0500645_000007 3300053730 Bacteria 233700
571 Ga0500645_008205 3300053730 Bacteria 3583
572 Ga0466962_0104087 3300061719 Bacteria 1364
573 Ga0530510_0056351 3300061734 Bacteria 2839

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0470535 Ga0496115_0470535_376_1002 181
2 3300050513 nmdc:mga0rr50_1086162_c1 nmdc:mga0rr50_1086162_c1_32_640 182
3 3300037853 Ga0436364_0045315 Ga0436364_0045315_43_666 194
4 3300044735 Ga0466968_0031496 Ga0466968_0031496_710_1369 194
5 3300049571 Ga0501034_0140724 Ga0501034_0140724_943_1572 194
6 3300061719 Ga0466962_0104087 Ga0466962_0104087_656_1315 194
7 iso_pu_bacteria 2643221715 2644638192 194
8 iso_pu_bacteria 2902810491 2902812068 194
9 3300044658 Ga0466972_0078539 Ga0466972_0078539_115_744 195
10 3300050511 nmdc:mga08y16_5095_c1 nmdc:mga08y16_5095_c1_264_878 195
11 3300003320 rootH2_10113120 rootH2_101131203 196
12 3300005436 Ga0070713_100187948 Ga0070713_1001879482 196
13 3300005437 Ga0070710_10173321 Ga0070710_101733212 196
14 3300025929 Ga0207664_10014274 Ga0207664_100142743 196
15 3300044658 Ga0466972_0072915 Ga0466972_0072915_699_1334 196
16 3300045049 Ga0466959_0081491 Ga0466959_0081491_1144_1779 196
17 3300045976 Ga0466967_0257586 Ga0466967_0257586_849_1484 196
18 3300049569 Ga0501032_0117028 Ga0501032_0117028_632_1222 196
19 3300049570 Ga0501033_0132369 Ga0501033_0132369_895_1485 196
20 3300049571 Ga0501034_0160037 Ga0501034_0160037_691_1281 196
21 3300049822 Ga0501035_0000556 Ga0501035_0000556_19962_20552 196
22 3300049823 Ga0501044_0000797 Ga0501044_0000797_23048_23638 196
23 3300006871 Ga0075434_100352450 Ga0075434_1003524502 197
24 3300009094 Ga0111539_11114981 Ga0111539_111149812 197
25 3300013306 Ga0163162_10733299 Ga0163162_107332992 197
26 3300025972 Ga0207668_10210348 Ga0207668_102103483 197
27 3300026118 Ga0207675_101478523 Ga0207675_1014785231 197
28 3300031852 Ga0307410_10274001 Ga0307410_102740012 197
29 3300031995 Ga0307409_100302813 Ga0307409_1003028132 197
30 3300048905 Ga0496102_0498566 Ga0496102_0498566_125_763 197
31 3300048912 Ga0496109_1064948 Ga0496109_1064948_21_656 197
32 3300050494 nmdc:mga06z11_233082_c1 nmdc:mga06z11_233082_c1_319_951 197
33 3300050511 nmdc:mga08y16_826551_c1 nmdc:mga08y16_826551_c1_39_677 197
34 3300050512 nmdc:mga0n895_336904_c1 nmdc:mga0n895_336904_c1_733_1371 197
35 iso_pu_bacteria 2842134933 2842140082 197
36 3300001977 JGI24746J21847_1016951 JGI24746J21847_10169512 198
37 3300001990 JGI24737J22298_10071779 JGI24737J22298_100717791 198
38 3300002070 JGI24750J21931_1028103 JGI24750J21931_10281031 198
39 3300002073 JGI24745J21846_1002207 JGI24745J21846_10022072 198
40 3300002077 JGI24744J21845_10000316 JGI24744J21845_100003168 198
41 3300002077 JGI24744J21845_10023989 JGI24744J21845_100239891 198
42 3300002244 JGI24742J22300_10017465 JGI24742J22300_100174652 198
43 3300002244 JGI24742J22300_10025495 JGI24742J22300_100254951 198
44 3300002459 JGI24751J29686_10030464 JGI24751J29686_100304642 198
45 3300005328 Ga0070676_10017688 Ga0070676_100176885 198
46 3300005334 Ga0068869_100163783 Ga0068869_1001637833 198
47 3300005335 Ga0070666_10020422 Ga0070666_100204222 198
48 3300005335 Ga0070666_10222102 Ga0070666_102221022 198
49 3300005335 Ga0070666_10282204 Ga0070666_102822042 198
50 3300005336 Ga0070680_100437035 Ga0070680_1004370351 198
51 3300005337 Ga0070682_100132270 Ga0070682_1001322702 198
52 3300005337 Ga0070682_100328810 Ga0070682_1003288101 198
53 3300005338 Ga0068868_100001495 Ga0068868_1000014957 198
54 3300005338 Ga0068868_100041231 Ga0068868_1000412314 198
55 3300005339 Ga0070660_100196369 Ga0070660_1001963692 198
56 3300005340 Ga0070689_100179182 Ga0070689_1001791822 198
57 3300005340 Ga0070689_100243271 Ga0070689_1002432712 198
58 3300005341 Ga0070691_10005058 Ga0070691_100050587 198
59 3300005341 Ga0070691_10112944 Ga0070691_101129441 198
60 3300005343 Ga0070687_100035626 Ga0070687_1000356263 198
61 3300005344 Ga0070661_100265326 Ga0070661_1002653262 198
62 3300005347 Ga0070668_100000783 Ga0070668_1000007834 198
63 3300005347 Ga0070668_100003719 Ga0070668_1000037192 198
64 3300005353 Ga0070669_100014426 Ga0070669_1000144263 198
65 3300005354 Ga0070675_100066497 Ga0070675_1000664972 198
66 3300005354 Ga0070675_100801020 Ga0070675_1008010201 198
67 3300005355 Ga0070671_100044151 Ga0070671_1000441514 198
68 3300005355 Ga0070671_100057274 Ga0070671_1000572745 198
69 3300005355 Ga0070671_100077328 Ga0070671_1000773281 198
70 3300005356 Ga0070674_100022230 Ga0070674_1000222302 198
71 3300005356 Ga0070674_100023965 Ga0070674_1000239653 198
72 3300005364 Ga0070673_100313043 Ga0070673_1003130432 198
73 3300005364 Ga0070673_100343493 Ga0070673_1003434932 198
