F465987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 580 | 287 | 573 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0229774|Ga0466967_0229774_1019_1738 |
| Length | 239 |
| Sequence | MTSARRIGAPDAKNRVLLLDAAERLMLEEGYAAVTSRRLANKAGLKPQLVHYYFRTMEELFLEVFRRRAEEALEVHAQMLKSPQPLWALWRFGTDPAFTRISMEFMALANHRKEMRAEIAYYAERFRDEQRQAVATALERYGSRIQDEGQDIDIPPVVWTVLMSSLSRFLVLEQAIGMSAGHAETLELVENYLRRLEGEPRPIEGVPDTWIVHQFRSEQSTPLGPSLDTTTAPSTARSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 4 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 5 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 6 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 7 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 8 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 179 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 180 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 181 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 182 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 183 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 184 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 277 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 278 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 282 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 283 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 0 |
| Isolates | 1.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.48 |
| Nodule | 0.17 |
| Rhizoplane | 9.14 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002176 | 3300000546 | Bacteria | 2447 |
| 2 | JGI24746J21847_1016951 | 3300001977 | Bacteria | 1037 |
| 3 | JGI24737J22298_10071779 | 3300001990 | Bacteria | 1033 |
| 4 | JGI24750J21931_1028103 | 3300002070 | Bacteria | 816 |
| 5 | JGI24745J21846_1002207 | 3300002073 | Bacteria | 1968 |
| 6 | JGI24744J21845_10000316 | 3300002077 | Bacteria | 8121 |
| 7 | JGI24744J21845_10023989 | 3300002077 | Bacteria | 1194 |
| 8 | JGI24742J22300_10017465 | 3300002244 | Bacteria | 1213 |
| 9 | JGI24742J22300_10025495 | 3300002244 | Bacteria | 1022 |
| 10 | JGI24751J29686_10030464 | 3300002459 | Bacteria | 1119 |
| 11 | rootH2_10113120 | 3300003320 | Bacteria | 2598 |
| 12 | Ga0070676_10017688 | 3300005328 | Bacteria | 3944 |
| 13 | Ga0068869_100163783 | 3300005334 | Bacteria | 1733 |
| 14 | Ga0070666_10020422 | 3300005335 | Bacteria | 4282 |
| 15 | Ga0070666_10200190 | 3300005335 | Bacteria | 1405 |
| 16 | Ga0070666_10222102 | 3300005335 | Bacteria | 1333 |
| 17 | Ga0070666_10282204 | 3300005335 | Bacteria | 1181 |
| 18 | Ga0070680_100437035 | 3300005336 | Bacteria | 1117 |
| 19 | Ga0070682_100132270 | 3300005337 | Bacteria | 1690 |
| 20 | Ga0070682_100328810 | 3300005337 | Bacteria | 1132 |
| 21 | Ga0068868_100001495 | 3300005338 | Bacteria | 16133 |
| 22 | Ga0068868_100041231 | 3300005338 | Bacteria | 3596 |
| 23 | Ga0070660_100196369 | 3300005339 | Bacteria | 1636 |
| 24 | Ga0070689_100179182 | 3300005340 | Bacteria | 1720 |
| 25 | Ga0070689_100243271 | 3300005340 | Bacteria | 1482 |
| 26 | Ga0070691_10005058 | 3300005341 | Bacteria | 5992 |
| 27 | Ga0070691_10112944 | 3300005341 | Bacteria | 1361 |
| 28 | Ga0070687_100035626 | 3300005343 | Bacteria | 2473 |
| 29 | Ga0070661_100265326 | 3300005344 | Bacteria | 1328 |
| 30 | Ga0070668_100000783 | 3300005347 | Bacteria | 21957 |
| 31 | Ga0070668_100003719 | 3300005347 | Bacteria | 11250 |
| 32 | Ga0070669_100014426 | 3300005353 | Bacteria | 5624 |
| 33 | Ga0070675_100066497 | 3300005354 | Bacteria | 2982 |
| 34 | Ga0070675_100801020 | 3300005354 | Bacteria | 861 |
| 35 | Ga0070671_100044151 | 3300005355 | Bacteria | 3703 |
| 36 | Ga0070671_100057274 | 3300005355 | Bacteria | 3243 |
| 37 | Ga0070671_100077328 | 3300005355 | Bacteria | 2781 |
| 38 | Ga0070674_100015666 | 3300005356 | Bacteria | 4739 |
| 39 | Ga0070674_100022230 | 3300005356 | Bacteria | 4088 |
| 40 | Ga0070674_100023965 | 3300005356 | Bacteria | 3957 |
| 41 | Ga0070673_100313043 | 3300005364 | Bacteria | 1385 |
| 42 | Ga0070673_100343493 | 3300005364 | Bacteria | 1323 |
| 43 | Ga0070673_100408529 | 3300005364 | Bacteria | 1215 |
| 44 | Ga0070688_100137511 | 3300005365 | Bacteria | 1656 |
| 45 | Ga0070659_100066066 | 3300005366 | Bacteria | 2866 |
| 46 | Ga0070667_100000073 | 3300005367 | Bacteria | 122757 |
| 47 | Ga0070667_100009799 | 3300005367 | Bacteria | 7943 |
| 48 | Ga0070667_100111654 | 3300005367 | Bacteria | 2371 |