74 3300005364 Ga0070673_100408529 Ga0070673_1004085292 198
75 3300005365 Ga0070688_100137511 Ga0070688_1001375112 198
76 3300005366 Ga0070659_100066066 Ga0070659_1000660662 198
77 3300005367 Ga0070667_100000073 Ga0070667_10000007362 198
78 3300005367 Ga0070667_100009799 Ga0070667_1000097998 198
79 3300005367 Ga0070667_100111654 Ga0070667_1001116543 198
80 3300005367 Ga0070667_100489512 Ga0070667_1004895122 198
81 3300005406 Ga0070703_10056619 Ga0070703_100566192 198
82 3300005434 Ga0070709_10073864 Ga0070709_100738643 198
83 3300005434 Ga0070709_10095111 Ga0070709_100951113 198
84 3300005435 Ga0070714_100021043 Ga0070714_1000210433 198
85 3300005437 Ga0070710_10009560 Ga0070710_100095603 198
86 3300005437 Ga0070710_10055578 Ga0070710_100555783 198
87 3300005438 Ga0070701_10022390 Ga0070701_100223903 198
88 3300005439 Ga0070711_100061683 Ga0070711_1000616832 198
89 3300005440 Ga0070705_100088457 Ga0070705_1000884572 198
90 3300005441 Ga0070700_100078182 Ga0070700_1000781823 198
91 3300005444 Ga0070694_100018878 Ga0070694_1000188785 198
92 3300005444 Ga0070694_100262384 Ga0070694_1002623842 198
93 3300005445 Ga0070708_100852835 Ga0070708_1008528351 198
94 3300005455 Ga0070663_100019188 Ga0070663_1000191883 198
95 3300005455 Ga0070663_100238170 Ga0070663_1002381702 198
96 3300005455 Ga0070663_100294216 Ga0070663_1002942162 198
97 3300005456 Ga0070678_100000501 Ga0070678_10000050114 198
98 3300005456 Ga0070678_100094977 Ga0070678_1000949771 198
99 3300005457 Ga0070662_100075466 Ga0070662_1000754664 198
100 3300005459 Ga0068867_100074364 Ga0068867_1000743641 198
101 3300005459 Ga0068867_100188205 Ga0068867_1001882053 198
102 3300005466 Ga0070685_10057168 Ga0070685_100571682 198
103 3300005466 Ga0070685_10097165 Ga0070685_100971652 198
104 3300005466 Ga0070685_10252116 Ga0070685_102521162 198
105 3300005539 Ga0068853_100514628 Ga0068853_1005146281 198
106 3300005539 Ga0068853_100692348 Ga0068853_1006923481 198
107 3300005545 Ga0070695_100001861 Ga0070695_1000018616 198
108 3300005545 Ga0070695_100354725 Ga0070695_1003547252 198
109 3300005546 Ga0070696_100312646 Ga0070696_1003126462 198
110 3300005546 Ga0070696_100536246 Ga0070696_1005362461 198
111 3300005547 Ga0070693_100010072 Ga0070693_1000100723 198
112 3300005547 Ga0070693_100097421 Ga0070693_1000974212 198
113 3300005548 Ga0070665_100010228 Ga0070665_1000102285 198
114 3300005548 Ga0070665_100061435 Ga0070665_1000614355 198
115 3300005548 Ga0070665_100111578 Ga0070665_1001115783 198
116 3300005549 Ga0070704_100333206 Ga0070704_1003332062 198
117 3300005563 Ga0068855_100424022 Ga0068855_1004240222 198
118 3300005563 Ga0068855_101037312 Ga0068855_1010373122 198
119 3300005564 Ga0070664_100241320 Ga0070664_1002413202 198
120 3300005578 Ga0068854_100002504 Ga0068854_1000025047 198
121 3300005578 Ga0068854_100024955 Ga0068854_1000249558 198
122 3300005615 Ga0070702_100020309 Ga0070702_1000203092 198
123 3300005616 Ga0068852_100155991 Ga0068852_1001559912 198
124 3300005616 Ga0068852_100157472 Ga0068852_1001574723 198
125 3300005617 Ga0068859_100000223 Ga0068859_10000022318 198
126 3300005617 Ga0068859_100008823 Ga0068859_1000088239 198
127 3300005617 Ga0068859_100113717 Ga0068859_1001137173 198
128 3300005618 Ga0068864_100314231 Ga0068864_1003142312 198
129 3300005718 Ga0068866_10001113 Ga0068866_100011137 198
130 3300005718 Ga0068866_10074122 Ga0068866_100741222 198
131 3300005719 Ga0068861_100002059 Ga0068861_1000020594 198
132 3300005719 Ga0068861_100073442 Ga0068861_1000734424 198
133 3300005841 Ga0068863_100001282 Ga0068863_10000128222 198
134 3300005841 Ga0068863_100003966 Ga0068863_1000039666 198
135 3300005841 Ga0068863_100183668 Ga0068863_1001836683 198
136 3300005842 Ga0068858_100011570 Ga0068858_10001157011 198
137 3300005842 Ga0068858_100015499 Ga0068858_1000154996 198
138 3300005842 Ga0068858_100805532 Ga0068858_1008055321 198
139 3300005843 Ga0068860_100000127 Ga0068860_10000012763 198
140 3300005843 Ga0068860_100008110 Ga0068860_1000081108 198
141 3300005843 Ga0068860_100072044 Ga0068860_1000720441 198
142 3300005843 Ga0068860_100140177 Ga0068860_1001401773 198
143 3300005844 Ga0068862_100000052 Ga0068862_10000005278 198
144 3300005844 Ga0068862_100028247 Ga0068862_1000282476 198
145 3300005844 Ga0068862_100073627 Ga0068862_1000736273 198
146 3300005937 Ga0081455_10013790 Ga0081455_100137908 198
147 3300006038 Ga0075365_10085563 Ga0075365_100855632 198
148 3300006038 Ga0075365_10089023 Ga0075365_100890233 198
149 3300006038 Ga0075365_10134475 Ga0075365_101344753 198
150 3300006048 Ga0075363_100006604 Ga0075363_1000066047 198
151 3300006048 Ga0075363_100013738 Ga0075363_1000137384 198
152 3300006048 Ga0075363_100023622 Ga0075363_1000236223 198