| 49 | Ga0070667_100489512 | 3300005367 | Bacteria | 1127 |
| 50 | Ga0070703_10056619 | 3300005406 | Bacteria | 1270 |
| 51 | Ga0070709_10073864 | 3300005434 | Bacteria | 2209 |
| 52 | Ga0070709_10095111 | 3300005434 | Bacteria | 1973 |
| 53 | Ga0070714_100021043 | 3300005435 | Bacteria | 5333 |
| 54 | Ga0070714_100668797 | 3300005435 | Bacteria | 1000 |
| 55 | Ga0070714_100836877 | 3300005435 | Bacteria | 892 |
| 56 | Ga0070713_100187948 | 3300005436 | Bacteria | 1860 |
| 57 | Ga0070710_10009560 | 3300005437 | Bacteria | 4747 |
| 58 | Ga0070710_10055578 | 3300005437 | Bacteria | 2238 |
| 59 | Ga0070710_10173321 | 3300005437 | Bacteria | 1346 |
| 60 | Ga0070701_10022390 | 3300005438 | Bacteria | 3029 |
| 61 | Ga0070711_100061683 | 3300005439 | Bacteria | 2611 |
| 62 | Ga0070705_100088457 | 3300005440 | Bacteria | 1923 |
| 63 | Ga0070700_100078182 | 3300005441 | Bacteria | 2129 |
| 64 | Ga0070694_100018878 | 3300005444 | Bacteria | 4381 |
| 65 | Ga0070694_100262384 | 3300005444 | Bacteria | 1311 |
| 66 | Ga0070708_100852835 | 3300005445 | Bacteria | 856 |
| 67 | Ga0070663_100019188 | 3300005455 | Bacteria | 4500 |
| 68 | Ga0070663_100238170 | 3300005455 | Bacteria | 1435 |
| 69 | Ga0070663_100294216 | 3300005455 | Bacteria | 1298 |
| 70 | Ga0070678_100000501 | 3300005456 | Bacteria | 18833 |
| 71 | Ga0070678_100094977 | 3300005456 | Bacteria | 2296 |
| 72 | Ga0070662_100075466 | 3300005457 | Bacteria | 2497 |
| 73 | Ga0068867_100074364 | 3300005459 | Bacteria | 2547 |
| 74 | Ga0068867_100188205 | 3300005459 | Bacteria | 1645 |
| 75 | Ga0070685_10057168 | 3300005466 | Bacteria | 2270 |
| 76 | Ga0070685_10097165 | 3300005466 | Bacteria | 1793 |
| 77 | Ga0070685_10110263 | 3300005466 | Bacteria | 1694 |
| 78 | Ga0070685_10252116 | 3300005466 | Bacteria | 1170 |
| 79 | Ga0068853_100514628 | 3300005539 | Bacteria | 1131 |
| 80 | Ga0068853_100692348 | 3300005539 | Bacteria | 972 |
| 81 | Ga0070695_100001861 | 3300005545 | Bacteria | 11918 |
| 82 | Ga0070695_100354725 | 3300005545 | Bacteria | 1100 |
| 83 | Ga0070696_100312646 | 3300005546 | Bacteria | 1206 |
| 84 | Ga0070696_100536246 | 3300005546 | Bacteria | 936 |
| 85 | Ga0070693_100010072 | 3300005547 | Bacteria | 4719 |
| 86 | Ga0070693_100097421 | 3300005547 | Bacteria | 1785 |
| 87 | Ga0070665_100010228 | 3300005548 | Bacteria | 9491 |
| 88 | Ga0070665_100061435 | 3300005548 | Bacteria | 3767 |
| 89 | Ga0070665_100111578 | 3300005548 | Bacteria | 2737 |
| 90 | Ga0070704_100333206 | 3300005549 | Bacteria | 1275 |
| 91 | Ga0068855_100424022 | 3300005563 | Bacteria | 1455 |
| 92 | Ga0068855_101037312 | 3300005563 | Bacteria | 860 |
| 93 | Ga0070664_100241320 | 3300005564 | Bacteria | 1622 |
| 94 | Ga0068854_100002504 | 3300005578 | Bacteria | 11390 |
| 95 | Ga0068854_100024955 | 3300005578 | Bacteria | 4100 |
| 96 | Ga0070702_100020309 | 3300005615 | Bacteria | 3477 |
| 97 | Ga0068852_100155991 | 3300005616 | Bacteria | 2127 |
| 98 | Ga0068852_100157472 | 3300005616 | Bacteria | 2117 |
| 99 | Ga0068859_100000223 | 3300005617 | Bacteria | 56082 |
| 100 | Ga0068859_100008823 | 3300005617 | Bacteria | 10180 |
| 101 | Ga0068859_100113717 | 3300005617 | Bacteria | 2770 |
| 102 | Ga0068864_100314231 | 3300005618 | Bacteria | 1470 |
| 103 | Ga0068866_10001113 | 3300005718 | Bacteria | 11805 |
| 104 | Ga0068866_10074122 | 3300005718 | Bacteria | 1808 |
| 105 | Ga0068861_100002059 | 3300005719 | Bacteria | 13039 |
| 106 | Ga0068861_100073442 | 3300005719 | Bacteria | 2657 |
| 107 | Ga0068863_100001282 | 3300005841 | Bacteria | 25087 |
| 108 | Ga0068863_100003966 | 3300005841 | Bacteria | 14617 |
| 109 | Ga0068863_100183668 | 3300005841 | Bacteria | 2008 |
| 110 | Ga0068858_100011570 | 3300005842 | Bacteria | 8322 |
| 111 | Ga0068858_100015499 | 3300005842 | Bacteria | 7169 |
| 112 | Ga0068858_100805532 | 3300005842 | Bacteria | 916 |
| 113 | Ga0068860_100000127 | 3300005843 | Bacteria | 122766 |
| 114 | Ga0068860_100008110 | 3300005843 | Bacteria | 10460 |
| 115 | Ga0068860_100072044 | 3300005843 | Bacteria | 3283 |
| 116 | Ga0068860_100140177 | 3300005843 | Bacteria | 2324 |
| 117 | Ga0068862_100000052 | 3300005844 | Bacteria | 144622 |
| 118 | Ga0068862_100028247 | 3300005844 | Bacteria | 4722 |
| 119 | Ga0068862_100073627 | 3300005844 | Bacteria | 2952 |
| 120 | Ga0081455_10013790 | 3300005937 | Bacteria | 7953 |
| 121 | Ga0075365_10049552 | 3300006038 | Bacteria | 2768 |
| 122 | Ga0075365_10085563 | 3300006038 | Bacteria | 2141 |
| 123 | Ga0075365_10089023 | 3300006038 | Bacteria | 2101 |
| 124 | Ga0075365_10134475 | 3300006038 | Bacteria | 1713 |
| 125 | Ga0075365_10144935 | 3300006038 | Bacteria | 1650 |
| 126 | Ga0075363_100006604 | 3300006048 | Bacteria | 5284 |
| 127 | Ga0075363_100013738 | 3300006048 | Bacteria | 3938 |
| 128 | Ga0075363_100023622 | 3300006048 | Bacteria | 3119 |
| 129 | Ga0075363_100056693 | 3300006048 | Bacteria | 2101 |
| 130 | Ga0075363_100065906 | 3300006048 | Bacteria | 1959 |
| 131 | Ga0075363_100071350 | 3300006048 | Bacteria | 1888 |
| 132 | Ga0075363_100095308 | 3300006048 | Bacteria | 1641 |
| 133 | Ga0075363_100299646 | 3300006048 | Bacteria | 933 |
| 134 | Ga0075363_100365128 | 3300006048 | Bacteria | 845 |
| 135 | Ga0075364_10005662 | 3300006051 | Bacteria | 7283 |
| 136 | Ga0075364_10007711 | 3300006051 | Bacteria | 6404 |
| 137 | Ga0075364_10020279 | 3300006051 | Bacteria | 4180 |
| 138 | Ga0075364_10031438 | 3300006051 | Bacteria | 3410 |
| 139 | Ga0075364_10045093 | 3300006051 | Bacteria | 2870 |
| 140 | Ga0075364_10110545 | 3300006051 | Bacteria | 1834 |
| 141 | Ga0075364_10137128 | 3300006051 | Bacteria | 1644 |
| 142 | Ga0070716_100014974 | 3300006173 | Bacteria | 3978 |
| 143 | Ga0070712_100019330 | 3300006175 | Bacteria | 4442 |
| 144 | Ga0070712_100048619 | 3300006175 | Bacteria | 2941 |
| 145 | Ga0075362_10050307 | 3300006177 | Bacteria | 1863 |
| 146 | Ga0075362_10066849 | 3300006177 | Bacteria | 1634 |
| 147 | Ga0075362_10221904 | 3300006177 | Bacteria | 924 |
| 148 | Ga0075367_10028997 | 3300006178 | Bacteria | 3162 |
| 149 | Ga0075367_10054198 | 3300006178 | Bacteria | 2378 |
| 150 | Ga0075367_10125645 | 3300006178 | Bacteria | 1583 |
| 151 | Ga0075369_10001688 | 3300006186 | Bacteria | 7627 |
| 152 | Ga0075369_10004739 | 3300006186 | Bacteria | 5048 |
| 153 | Ga0075369_10006908 | 3300006186 | Bacteria | 4309 |
| 154 | Ga0075369_10008590 | 3300006186 | Bacteria | 3935 |
| 155 | Ga0075369_10085012 | 3300006186 | Bacteria | 1407 |
| 156 | Ga0075369_10158723 | 3300006186 | Bacteria | 1036 |
| 157 | Ga0075369_10256327 | 3300006186 | Bacteria | 813 |
| 158 | Ga0075366_10236581 | 3300006195 | Bacteria | 1113 |
| 159 | Ga0075370_10001453 | 3300006353 | Bacteria | 10286 |
| 160 | Ga0075370_10019258 | 3300006353 | Bacteria | 3715 |
| 161 | Ga0075370_10021785 | 3300006353 | Bacteria | 3513 |
| 162 | Ga0075370_10155733 | 3300006353 | Bacteria | 1340 |
| 163 | Ga0075370_10205736 | 3300006353 | Bacteria | 1161 |
| 164 | Ga0075428_100005457 | 3300006844 | Bacteria | 14138 |
| 165 | Ga0075430_100455820 | 3300006846 | Bacteria | 1055 |
| 166 | Ga0075431_100174664 | 3300006847 | Bacteria | 2207 |
| 167 | Ga0075434_100352450 | 3300006871 | Bacteria | 1493 |
| 168 | Ga0068865_100033143 | 3300006881 | Bacteria | 3456 |
| 169 | Ga0097620_100000223 | 3300006931 | Bacteria | 56082 |
| 170 | Ga0097620_100008823 | 3300006931 | Bacteria | 10180 |
| 171 | Ga0097620_100113717 | 3300006931 | Bacteria | 2770 |
| 172 | Ga0075435_101079922 | 3300007076 | Bacteria | 701 |
| 173 | Ga0111539_10256005 | 3300009094 | Bacteria | 2038 |
| 174 | Ga0111539_11114981 | 3300009094 | Bacteria | 917 |
| 175 | Ga0105245_10739475 | 3300009098 | Bacteria | 1019 |
| 176 | Ga0105245_10812132 | 3300009098 | Bacteria | 974 |
| 177 | Ga0105247_10000066 | 3300009101 | Bacteria | 121025 |
| 178 | Ga0105247_10071029 | 3300009101 | Bacteria | 2176 |
| 179 | Ga0105247_10075075 | 3300009101 | Bacteria | 2121 |
| 180 | Ga0114129_10077725 | 3300009147 | Bacteria | 4616 |
| 181 | Ga0105243_10005180 | 3300009148 | Bacteria | 10207 |
| 182 | Ga0105243_10158367 | 3300009148 | Bacteria | 1950 |
| 183 | Ga0105241_10596877 | 3300009174 | Bacteria | 997 |
| 184 | Ga0105242_10001265 | 3300009176 | Bacteria | 19971 |
| 185 | Ga0105242_10553813 | 3300009176 | Bacteria | 1103 |
| 186 | Ga0105248_10000144 | 3300009177 | Bacteria | 81953 |
| 187 | Ga0105248_10025545 | 3300009177 | Bacteria | 6567 |
| 188 | Ga0105248_10286967 | 3300009177 | Bacteria | 1853 |
| 189 | Ga0105248_10594467 | 3300009177 | Bacteria | 1249 |
| 190 | Ga0105237_10233829 | 3300009545 | Bacteria | 1839 |
| 191 | Ga0105237_10366623 | 3300009545 | Bacteria | 1445 |
| 192 | Ga0105237_10785112 | 3300009545 | Bacteria | 959 |
| 193 | Ga0105238_10195401 | 3300009551 | Bacteria | 1999 |
| 194 | Ga0105249_10000093 | 3300009553 | Bacteria | 122840 |