153 3300006048 Ga0075363_100056693 Ga0075363_1000566931 198
154 3300006048 Ga0075363_100065906 Ga0075363_1000659062 198
155 3300006048 Ga0075363_100071350 Ga0075363_1000713502 198
156 3300006048 Ga0075363_100095308 Ga0075363_1000953082 198
157 3300006048 Ga0075363_100299646 Ga0075363_1002996462 198
158 3300006048 Ga0075363_100365128 Ga0075363_1003651282 198
159 3300006051 Ga0075364_10005662 Ga0075364_100056627 198
160 3300006051 Ga0075364_10007711 Ga0075364_100077113 198
161 3300006051 Ga0075364_10020279 Ga0075364_100202796 198
162 3300006051 Ga0075364_10031438 Ga0075364_100314385 198
163 3300006051 Ga0075364_10045093 Ga0075364_100450932 198
164 3300006051 Ga0075364_10137128 Ga0075364_101371282 198
165 3300006173 Ga0070716_100014974 Ga0070716_1000149744 198
166 3300006175 Ga0070712_100019330 Ga0070712_1000193303 198
167 3300006175 Ga0070712_100048619 Ga0070712_1000486191 198
168 3300006177 Ga0075362_10050307 Ga0075362_100503072 198
169 3300006177 Ga0075362_10066849 Ga0075362_100668492 198
170 3300006177 Ga0075362_10221904 Ga0075362_102219042 198
171 3300006178 Ga0075367_10028997 Ga0075367_100289973 198
172 3300006178 Ga0075367_10054198 Ga0075367_100541982 198
173 3300006178 Ga0075367_10125645 Ga0075367_101256453 198
174 3300006186 Ga0075369_10004739 Ga0075369_100047392 198
175 3300006186 Ga0075369_10008590 Ga0075369_100085902 198
176 3300006186 Ga0075369_10085012 Ga0075369_100850122 198
177 3300006186 Ga0075369_10158723 Ga0075369_101587232 198
178 3300006195 Ga0075366_10236581 Ga0075366_102365811 198
179 3300006353 Ga0075370_10001453 Ga0075370_100014538 198
180 3300006353 Ga0075370_10019258 Ga0075370_100192581 198
181 3300006353 Ga0075370_10021785 Ga0075370_100217853 198
182 3300006353 Ga0075370_10155733 Ga0075370_101557331 198
183 3300006353 Ga0075370_10205736 Ga0075370_102057362 198
184 3300006844 Ga0075428_100005457 Ga0075428_1000054573 198
185 3300006846 Ga0075430_100455820 Ga0075430_1004558201 198
186 3300006847 Ga0075431_100174664 Ga0075431_1001746642 198
187 3300006881 Ga0068865_100033143 Ga0068865_1000331434 198
188 3300006931 Ga0097620_100000223 Ga0097620_10000022318 198
189 3300006931 Ga0097620_100008823 Ga0097620_1000088239 198
190 3300006931 Ga0097620_100113717 Ga0097620_1001137173 198
191 3300007076 Ga0075435_101079922 Ga0075435_1010799221 198
192 3300009094 Ga0111539_10256005 Ga0111539_102560052 198
193 3300009098 Ga0105245_10739475 Ga0105245_107394751 198
194 3300009098 Ga0105245_10812132 Ga0105245_108121322 198
195 3300009101 Ga0105247_10000066 Ga0105247_1000006652 198
196 3300009101 Ga0105247_10071029 Ga0105247_100710293 198
197 3300009101 Ga0105247_10075075 Ga0105247_100750752 198
198 3300009147 Ga0114129_10077725 Ga0114129_100777254 198
199 3300009148 Ga0105243_10005180 Ga0105243_100051806 198
200 3300009148 Ga0105243_10158367 Ga0105243_101583673 198
201 3300009174 Ga0105241_10596877 Ga0105241_105968771 198
202 3300009176 Ga0105242_10001265 Ga0105242_100012656 198
203 3300009176 Ga0105242_10553813 Ga0105242_105538131 198
204 3300009177 Ga0105248_10000144 Ga0105248_1000014418 198
205 3300009177 Ga0105248_10025545 Ga0105248_100255457 198
206 3300009177 Ga0105248_10594467 Ga0105248_105944672 198
207 3300009545 Ga0105237_10233829 Ga0105237_102338292 198
208 3300009545 Ga0105237_10366623 Ga0105237_103666232 198
209 3300009545 Ga0105237_10785112 Ga0105237_107851122 198
210 3300009551 Ga0105238_10195401 Ga0105238_101954013 198
211 3300009553 Ga0105249_10000093 Ga0105249_1000009353 198
212 3300009553 Ga0105249_10010343 Ga0105249_1001034311 198
213 3300009553 Ga0105249_10017377 Ga0105249_100173775 198
214 3300009553 Ga0105249_10067733 Ga0105249_100677334 198
215 3300009553 Ga0105249_10784709 Ga0105249_107847092 198
216 3300010159 Ga0099796_10087690 Ga0099796_100876902 198
217 3300010375 Ga0105239_10065105 Ga0105239_100651052 198
218 3300010375 Ga0105239_10083690 Ga0105239_100836904 198
219 3300010375 Ga0105239_10098380 Ga0105239_100983805 198
220 3300011119 Ga0105246_10008144 Ga0105246_100081446 198
221 3300013105 Ga0157369_10784791 Ga0157369_107847911 198
222 3300013296 Ga0157374_10138778 Ga0157374_101387783 198
223 3300013296 Ga0157374_10510725 Ga0157374_105107251 198
224 3300013297 Ga0157378_10005801 Ga0157378_100058017 198
225 3300013297 Ga0157378_10043286 Ga0157378_100432863 198
226 3300013306 Ga0163162_10083823 Ga0163162_100838232 198
227 3300013306 Ga0163162_10157947 Ga0163162_101579473 198
228 3300013306 Ga0163162_10312469 Ga0163162_103124692 198
229 3300013306 Ga0163162_10351783 Ga0163162_103517832 198
230 3300013306 Ga0163162_10565186 Ga0163162_105651863 198
231 3300013307 Ga0157372_10023638 Ga0157372_100236382 198
232 3300013307 Ga0157372_10597592 Ga0157372_105975921 198
233 3300013308 Ga0157375_10021798 Ga0157375_100217986 198
234 3300013308 Ga0157375_10033105 Ga0157375_100331055 198
235 3300013308 Ga0157375_10485297 Ga0157375_104852973 198
236 3300014325 Ga0163163_10077208 Ga0163163_100772084 198
237 3300014325 Ga0163163_10123874 Ga0163163_101238745 198
238 3300014326 Ga0157380_10004282 Ga0157380_1000428211 198
239 3300014326 Ga0157380_10533748 Ga0157380_105337482 198
240 3300014497 Ga0182008_10061117 Ga0182008_100611173 198
241 3300014968 Ga0157379_10016326 Ga0157379_100163266 198
242 3300014968 Ga0157379_10025675 Ga0157379_100256755 198
243 3300017792 Ga0163161_10015015 Ga0163161_100150155 198
244 3300017792 Ga0163161_10026591 Ga0163161_100265915 198
245 3300017792 Ga0163161_10143081 Ga0163161_101430811 198
246 3300021384 Ga0213876_10313239 Ga0213876_103132391 198
247 3300025885 Ga0207653_10023312 Ga0207653_100233122 198
248 3300025898 Ga0207692_10066928 Ga0207692_100669282 198
249 3300025899 Ga0207642_10000575 Ga0207642_1000057511 198
250 3300025899 Ga0207642_10116703 Ga0207642_101167032 198
251 3300025900 Ga0207710_10000090 Ga0207710_1000009052 198
252 3300025900 Ga0207710_10011885 Ga0207710_100118853 198
253 3300025900 Ga0207710_10072953 Ga0207710_100729532 198
254 3300025901 Ga0207688_10140344 Ga0207688_101403443 198
255 3300025904 Ga0207647_10070846 Ga0207647_100708462 198
256 3300025906 Ga0207699_10067524 Ga0207699_100675243 198
257 3300025906 Ga0207699_10293131 Ga0207699_102931312 198
258 3300025907 Ga0207645_10055165 Ga0207645_100551653 198
259 3300025907 Ga0207645_10088521 Ga0207645_100885211 198
260 3300025914 Ga0207671_10385702 Ga0207671_103857022 198
261 3300025915 Ga0207693_10000428 Ga0207693_1000042831 198
262 3300025915 Ga0207693_10003739 Ga0207693_1000373913 198
263 3300025916 Ga0207663_10461405 Ga0207663_104614051 198
264 3300025916 Ga0207663_10578995 Ga0207663_105789952 198
265 3300025917 Ga0207660_10067205 Ga0207660_100672052 198
266 3300025918 Ga0207662_10106023 Ga0207662_101060231 198
267 3300025919 Ga0207657_10110869 Ga0207657_101108693 198
268 3300025920 Ga0207649_10192964 Ga0207649_101929642 198
269 3300025923 Ga0207681_10009333 Ga0207681_100093335 198
270 3300025923 Ga0207681_10023815 Ga0207681_100238155 198
271 3300025924 Ga0207694_10091957 Ga0207694_100919572 198
272 3300025926 Ga0207659_10053405 Ga0207659_100534054 198
273 3300025926 Ga0207659_10710127 Ga0207659_107101271 198
274 3300025927 Ga0207687_10012498 Ga0207687_100124988 198
275 3300025927 Ga0207687_10135411 Ga0207687_101354113 198
276 3300025931 Ga0207644_10069103 Ga0207644_100691034 198
277 3300025931 Ga0207644_10538101 Ga0207644_105381012 198
278 3300025932 Ga0207690_10022015 Ga0207690_100220155 198
279 3300025932 Ga0207690_10045255 Ga0207690_100452554 198
280 3300025933 Ga0207706_10001922 Ga0207706_100019222 198
281 3300025933 Ga0207706_10005781 Ga0207706_100057817 198
282 3300025934 Ga0207686_10010548 Ga0207686_100105486 198
283 3300025935 Ga0207709_10002942 Ga0207709_100029425 198
284 3300025935 Ga0207709_10084979 Ga0207709_100849794 198
285 3300025935 Ga0207709_10092748 Ga0207709_100927483 198
286 3300025936 Ga0207670_10050743 Ga0207670_100507433 198
287 3300025936 Ga0207670_10245607 Ga0207670_102456072 198
288 3300025937 Ga0207669_10001292 Ga0207669_100012927 198
289 3300025938 Ga0207704_10005436 Ga0207704_100054368 198
290 3300025939 Ga0207665_10008506 Ga0207665_100085067 198
291 3300025939 Ga0207665_10018260 Ga0207665_100182602 198
292 3300025940 Ga0207691_10113196 Ga0207691_101131963 198
293 3300025941 Ga0207711_10000183 Ga0207711_1000018363 198
294 3300025944 Ga0207661_10354693 Ga0207661_103546932 198
295 3300025949 Ga0207667_11018917 Ga0207667_110189172 198
296 3300025960 Ga0207651_10607915 Ga0207651_106079151 198
297 3300025961 Ga0207712_10000073 Ga0207712_1000007353 198
298 3300025961 Ga0207712_10030405 Ga0207712_100304054 198
299 3300025961 Ga0207712_10428225 Ga0207712_104282251 198
300 3300025972 Ga0207668_10000804 Ga0207668_1000080416 198
301 3300025972 Ga0207668_10005657 Ga0207668_100056574 198
302 3300025972 Ga0207668_10225298 Ga0207668_102252982 198
303 3300025972 Ga0207668_10438795 Ga0207668_104387951 198
304 3300025981 Ga0207640_10127817 Ga0207640_101278171 198
305 3300025981 Ga0207640_10175390 Ga0207640_101753902 198
306 3300025981 Ga0207640_11131171 Ga0207640_111311711 198
307 3300025986 Ga0207658_10000304 Ga0207658_1000030422 198
308 3300025986 Ga0207658_10008729 Ga0207658_100087296 198
309 3300025986 Ga0207658_10336223 Ga0207658_103362232 198
310 3300025986 Ga0207658_10350038 Ga0207658_103500382 198
311 3300025986 Ga0207658_10617685 Ga0207658_106176851 198