| 195 | Ga0105249_10010343 | 3300009553 | Bacteria | 8201 |
| 196 | Ga0105249_10017377 | 3300009553 | Bacteria | 6385 |
| 197 | Ga0105249_10067733 | 3300009553 | Bacteria | 3290 |
| 198 | Ga0105249_10784709 | 3300009553 | Bacteria | 1016 |
| 199 | Ga0099796_10087690 | 3300010159 | Bacteria | 1152 |
| 200 | Ga0105239_10065105 | 3300010375 | Bacteria | 4002 |
| 201 | Ga0105239_10083690 | 3300010375 | Bacteria | 3514 |
| 202 | Ga0105239_10098380 | 3300010375 | Bacteria | 3234 |
| 203 | Ga0105246_10008144 | 3300011119 | Bacteria | 6435 |
| 204 | Ga0157369_10784791 | 3300013105 | Bacteria | 979 |
| 205 | Ga0157374_10138778 | 3300013296 | Bacteria | 2358 |
| 206 | Ga0157374_10510725 | 3300013296 | Bacteria | 1207 |
| 207 | Ga0157378_10005801 | 3300013297 | Bacteria | 10820 |
| 208 | Ga0157378_10043286 | 3300013297 | Bacteria | 3997 |
| 209 | Ga0163162_10083823 | 3300013306 | Bacteria | 3262 |
| 210 | Ga0163162_10157947 | 3300013306 | Bacteria | 2388 |
| 211 | Ga0163162_10312469 | 3300013306 | Bacteria | 1704 |
| 212 | Ga0163162_10351783 | 3300013306 | Bacteria | 1606 |
| 213 | Ga0163162_10565186 | 3300013306 | Bacteria | 1265 |
| 214 | Ga0163162_10733299 | 3300013306 | Bacteria | 1108 |
| 215 | Ga0157372_10023638 | 3300013307 | Bacteria | 6667 |
| 216 | Ga0157372_10597592 | 3300013307 | Bacteria | 1286 |
| 217 | Ga0157375_10021798 | 3300013308 | Bacteria | 5884 |
| 218 | Ga0157375_10033105 | 3300013308 | Bacteria | 4908 |
| 219 | Ga0157375_10485297 | 3300013308 | Bacteria | 1401 |
| 220 | Ga0163163_10077208 | 3300014325 | Bacteria | 3326 |
| 221 | Ga0163163_10123874 | 3300014325 | Bacteria | 2621 |
| 222 | Ga0157380_10004282 | 3300014326 | Bacteria | 9881 |
| 223 | Ga0157380_10533748 | 3300014326 | Bacteria | 1147 |
| 224 | Ga0182008_10061117 | 3300014497 | Bacteria | 1857 |
| 225 | Ga0157379_10016326 | 3300014968 | Bacteria | 6531 |
| 226 | Ga0157379_10025675 | 3300014968 | Bacteria | 5236 |
| 227 | Ga0157379_10077493 | 3300014968 | Bacteria | 2976 |
| 228 | Ga0163161_10015015 | 3300017792 | Bacteria | 5396 |
| 229 | Ga0163161_10026591 | 3300017792 | Bacteria | 4099 |
| 230 | Ga0163161_10143081 | 3300017792 | Bacteria | 1812 |
| 231 | Ga0213876_10006661 | 3300021384 | Bacteria | 6304 |
| 232 | Ga0213876_10013586 | 3300021384 | Bacteria | 4319 |
| 233 | Ga0213876_10050116 | 3300021384 | Bacteria | 2206 |
| 234 | Ga0213876_10313239 | 3300021384 | Bacteria | 834 |
| 235 | Ga0213875_10042878 | 3300021388 | Bacteria | 2125 |
| 236 | Ga0207653_10023312 | 3300025885 | Bacteria | 1971 |
| 237 | Ga0207692_10066928 | 3300025898 | Bacteria | 1879 |
| 238 | Ga0207642_10000575 | 3300025899 | Bacteria | 11305 |
| 239 | Ga0207642_10116703 | 3300025899 | Bacteria | 1369 |
| 240 | Ga0207710_10000090 | 3300025900 | Bacteria | 121405 |
| 241 | Ga0207710_10011885 | 3300025900 | Bacteria | 3663 |
| 242 | Ga0207710_10072953 | 3300025900 | Bacteria | 1577 |
| 243 | Ga0207688_10140344 | 3300025901 | Bacteria | 1422 |
| 244 | Ga0207680_10505033 | 3300025903 | Bacteria | 861 |
| 245 | Ga0207647_10070846 | 3300025904 | Bacteria | 2105 |
| 246 | Ga0207699_10067524 | 3300025906 | Bacteria | 2174 |
| 247 | Ga0207699_10293131 | 3300025906 | Bacteria | 1134 |
| 248 | Ga0207645_10055165 | 3300025907 | Bacteria | 2537 |
| 249 | Ga0207645_10088521 | 3300025907 | Bacteria | 1990 |
| 250 | Ga0207671_10385702 | 3300025914 | Bacteria | 1113 |
| 251 | Ga0207693_10000428 | 3300025915 | Bacteria | 38211 |
| 252 | Ga0207693_10003739 | 3300025915 | Bacteria | 12973 |
| 253 | Ga0207663_10461405 | 3300025916 | Bacteria | 981 |
| 254 | Ga0207663_10578995 | 3300025916 | Bacteria | 880 |
| 255 | Ga0207660_10067205 | 3300025917 | Bacteria | 2595 |
| 256 | Ga0207662_10106023 | 3300025918 | Bacteria | 1747 |
| 257 | Ga0207657_10110869 | 3300025919 | Bacteria | 2266 |
| 258 | Ga0207649_10192964 | 3300025920 | Bacteria | 1434 |
| 259 | Ga0207681_10009333 | 3300025923 | Bacteria | 5994 |
| 260 | Ga0207681_10023815 | 3300025923 | Bacteria | 3921 |
| 261 | Ga0207694_10091957 | 3300025924 | Bacteria | 2394 |
| 262 | Ga0207659_10053405 | 3300025926 | Bacteria | 2882 |
| 263 | Ga0207659_10710127 | 3300025926 | Bacteria | 861 |
| 264 | Ga0207687_10012498 | 3300025927 | Bacteria | 5546 |
| 265 | Ga0207687_10135411 | 3300025927 | Bacteria | 1862 |
| 266 | Ga0207664_10014274 | 3300025929 | Bacteria | 5729 |
| 267 | Ga0207664_10639054 | 3300025929 | Bacteria | 956 |
| 268 | Ga0207644_10069103 | 3300025931 | Bacteria | 2579 |