312 3300026023 Ga0207677_10020820 Ga0207677_100208205 198
313 3300026023 Ga0207677_10025297 Ga0207677_100252974 198
314 3300026035 Ga0207703_10016203 Ga0207703_100162035 198
315 3300026035 Ga0207703_10034314 Ga0207703_100343144 198
316 3300026035 Ga0207703_11169748 Ga0207703_111697482 198
317 3300026067 Ga0207678_10017856 Ga0207678_100178565 198
318 3300026067 Ga0207678_10159080 Ga0207678_101590803 198
319 3300026067 Ga0207678_10396601 Ga0207678_103966011 198
320 3300026075 Ga0207708_10001568 Ga0207708_1000156813 198
321 3300026075 Ga0207708_10027129 Ga0207708_100271292 198
322 3300026088 Ga0207641_10000413 Ga0207641_100004136 198
323 3300026088 Ga0207641_10027640 Ga0207641_100276403 198
324 3300026088 Ga0207641_10174931 Ga0207641_101749312 198
325 3300026089 Ga0207648_10017088 Ga0207648_100170886 198
326 3300026089 Ga0207648_10028388 Ga0207648_100283882 198
327 3300026095 Ga0207676_10833429 Ga0207676_108334292 198
328 3300026118 Ga0207675_100000876 Ga0207675_10000087630 198
329 3300026118 Ga0207675_100021869 Ga0207675_1000218693 198
330 3300026118 Ga0207675_100244324 Ga0207675_1002443243 198
331 3300026121 Ga0207683_10001137 Ga0207683_1000113725 198
332 3300026142 Ga0207698_10091578 Ga0207698_100915782 198
333 3300026142 Ga0207698_10116832 Ga0207698_101168322 198
334 3300027907 Ga0207428_10588650 Ga0207428_105886501 198
335 3300028379 Ga0268266_10052494 Ga0268266_100524941 198
336 3300028379 Ga0268266_10082887 Ga0268266_100828873 198
337 3300028379 Ga0268266_10108114 Ga0268266_101081142 198
338 3300028380 Ga0268265_10000063 Ga0268265_1000006378 198
339 3300028380 Ga0268265_10270093 Ga0268265_102700932 198
340 3300028381 Ga0268264_10000007 Ga0268264_1000000763 198
341 3300028381 Ga0268264_10022353 Ga0268264_100223531 198
342 3300028381 Ga0268264_10119260 Ga0268264_101192603 198
343 3300031852 Ga0307410_10523279 Ga0307410_105232791 198
344 3300031901 Ga0307406_10067866 Ga0307406_100678662 198
345 3300035241 Ga0373961_0162226 Ga0373961_0162226_10_669 198
346 3300035691 Ga0373931_0120332 Ga0373931_0120332_44_703 198
347 3300037853 Ga0436364_0218929 Ga0436364_0218929_6010_6606 198
348 3300039437 Ga0436365_1302860 Ga0436365_1302860_36_632 198
349 3300039437 Ga0436365_1319574 Ga0436365_1319574_1707_2318 198
350 3300041410 Ga0439461_0025583 Ga0439461_0025583_23_661 198
351 3300041411 Ga0439466_0012644 Ga0439466_0012644_2326_2964 198
352 3300041411 Ga0439466_0018266 Ga0439466_0018266_1207_1881 198
353 3300041413 Ga0439465_0127072 Ga0439465_0127072_83_757 198
354 3300041511 Ga0451855_1772296 Ga0451855_1772296_239_895 198
355 3300041997 Ga0439431_0144666 Ga0439431_0144666_23_661 198
356 3300042004 Ga0439445_0013044 Ga0439445_0013044_580_1254 198
357 3300042005 Ga0439448_0063764 Ga0439448_0063764_374_1012 198
358 3300042435 Ga0439434_0024358 Ga0439434_0024358_573_1247 198
359 3300042435 Ga0439434_0071524 Ga0439434_0071524_334_972 198
360 3300044658 Ga0466972_0025438 Ga0466972_0025438_329_967 198
361 3300044735 Ga0466968_0201137 Ga0466968_0201137_91_729 198
362 3300044842 Ga0466957_0026915 Ga0466957_0026915_1914_2552 198
363 3300044901 Ga0466960_0018037 Ga0466960_0018037_1844_2482 198
364 3300045976 Ga0466967_0007445 Ga0466967_0007445_5281_5919 198
365 3300046455 Ga0495603_0265882 Ga0495603_0265882_44_664 198
366 3300046459 Ga0495629_0011744 Ga0495629_0011744_217_837 198
367 3300046460 Ga0495638_0001056 Ga0495638_0001056_14023_14643 198
368 3300046463 Ga0495653_0031275 Ga0495653_0031275_542_1156 198
369 3300046473 Ga0495582_0064233 Ga0495582_0064233_736_1356 198
370 3300046476 Ga0495662_0367136 Ga0495662_0367136_22_642 198
371 3300046506 Ga0495583_0248818 Ga0495583_0248818_29_655 198
372 3300046517 Ga0495630_0114797 Ga0495630_0114797_635_1249 198
373 3300046531 Ga0495665_0355783 Ga0495665_0355783_73_693 198
374 3300046533 Ga0495640_0095527 Ga0495640_0095527_860_1480 198
375 3300046535 Ga0495586_0305544 Ga0495586_0305544_237_857 198
376 3300046559 Ga0495667_0151162 Ga0495667_0151162_561_1181 198
377 3300046616 Ga0495668_0118527 Ga0495668_0118527_167_787 198
378 3300046660 Ga0495625_0204006 Ga0495625_0204006_75_695 198
379 3300046675 Ga0495657_0090627 Ga0495657_0090627_919_1533 198
380 3300046694 Ga0495649_0045101 Ga0495649_0045101_1687_2307 198
381 3300046809 Ga0495600_0103642 Ga0495600_0103642_480_1094 198
382 3300046810 Ga0495660_0263985 Ga0495660_0263985_108_764 198
383 3300047315 Ga0495581_0067137 Ga0495581_0067137_430_1050 198
384 3300047317 Ga0495604_0167185 Ga0495604_0167185_760_1380 198
385 3300047319 Ga0495674_0153209 Ga0495674_0153209_1065_1685 198
386 3300047320 Ga0495672_0021028 Ga0495672_0021028_2374_3012 198
387 3300047320 Ga0495672_0119899 Ga0495672_0119899_379_1005 198
388 3300048903 Ga0496100_0025472 Ga0496100_0025472_2367_3077 198
389 3300048903 Ga0496100_0101067 Ga0496100_0101067_1105_1755 198
390 3300048904 Ga0496101_0007372 Ga0496101_0007372_5696_6346 198
391 3300048904 Ga0496101_0273729 Ga0496101_0273729_309_1019 198
392 3300048905 Ga0496102_0000168 Ga0496102_0000168_57846_58466 198
393 3300048905 Ga0496102_0001819 Ga0496102_0001819_10647_11357 198
394 3300048905 Ga0496102_0055058 Ga0496102_0055058_2919_3587 198
395 3300048905 Ga0496102_0576384 Ga0496102_0576384_267_905 198
396 3300048906 Ga0496103_0000550 Ga0496103_0000550_12203_12823 198
397 3300048906 Ga0496103_0002065 Ga0496103_0002065_4682_5392 198
398 3300048907 Ga0496104_0589941 Ga0496104_0589941_11_670 198
399 3300048908 Ga0496105_0181249 Ga0496105_0181249_46_684 198
400 3300048908 Ga0496105_0262294 Ga0496105_0262294_707_1366 198
401 3300048909 Ga0496106_0017361 Ga0496106_0017361_261_971 198
402 3300048909 Ga0496106_0051295 Ga0496106_0051295_664_1323 198
403 3300048909 Ga0496106_0115196 Ga0496106_0115196_105_755 198
404 3300048909 Ga0496106_0759995 Ga0496106_0759995_23_679 198
405 3300048910 Ga0496107_0015968 Ga0496107_0015968_148_858 198
406 3300048910 Ga0496107_0032518 Ga0496107_0032518_2836_3486 198
407 3300048910 Ga0496107_0309520 Ga0496107_0309520_324_980 198
408 3300048910 Ga0496107_0434793 Ga0496107_0434793_294_953 198
409 3300048911 Ga0496108_0000223 Ga0496108_0000223_32016_32675 198
410 3300048911 Ga0496108_0067427 Ga0496108_0067427_2106_2762 198
411 3300048912 Ga0496109_0020947 Ga0496109_0020947_31_690 198
412 3300048912 Ga0496109_0060320 Ga0496109_0060320_1545_2201 198
413 3300048912 Ga0496109_0808242 Ga0496109_0808242_24_692 198
414 3300048913 Ga0496110_0171341 Ga0496110_0171341_1072_1728 198
415 3300048913 Ga0496110_0640225 Ga0496110_0640225_283_942 198
416 3300048915 Ga0496112_0004133 Ga0496112_0004133_7272_7910 198
417 3300048915 Ga0496112_0024856 Ga0496112_0024856_4753_5409 198
418 3300048916 Ga0496113_0033773 Ga0496113_0033773_2815_3453 198
419 3300048916 Ga0496113_0049411 Ga0496113_0049411_1816_2472 198
420 3300048916 Ga0496113_0068065 Ga0496113_0068065_43_702 198
421 3300048917 Ga0496114_0018865 Ga0496114_0018865_2291_3001 198
422 3300048917 Ga0496114_0057404 Ga0496114_0057404_1388_2047 198
423 3300048918 Ga0496115_0604152 Ga0496115_0604152_29_685 198
424 3300048920 Ga0496117_0000869 Ga0496117_0000869_30078_30698 198
425 3300048921 Ga0496118_0000171 Ga0496118_0000171_40394_41014 198
426 3300048922 Ga0496119_0017669 Ga0496119_0017669_495_1115 198
427 3300048924 Ga0496121_0013171 Ga0496121_0013171_6678_7328 198
428 3300048927 Ga0496124_0084821 Ga0496124_0084821_1818_2438 198
429 3300048928 Ga0496125_0020492 Ga0496125_0020492_3757_4407 198
430 3300048929 Ga0496126_0005442 Ga0496126_0005442_5720_6370 198
431 3300049586 Ga0501070_0490708 Ga0501070_0490708_215_835 198
432 3300049742 Ga0501080_0145210 Ga0501080_0145210_1115_1735 198
433 3300050490 nmdc:mga03n38_13639_c1 nmdc:mga03n38_13639_c1_1019_1636 198
434 3300050490 nmdc:mga03n38_26817_c1 nmdc:mga03n38_26817_c1_666_1283 198
435 3300050490 nmdc:mga03n38_44530_c1 nmdc:mga03n38_44530_c1_397_1035 198
436 3300050490 nmdc:mga03n38_7596_c1 nmdc:mga03n38_7596_c1_2576_3232 198
437 3300050491 nmdc:mga00v17_141698_c1 nmdc:mga00v17_141698_c1_395_1012 198
438 3300050491 nmdc:mga00v17_147144_c1 nmdc:mga00v17_147144_c1_361_996 198
439 3300050491 nmdc:mga00v17_21928_c1 nmdc:mga00v17_21928_c1_1729_2346 198
440 3300050491 nmdc:mga00v17_2306_c1 nmdc:mga00v17_2306_c1_2855_3523 198
441 3300050491 nmdc:mga00v17_260_c1 nmdc:mga00v17_260_c1_29502_30140 198
442 3300050491 nmdc:mga00v17_432888_c1 nmdc:mga00v17_432888_c1_193_831 198
443 3300050492 nmdc:mga0yw44_130684_c1 nmdc:mga0yw44_130684_c1_678_1346 198
444 3300050492 nmdc:mga0yw44_211674_c1 nmdc:mga0yw44_211674_c1_528_1151 198
445 3300050492 nmdc:mga0yw44_33275_c1 nmdc:mga0yw44_33275_c1_1515_2162 198
446 3300050492 nmdc:mga0yw44_67901_c1 nmdc:mga0yw44_67901_c1_288_926 198
447 3300050493 nmdc:mga0k408_111190_c1 nmdc:mga0k408_111190_c1_484_1122 198
448 3300050494 nmdc:mga06z11_139089_c1 nmdc:mga06z11_139089_c1_20_640 198
449 3300050494 nmdc:mga06z11_145050_c1 nmdc:mga06z11_145050_c1_444_1082 198
450 3300050494 nmdc:mga06z11_17661_c1 nmdc:mga06z11_17661_c1_776_1393 198
451 3300050494 nmdc:mga06z11_202363_c1 nmdc:mga06z11_202363_c1_314_952 198
452 3300050496 nmdc:mga07m45_205785_c1 nmdc:mga07m45_205785_c1_512_1135 198
453 3300050496 nmdc:mga07m45_211266_c1 nmdc:mga07m45_211266_c1_322_960 198
454 3300050496 nmdc:mga07m45_38224_c1 nmdc:mga07m45_38224_c1_556_1173 198
455 3300050507 nmdc:mga05p37_1121643_c1 nmdc:mga05p37_1121643_c1_144_782 198
456 3300050507 nmdc:mga05p37_214516_c1 nmdc:mga05p37_214516_c1_337_975 198