| 269 | Ga0207644_10538101 | 3300025931 | Bacteria | 966 |
| 270 | Ga0207690_10022015 | 3300025932 | Bacteria | 3959 |
| 271 | Ga0207690_10045255 | 3300025932 | Bacteria | 2906 |
| 272 | Ga0207706_10001922 | 3300025933 | Bacteria | 20409 |
| 273 | Ga0207706_10005781 | 3300025933 | Bacteria | 11505 |
| 274 | Ga0207686_10010548 | 3300025934 | Bacteria | 5034 |
| 275 | Ga0207709_10002942 | 3300025935 | Bacteria | 10394 |
| 276 | Ga0207709_10084979 | 3300025935 | Bacteria | 2050 |
| 277 | Ga0207709_10092748 | 3300025935 | Bacteria | 1978 |
| 278 | Ga0207670_10050743 | 3300025936 | Bacteria | 2782 |
| 279 | Ga0207670_10245607 | 3300025936 | Bacteria | 1381 |
| 280 | Ga0207669_10001292 | 3300025937 | Bacteria | 10625 |
| 281 | Ga0207669_10019081 | 3300025937 | Bacteria | 3561 |
| 282 | Ga0207704_10005436 | 3300025938 | Bacteria | 5878 |
| 283 | Ga0207665_10008506 | 3300025939 | Bacteria | 6756 |
| 284 | Ga0207665_10018260 | 3300025939 | Bacteria | 4607 |
| 285 | Ga0207691_10113196 | 3300025940 | Bacteria | 2411 |
| 286 | Ga0207711_10000183 | 3300025941 | Bacteria | 67270 |
| 287 | Ga0207711_10243986 | 3300025941 | Bacteria | 1648 |
| 288 | Ga0207661_10354693 | 3300025944 | Bacteria | 1324 |
| 289 | Ga0207667_11018917 | 3300025949 | Bacteria | 814 |
| 290 | Ga0207651_10607915 | 3300025960 | Bacteria | 956 |
| 291 | Ga0207712_10000073 | 3300025961 | Bacteria | 123046 |
| 292 | Ga0207712_10030405 | 3300025961 | Bacteria | 3630 |
| 293 | Ga0207712_10428225 | 3300025961 | Bacteria | 1118 |
| 294 | Ga0207668_10000804 | 3300025972 | Bacteria | 19218 |
| 295 | Ga0207668_10005657 | 3300025972 | Bacteria | 7357 |
| 296 | Ga0207668_10210348 | 3300025972 | Bacteria | 1555 |
| 297 | Ga0207668_10225298 | 3300025972 | Bacteria | 1508 |
| 298 | Ga0207668_10438795 | 3300025972 | Bacteria | 1112 |
| 299 | Ga0207640_10127817 | 3300025981 | Bacteria | 1832 |
| 300 | Ga0207640_10175390 | 3300025981 | Bacteria | 1602 |
| 301 | Ga0207640_11131171 | 3300025981 | Bacteria | 694 |
| 302 | Ga0207658_10000304 | 3300025986 | Bacteria | 50815 |
| 303 | Ga0207658_10008729 | 3300025986 | Bacteria | 6885 |
| 304 | Ga0207658_10336223 | 3300025986 | Bacteria | 1311 |
| 305 | Ga0207658_10350038 | 3300025986 | Bacteria | 1286 |
| 306 | Ga0207658_10617685 | 3300025986 | Bacteria | 975 |
| 307 | Ga0207677_10020820 | 3300026023 | Bacteria | 3993 |
| 308 | Ga0207677_10025297 | 3300026023 | Bacteria | 3701 |
| 309 | Ga0207703_10016203 | 3300026035 | Bacteria | 5810 |
| 310 | Ga0207703_10034314 | 3300026035 | Bacteria | 4025 |
| 311 | Ga0207703_11169748 | 3300026035 | Bacteria | 739 |
| 312 | Ga0207639_10016205 | 3300026041 | Bacteria | 5267 |
| 313 | Ga0207678_10017856 | 3300026067 | Bacteria | 6231 |
| 314 | Ga0207678_10159080 | 3300026067 | Bacteria | 1929 |
| 315 | Ga0207678_10396601 | 3300026067 | Bacteria | 1194 |
| 316 | Ga0207708_10001568 | 3300026075 | Bacteria | 17075 |
| 317 | Ga0207708_10027129 | 3300026075 | Bacteria | 4337 |
| 318 | Ga0207641_10000413 | 3300026088 | Bacteria | 49861 |
| 319 | Ga0207641_10027640 | 3300026088 | Bacteria | 4685 |
| 320 | Ga0207641_10174931 | 3300026088 | Bacteria | 1962 |
| 321 | Ga0207648_10017088 | 3300026089 | Bacteria | 6612 |
| 322 | Ga0207648_10028388 | 3300026089 | Bacteria | 4960 |
| 323 | Ga0207676_10833429 | 3300026095 | Bacteria | 901 |
| 324 | Ga0207675_100000876 | 3300026118 | Bacteria | 30016 |
| 325 | Ga0207675_100021869 | 3300026118 | Bacteria | 5954 |
| 326 | Ga0207675_100244324 | 3300026118 | Bacteria | 1735 |
| 327 | Ga0207675_101478523 | 3300026118 | Bacteria | 700 |
| 328 | Ga0207683_10001137 | 3300026121 | Bacteria | 24171 |
| 329 | Ga0207698_10091578 | 3300026142 | Bacteria | 2489 |
| 330 | Ga0207698_10116832 | 3300026142 | Bacteria | 2249 |
| 331 | Ga0207428_10588650 | 3300027907 | Bacteria | 802 |
| 332 | Ga0268266_10052494 | 3300028379 | Bacteria | 3501 |
| 333 | Ga0268266_10082887 | 3300028379 | Bacteria | 2798 |
| 334 | Ga0268266_10108114 | 3300028379 | Bacteria | 2460 |
| 335 | Ga0268265_10000063 | 3300028380 | Bacteria | 144643 |
| 336 | Ga0268265_10270093 | 3300028380 | Bacteria | 1516 |
| 337 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 338 | Ga0268264_10022353 | 3300028381 | Bacteria | 5165 |
| 339 | Ga0268264_10119260 | 3300028381 | Bacteria | 2323 |
| 340 | Ga0307410_10274001 | 3300031852 | Bacteria | 1321 |
| 341 | Ga0307410_10523279 | 3300031852 | Bacteria | 979 |
| 342 | Ga0307406_10067866 | 3300031901 | Bacteria | 2326 |
| 343 | Ga0307409_100302813 | 3300031995 | Bacteria | 1488 |
| 344 | Ga0373961_0162226 | 3300035241 | Bacteria | 768 |
| 345 | Ga0373931_0120332 | 3300035691 | Bacteria | 1500 |
| 346 | Ga0436364_0045315 | 3300037853 | Bacteria | 1048 |
| 347 | Ga0436364_0218929 | 3300037853 | Bacteria | 25746 |
| 348 | Ga0436364_0559448 | 3300037853 | Bacteria | 8381 |
| 349 | Ga0436365_0456575 | 3300039437 | Bacteria | 43610 |
| 350 | Ga0436365_0464410 | 3300039437 | Bacteria | 5847 |
| 351 | Ga0436365_1302860 | 3300039437 | Bacteria | 3152 |
| 352 | Ga0436365_1319574 | 3300039437 | Bacteria | 2454 |
| 353 | Ga0436365_1352201 | 3300039437 | Bacteria | 6227 |
| 354 | Ga0436365_1765865 | 3300039437 | Bacteria | 11286 |
| 355 | Ga0439461_0025583 | 3300041410 | Bacteria | 1199 |
| 356 | Ga0439466_0012644 | 3300041411 | Bacteria | 3103 |
| 357 | Ga0439466_0018266 | 3300041411 | Bacteria | 2517 |
| 358 | Ga0439465_0010197 | 3300041413 | Bacteria | 2952 |
| 359 | Ga0439465_0127072 | 3300041413 | Bacteria | 897 |
| 360 | Ga0451855_1772296 | 3300041511 | Bacteria | 1244 |
| 361 | Ga0439431_0144666 | 3300041997 | Bacteria | 673 |
| 362 | Ga0439445_0002473 | 3300042004 | Bacteria | 4117 |
| 363 | Ga0439445_0013044 | 3300042004 | Bacteria | 2006 |
| 364 | Ga0439448_0063764 | 3300042005 | Bacteria | 1221 |
| 365 | Ga0439434_0024358 | 3300042435 | Bacteria | 1825 |
| 366 | Ga0439434_0071524 | 3300042435 | Bacteria | 1092 |
| 367 | Ga0466969_0088649 | 3300044656 | Bacteria | 1468 |
| 368 | Ga0466972_0004838 | 3300044658 | Bacteria | 6756 |
| 369 | Ga0466972_0025438 | 3300044658 | Bacteria | 2935 |
| 370 | Ga0466972_0072915 | 3300044658 | Bacteria | 1637 |
| 371 | Ga0466972_0078539 | 3300044658 | Bacteria | 1572 |
| 372 | Ga0466965_0001888 | 3300044683 | Bacteria | 8728 |
| 373 | Ga0466966_0008407 | 3300044684 | Bacteria | 6828 |
| 374 | Ga0466961_0005701 | 3300044693 | Bacteria | 7877 |
| 375 | Ga0466963_0015491 | 3300044694 | Bacteria | 4723 |
| 376 | Ga0466963_0041783 | 3300044694 | Bacteria | 3008 |
| 377 | Ga0466963_0298266 | 3300044694 | Bacteria | 1133 |
| 378 | Ga0466968_0000457 | 3300044735 | Bacteria | 13772 |
| 379 | Ga0466968_0031496 | 3300044735 | Bacteria | 2201 |
| 380 | Ga0466968_0043155 | 3300044735 | Bacteria | 1908 |
| 381 | Ga0466968_0201137 | 3300044735 | Bacteria | 933 |
| 382 | Ga0466970_0005515 | 3300044765 | Bacteria | 6282 |
| 383 | Ga0466970_0060060 | 3300044765 | Bacteria | 2036 |
| 384 | Ga0466957_0006255 | 3300044842 | Bacteria | 6719 |
| 385 | Ga0466957_0012416 | 3300044842 | Bacteria | 4929 |
| 386 | Ga0466957_0013759 | 3300044842 | Bacteria | 4700 |
| 387 | Ga0466957_0026915 | 3300044842 | Bacteria | 3414 |
| 388 | Ga0466960_0000688 | 3300044901 | Bacteria | 11777 |
| 389 | Ga0466960_0001536 | 3300044901 | Bacteria | 8424 |
| 390 | Ga0466960_0002878 | 3300044901 | Bacteria | 6532 |
| 391 | Ga0466960_0018037 | 3300044901 | Bacteria | 3088 |
| 392 | Ga0466959_0003108 | 3300045049 | Bacteria | 10762 |
| 393 | Ga0466959_0018065 | 3300045049 | Bacteria | 5175 |
| 394 | Ga0466959_0081491 | 3300045049 | Bacteria | 2332 |
| 395 | Ga0466958_0000569 | 3300045836 | Bacteria | 15728 |
| 396 | Ga0466958_0042518 | 3300045836 | Bacteria | 2736 |
| 397 | Ga0466967_0007445 | 3300045976 | Bacteria | 7898 |
| 398 | Ga0466967_0060633 | 3300045976 | Bacteria | 3353 |
| 399 | Ga0466967_0079233 | 3300045976 | Bacteria | 2961 |
| 400 | Ga0466967_0229774 | 3300045976 | Bacteria | 1766 |
| 401 | Ga0466967_0257586 | 3300045976 | Bacteria | 1668 |
| 402 | Ga0495603_0265882 | 3300046455 | Bacteria | 987 |
| 403 | Ga0495629_0011744 | 3300046459 | Bacteria | 6356 |
| 404 | Ga0495638_0001056 | 3300046460 | Bacteria | 27089 |
| 405 | Ga0495638_0068791 | 3300046460 | Bacteria | 2170 |
| 406 | Ga0495638_0102273 | 3300046460 | Bacteria | 1712 |
| 407 | Ga0495653_0031275 | 3300046463 | Bacteria | 4231 |
| 408 | Ga0495582_0064233 | 3300046473 | Bacteria | 2027 |
| 409 | Ga0495662_0367136 | 3300046476 | Bacteria | 707 |
| 410 | Ga0495583_0248818 | 3300046506 | Bacteria | 713 |
| 411 | Ga0495606_0354595 | 3300046507 | Bacteria | 777 |
| 412 | Ga0495630_0114797 | 3300046517 | Bacteria | 2041 |
| 413 | Ga0495665_0355783 | 3300046531 | Bacteria | 745 |
| 414 | Ga0495640_0095527 | 3300046533 | Bacteria | 1956 |
| 415 | Ga0495586_0305544 | 3300046535 | Bacteria | 912 |