457 3300050509 nmdc:mga0qj67_472924_c1 nmdc:mga0qj67_472924_c1_104_742 198
458 3300050510 nmdc:mga06r32_161127_c1 nmdc:mga06r32_161127_c1_1175_1813 198
459 3300050511 nmdc:mga08y16_859511_c1 nmdc:mga08y16_859511_c1_111_767 198
460 3300050516 nmdc:mga0sz30_18694_c1 nmdc:mga0sz30_18694_c1_294_932 198
461 3300050516 nmdc:mga0sz30_1955_c1 nmdc:mga0sz30_1955_c1_4755_5393 198
462 3300050516 nmdc:mga0sz30_223918_c1 nmdc:mga0sz30_223918_c1_180_818 198
463 3300053083 Ga0495655_0009755 Ga0495655_0009755_1110_1766 198
464 3300053084 Ga0495595_0085128 Ga0495595_0085128_859_1473 198
465 3300053104 Ga0500556_0018092 Ga0500556_0018092_1264_1884 198
466 3300053108 Ga0500562_012179 Ga0500562_012179_227_847 198
467 3300053139 Ga0500568_0081606 Ga0500568_0081606_304_924 198
468 3300053151 Ga0500604_0069518 Ga0500604_0069518_466_1086 198
469 3300053158 Ga0500627_0068059 Ga0500627_0068059_425_1045 198
470 3300053727 Ga0500611_053902 Ga0500611_053902_94_714 198
471 3300061734 Ga0530510_0056351 Ga0530510_0056351_191_841 198
472 iso_pu_bacteria 2929212328 2929216723 198
473 3300005435 Ga0070714_100836877 Ga0070714_1008368771 199
474 3300044765 Ga0466970_0060060 Ga0466970_0060060_1401_2006 199
475 3300039437 Ga0436365_1352201 Ga0436365_1352201_2601_3284 200
476 3300039437 Ga0436365_0464410 Ga0436365_0464410_4498_5106 202
477 3300046507 Ga0495606_0354595 Ga0495606_0354595_35_643 202
478 iso_pu_bacteria 2738541274 2738705743 202
479 iso_pu_bacteria 2738543028 2739330233 202
480 iso_pu_bacteria 2902799365 2902800084 202
481 3300006038 Ga0075365_10049552 Ga0075365_100495523 203
482 3300006051 Ga0075364_10110545 Ga0075364_101105453 203
483 3300006186 Ga0075369_10256327 Ga0075369_102563271 203
484 3300026041 Ga0207639_10016205 Ga0207639_100162054 203
485 3300044656 Ga0466969_0088649 Ga0466969_0088649_595_1206 203
486 3300044684 Ga0466966_0008407 Ga0466966_0008407_312_923 203
487 3300044693 Ga0466961_0005701 Ga0466961_0005701_6881_7492 203
488 3300044694 Ga0466963_0041783 Ga0466963_0041783_775_1452 203
489 3300044735 Ga0466968_0043155 Ga0466968_0043155_1205_1816 203
490 3300044842 Ga0466957_0006255 Ga0466957_0006255_5654_6265 203
491 3300045049 Ga0466959_0003108 Ga0466959_0003108_2553_3164 203
492 3300045836 Ga0466958_0000569 Ga0466958_0000569_7984_8595 203
493 3300047472 Ga0495686_0038665 Ga0495686_0038665_2100_2711 203
494 3300047472 Ga0495686_0125386 Ga0495686_0125386_503_1114 203
495 3300050492 nmdc:mga0yw44_57308_c1 nmdc:mga0yw44_57308_c1_342_953 203
496 3300053087 Ga0500643_001380 Ga0500643_001380_5370_5981 203
497 3300053153 Ga0500616_0007077 Ga0500616_0007077_6133_6744 203
498 3300021384 Ga0213876_10006661 Ga0213876_100066616 204
499 3300039437 Ga0436365_1765865 Ga0436365_1765865_8298_8999 204
500 3300005335 Ga0070666_10200190 Ga0070666_102001903 205
501 3300005356 Ga0070674_100015666 Ga0070674_1000156663 205
502 3300005466 Ga0070685_10110263 Ga0070685_101102632 205
503 3300009177 Ga0105248_10286967 Ga0105248_102869672 205
504 3300014968 Ga0157379_10077493 Ga0157379_100774933 205
505 3300025903 Ga0207680_10505033 Ga0207680_105050331 205
506 3300025937 Ga0207669_10019081 Ga0207669_100190813 205
507 3300025941 Ga0207711_10243986 Ga0207711_102439862 205
508 3300044901 Ga0466960_0000688 Ga0466960_0000688_4091_4714 205
509 3300048903 Ga0496100_0005502 Ga0496100_0005502_5060_5755 205
510 3300048904 Ga0496101_0004333 Ga0496101_0004333_6178_6873 205
511 3300048907 Ga0496104_0001250 Ga0496104_0001250_2291_2986 205
512 3300048908 Ga0496105_0025816 Ga0496105_0025816_2957_3652 205
513 3300048909 Ga0496106_0001250 Ga0496106_0001250_9051_9746 205
514 3300048910 Ga0496107_0000831 Ga0496107_0000831_574_1269 205
515 3300048912 Ga0496109_0353927 Ga0496109_0353927_758_1375 205
516 3300048917 Ga0496114_0000320 Ga0496114_0000320_14927_15622 205
517 3300048918 Ga0496115_0008280 Ga0496115_0008280_3019_3714 205
518 3300000546 LJNas_1002176 LJNas_10021763 206
519 3300005435 Ga0070714_100668797 Ga0070714_1006687971 206
520 3300006038 Ga0075365_10144935 Ga0075365_101449352 206
521 3300006186 Ga0075369_10001688 Ga0075369_100016884 206
522 3300006186 Ga0075369_10006908 Ga0075369_100069083 206
523 3300021384 Ga0213876_10013586 Ga0213876_100135863 206
524 3300021384 Ga0213876_10050116 Ga0213876_100501162 206
525 3300021388 Ga0213875_10042878 Ga0213875_100428781 206
526 3300025929 Ga0207664_10639054 Ga0207664_106390541 206
527 3300037853 Ga0436364_0559448 Ga0436364_0559448_4924_5625 206
528 3300039437 Ga0436365_0456575 Ga0436365_0456575_27134_27835 206
529 3300041413 Ga0439465_0010197 Ga0439465_0010197_1152_1910 206
530 3300042004 Ga0439445_0002473 Ga0439445_0002473_2625_3383 206