| 416 | Ga0495622_0238536 | 3300046557 | Bacteria | 802 |
| 417 | Ga0495667_0151162 | 3300046559 | Bacteria | 1495 |
| 418 | Ga0495668_0118527 | 3300046616 | Bacteria | 1448 |
| 419 | Ga0495625_0204006 | 3300046660 | Bacteria | 1303 |
| 420 | Ga0495657_0090627 | 3300046675 | Bacteria | 1962 |
| 421 | Ga0495649_0045101 | 3300046694 | Bacteria | 2405 |
| 422 | Ga0495600_0103642 | 3300046809 | Bacteria | 1854 |
| 423 | Ga0495660_0263985 | 3300046810 | Bacteria | 794 |
| 424 | Ga0495581_0067137 | 3300047315 | Bacteria | 2074 |
| 425 | Ga0495604_0167185 | 3300047317 | Bacteria | 1550 |
| 426 | Ga0495674_0153209 | 3300047319 | Bacteria | 1932 |
| 427 | Ga0495672_0021028 | 3300047320 | Bacteria | 4262 |
| 428 | Ga0495672_0119899 | 3300047320 | Bacteria | 1400 |
| 429 | Ga0495686_0038665 | 3300047472 | Bacteria | 3050 |
| 430 | Ga0495686_0125386 | 3300047472 | Bacteria | 1527 |
| 431 | Ga0496100_0005502 | 3300048903 | Bacteria | 6830 |
| 432 | Ga0496100_0025472 | 3300048903 | Bacteria | 3618 |
| 433 | Ga0496100_0033526 | 3300048903 | Bacteria | 3214 |
| 434 | Ga0496100_0101067 | 3300048903 | Bacteria | 1987 |
| 435 | Ga0496101_0004333 | 3300048904 | Bacteria | 8904 |
| 436 | Ga0496101_0007372 | 3300048904 | Bacteria | 7125 |
| 437 | Ga0496101_0019605 | 3300048904 | Bacteria | 4620 |
| 438 | Ga0496101_0273729 | 3300048904 | Bacteria | 1318 |
| 439 | Ga0496102_0000168 | 3300048905 | Bacteria | 88511 |
| 440 | Ga0496102_0001819 | 3300048905 | Bacteria | 18419 |
| 441 | Ga0496102_0055058 | 3300048905 | Bacteria | 3628 |
| 442 | Ga0496102_0498566 | 3300048905 | Bacteria | 1140 |
| 443 | Ga0496102_0576384 | 3300048905 | Bacteria | 1048 |
| 444 | Ga0496103_0000550 | 3300048906 | Bacteria | 29973 |
| 445 | Ga0496103_0002065 | 3300048906 | Bacteria | 12847 |
| 446 | Ga0496104_0001250 | 3300048907 | Bacteria | 21900 |
| 447 | Ga0496104_0589941 | 3300048907 | Bacteria | 1022 |
| 448 | Ga0496105_0025816 | 3300048908 | Bacteria | 4786 |
| 449 | Ga0496105_0181249 | 3300048908 | Bacteria | 1725 |
| 450 | Ga0496105_0262294 | 3300048908 | Bacteria | 1397 |
| 451 | Ga0496106_0001250 | 3300048909 | Bacteria | 19036 |
| 452 | Ga0496106_0017361 | 3300048909 | Bacteria | 5325 |
| 453 | Ga0496106_0051295 | 3300048909 | Bacteria | 3110 |
| 454 | Ga0496106_0115196 | 3300048909 | Bacteria | 2096 |
| 455 | Ga0496106_0759995 | 3300048909 | Bacteria | 770 |
| 456 | Ga0496107_0000831 | 3300048910 | Bacteria | 18014 |
| 457 | Ga0496107_0015968 | 3300048910 | Bacteria | 5268 |
| 458 | Ga0496107_0032518 | 3300048910 | Bacteria | 3729 |
| 459 | Ga0496107_0309520 | 3300048910 | Bacteria | 1176 |
| 460 | Ga0496107_0434793 | 3300048910 | Bacteria | 975 |
| 461 | Ga0496108_0000223 | 3300048911 | Bacteria | 50671 |
| 462 | Ga0496108_0067427 | 3300048911 | Bacteria | 3018 |
| 463 | Ga0496109_0020947 | 3300048912 | Bacteria | 5779 |
| 464 | Ga0496109_0060320 | 3300048912 | Bacteria | 3466 |
| 465 | Ga0496109_0353927 | 3300048912 | Bacteria | 1387 |
| 466 | Ga0496109_0808242 | 3300048912 | Bacteria | 876 |
| 467 | Ga0496109_1064948 | 3300048912 | Bacteria | 746 |
| 468 | Ga0496110_0171341 | 3300048913 | Bacteria | 1969 |
| 469 | Ga0496110_0640225 | 3300048913 | Bacteria | 963 |
| 470 | Ga0496112_0004133 | 3300048915 | Bacteria | 12213 |
| 471 | Ga0496112_0024856 | 3300048915 | Bacteria | 5746 |
| 472 | Ga0496112_0065410 | 3300048915 | Bacteria | 3588 |
| 473 | Ga0496113_0016603 | 3300048916 | Bacteria | 5089 |
| 474 | Ga0496113_0033773 | 3300048916 | Bacteria | 3728 |
| 475 | Ga0496113_0049411 | 3300048916 | Bacteria | 3132 |
| 476 | Ga0496113_0068065 | 3300048916 | Bacteria | 2702 |
| 477 | Ga0496114_0000320 | 3300048917 | Bacteria | 35231 |
| 478 | Ga0496114_0018865 | 3300048917 | Bacteria | 5585 |
| 479 | Ga0496114_0057404 | 3300048917 | Bacteria | 3250 |
| 480 | Ga0496115_0008280 | 3300048918 | Bacteria | 7685 |
| 481 | Ga0496115_0470535 | 3300048918 | Bacteria | 1013 |
| 482 | Ga0496115_0475300 | 3300048918 | Bacteria | 1007 |
| 483 | Ga0496115_0604152 | 3300048918 | Bacteria | 872 |
| 484 | Ga0496117_0000869 | 3300048920 | Bacteria | 46596 |
| 485 | Ga0496118_0000171 | 3300048921 | Bacteria | 117495 |
| 486 | Ga0496119_0017669 | 3300048922 | Bacteria | 5354 |
| 487 | Ga0496120_0094625 | 3300048923 | Bacteria | 1590 |
| 488 | Ga0496121_0013171 | 3300048924 | Bacteria | 8916 |
| 489 | Ga0496122_0036885 | 3300048925 | Bacteria | 3944 |
| 490 | Ga0496123_0020808 | 3300048926 | Bacteria | 5119 |