531 3300044658 Ga0466972_0004838 Ga0466972_0004838_3392_4057 206
532 3300044683 Ga0466965_0001888 Ga0466965_0001888_4833_5498 206
533 3300044694 Ga0466963_0015491 Ga0466963_0015491_3078_3797 206
534 3300044694 Ga0466963_0298266 Ga0466963_0298266_217_936 206
535 3300044735 Ga0466968_0000457 Ga0466968_0000457_4764_5429 206
536 3300044765 Ga0466970_0005515 Ga0466970_0005515_2273_2938 206
537 3300044842 Ga0466957_0012416 Ga0466957_0012416_1088_1753 206
538 3300044842 Ga0466957_0013759 Ga0466957_0013759_1684_2403 206
539 3300044901 Ga0466960_0001536 Ga0466960_0001536_5789_6454 206
540 3300044901 Ga0466960_0002878 Ga0466960_0002878_5531_6250 206
541 3300045049 Ga0466959_0018065 Ga0466959_0018065_1811_2476 206
542 3300045836 Ga0466958_0042518 Ga0466958_0042518_101_766 206
543 3300045976 Ga0466967_0060633 Ga0466967_0060633_1510_2229 206
544 3300045976 Ga0466967_0079233 Ga0466967_0079233_43_708 206
545 3300045976 Ga0466967_0229774 Ga0466967_0229774_1019_1738 206
546 3300046460 Ga0495638_0068791 Ga0495638_0068791_1053_1739 206
547 3300046460 Ga0495638_0102273 Ga0495638_0102273_913_1599 206
548 3300046557 Ga0495622_0238536 Ga0495622_0238536_56_742 206
549 3300048903 Ga0496100_0033526 Ga0496100_0033526_2001_2666 206
550 3300048904 Ga0496101_0019605 Ga0496101_0019605_556_1221 206
551 3300048915 Ga0496112_0065410 Ga0496112_0065410_1104_1769 206
552 3300048916 Ga0496113_0016603 Ga0496113_0016603_4128_4793 206
553 3300048918 Ga0496115_0475300 Ga0496115_0475300_29_715 206
554 3300048923 Ga0496120_0094625 Ga0496120_0094625_399_1064 206
555 3300048925 Ga0496122_0036885 Ga0496122_0036885_1787_2452 206
556 3300048926 Ga0496123_0020808 Ga0496123_0020808_2196_2861 206
557 3300048928 Ga0496125_0053441 Ga0496125_0053441_2533_3219 206
558 3300048928 Ga0496125_0219837 Ga0496125_0219837_328_993 206
559 3300048929 Ga0496126_0006823 Ga0496126_0006823_1686_2387 206
560 3300048929 Ga0496126_0025483 Ga0496126_0025483_3461_4126 206
561 3300049570 Ga0501033_0516439 Ga0501033_0516439_56_757 206
562 3300049571 Ga0501034_0005982 Ga0501034_0005982_11361_12080 206
563 3300049571 Ga0501034_0293644 Ga0501034_0293644_449_1186 206
564 3300049572 Ga0501036_0661303 Ga0501036_0661303_31_750 206
565 3300049573 Ga0501037_0044169 Ga0501037_0044169_488_1207 206
566 3300049580 Ga0501046_0003366 Ga0501046_0003366_2827_3546 206
567 3300049581 Ga0501047_0027428 Ga0501047_0027428_1636_2355 206
568 3300049582 Ga0501048_0011970 Ga0501048_0011970_2827_3546 206
569 3300049586 Ga0501070_0001967 Ga0501070_0001967_4585_5304 206
570 3300049822 Ga0501035_0007575 Ga0501035_0007575_2684_3403 206
571 3300049823 Ga0501044_0000935 Ga0501044_0000935_5377_6096 206
572 3300050491 nmdc:mga00v17_85546_c1 nmdc:mga00v17_85546_c1_907_1593 206
573 3300050492 nmdc:mga0yw44_52524_c1 nmdc:mga0yw44_52524_c1_336_1022 206
574 3300050516 nmdc:mga0sz30_27919_c1 nmdc:mga0sz30_27919_c1_1125_1811 206
575 3300050516 nmdc:mga0sz30_28780_c1 nmdc:mga0sz30_28780_c1_782_1468 206
576 3300053087 Ga0500643_030047 Ga0500643_030047_812_1498 206
577 3300053130 Ga0500642_0038329 Ga0500642_0038329_1118_1819 206
578 3300053158 Ga0500627_0019443 Ga0500627_0019443_844_1530 206
579 3300053730 Ga0500645_000007 Ga0500645_000007_22598_23284 206
580 3300053730 Ga0500645_008205 Ga0500645_008205_1660_2346 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

18

64

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8572 14 90
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.7784 14 187
3knw-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.758 15 187
4kwa-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator from saccharomonospora viridis in complex with choline 0.7534 15 187
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.7463 14 187
ID Description Score Start End Superfamily
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9634 14 54 1.10.10.60
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 15 67 1.10.10.60
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9349 13 66 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9331 15 67 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9327 15 67 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2W6VQ08-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9512 15 134 GO:0000976
GO:0003700
AF-X8C4E2-F1-model_v4 deleted 0.9231 18 199
AF-A0A6H0S973-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9032 1 198 GO:0000976
GO:0003700
AF-A0A7I7KWC5-F1-model_v4 TetR family transcriptional regulator 0.9003 1 195 GO:0000976
GO:0003700
AF-A0A1G4V4M9-F1-model_v4 Transcriptional regulator, TetR family 0.9001 26 195 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
86.53 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map