| 491 | Ga0496124_0084821 | 3300048927 | Bacteria | 2596 |
| 492 | Ga0496125_0020492 | 3300048928 | Bacteria | 6204 |
| 493 | Ga0496125_0053441 | 3300048928 | Bacteria | 3311 |
| 494 | Ga0496125_0219837 | 3300048928 | Bacteria | 1225 |
| 495 | Ga0496126_0005442 | 3300048929 | Bacteria | 14520 |
| 496 | Ga0496126_0006823 | 3300048929 | Bacteria | 12667 |
| 497 | Ga0496126_0025483 | 3300048929 | Bacteria | 5689 |
| 498 | Ga0501032_0117028 | 3300049569 | Bacteria | 1762 |
| 499 | Ga0501033_0132369 | 3300049570 | Bacteria | 1806 |
| 500 | Ga0501033_0516439 | 3300049570 | Bacteria | 825 |
| 501 | Ga0501034_0005982 | 3300049571 | Bacteria | 13160 |
| 502 | Ga0501034_0140724 | 3300049571 | Bacteria | 2393 |
| 503 | Ga0501034_0160037 | 3300049571 | Bacteria | 2223 |
| 504 | Ga0501034_0293644 | 3300049571 | Bacteria | 1563 |
| 505 | Ga0501036_0661303 | 3300049572 | Bacteria | 865 |
| 506 | Ga0501037_0044169 | 3300049573 | Bacteria | 3273 |
| 507 | Ga0501046_0003366 | 3300049580 | Bacteria | 14687 |
| 508 | Ga0501047_0027428 | 3300049581 | Bacteria | 5486 |
| 509 | Ga0501048_0011970 | 3300049582 | Bacteria | 6468 |
| 510 | Ga0501070_0001967 | 3300049586 | Bacteria | 18122 |
| 511 | Ga0501070_0490708 | 3300049586 | Bacteria | 987 |
| 512 | Ga0501080_0145210 | 3300049742 | Bacteria | 2193 |
| 513 | Ga0501035_0000556 | 3300049822 | Bacteria | 41478 |
| 514 | Ga0501035_0007575 | 3300049822 | Bacteria | 10145 |
| 515 | Ga0501044_0000797 | 3300049823 | Bacteria | 38010 |
| 516 | Ga0501044_0000935 | 3300049823 | Bacteria | 35094 |
| 517 | nmdc:mga03n38_13639_c1 | 3300050490 | Bacteria | 3093 |
| 518 | nmdc:mga03n38_26817_c1 | 3300050490 | Bacteria | 2383 |
| 519 | nmdc:mga03n38_44530_c1 | 3300050490 | Bacteria | 1950 |
| 520 | nmdc:mga03n38_7596_c1 | 3300050490 | Bacteria | 3844 |
| 521 | nmdc:mga00v17_141698_c1 | 3300050491 | Bacteria | 1542 |
| 522 | nmdc:mga00v17_147144_c1 | 3300050491 | Bacteria | 1512 |
| 523 | nmdc:mga00v17_21928_c1 | 3300050491 | Bacteria | 3679 |
| 524 | nmdc:mga00v17_2306_c1 | 3300050491 | Bacteria | 9788 |
| 525 | nmdc:mga00v17_260_c1 | 3300050491 | Bacteria | 31041 |
| 526 | nmdc:mga00v17_432888_c1 | 3300050491 | Bacteria | 854 |
| 527 | nmdc:mga00v17_85546_c1 | 3300050491 | Bacteria | 1974 |
| 528 | nmdc:mga0yw44_130684_c1 | 3300050492 | Bacteria | 1625 |
| 529 | nmdc:mga0yw44_211674_c1 | 3300050492 | Bacteria | 1282 |
| 530 | nmdc:mga0yw44_33275_c1 | 3300050492 | Bacteria | 3010 |
| 531 | nmdc:mga0yw44_52524_c1 | 3300050492 | Bacteria | 2471 |
| 532 | nmdc:mga0yw44_57308_c1 | 3300050492 | Bacteria | 2376 |
| 533 | nmdc:mga0yw44_67901_c1 | 3300050492 | Bacteria | 2204 |
| 534 | nmdc:mga0k408_111190_c1 | 3300050493 | Bacteria | 1619 |
| 535 | nmdc:mga06z11_139089_c1 | 3300050494 | Bacteria | 1371 |
| 536 | nmdc:mga06z11_145050_c1 | 3300050494 | Bacteria | 1345 |
| 537 | nmdc:mga06z11_17661_c1 | 3300050494 | Bacteria | 3243 |
| 538 | nmdc:mga06z11_202363_c1 | 3300050494 | Bacteria | 1154 |
| 539 | nmdc:mga06z11_233082_c1 | 3300050494 | Bacteria | 1079 |
| 540 | nmdc:mga07m45_205785_c1 | 3300050496 | Bacteria | 1145 |
| 541 | nmdc:mga07m45_211266_c1 | 3300050496 | Bacteria | 1129 |
| 542 | nmdc:mga07m45_38224_c1 | 3300050496 | Bacteria | 2678 |
| 543 | nmdc:mga05p37_1121643_c1 | 3300050507 | Bacteria | 821 |
| 544 | nmdc:mga05p37_214516_c1 | 3300050507 | Bacteria | 2325 |
| 545 | nmdc:mga0qj67_472924_c1 | 3300050509 | Bacteria | 1009 |
| 546 | nmdc:mga06r32_161127_c1 | 3300050510 | Bacteria | 2226 |
| 547 | nmdc:mga08y16_5095_c1 | 3300050511 | Bacteria | 13734 |
| 548 | nmdc:mga08y16_826551_c1 | 3300050511 | Bacteria | 917 |
| 549 | nmdc:mga08y16_859511_c1 | 3300050511 | Bacteria | 896 |
| 550 | nmdc:mga0n895_336904_c1 | 3300050512 | Bacteria | 1528 |
| 551 | nmdc:mga0rr50_1086162_c1 | 3300050513 | Bacteria | 681 |
| 552 | nmdc:mga0sz30_18694_c1 | 3300050516 | Bacteria | 2776 |
| 553 | nmdc:mga0sz30_1955_c1 | 3300050516 | Bacteria | 7365 |
| 554 | nmdc:mga0sz30_223918_c1 | 3300050516 | Bacteria | 836 |
| 555 | nmdc:mga0sz30_27919_c1 | 3300050516 | Bacteria | 2320 |
| 556 | nmdc:mga0sz30_28780_c1 | 3300050516 | Bacteria | 2287 |
| 557 | Ga0495655_0009755 | 3300053083 | Bacteria | 1872 |
| 558 | Ga0495595_0085128 | 3300053084 | Bacteria | 1511 |
| 559 | Ga0500643_001380 | 3300053087 | Bacteria | 14057 |
| 560 | Ga0500643_030047 | 3300053087 | Bacteria | 1667 |
| 561 | Ga0500556_0018092 | 3300053104 | Bacteria | 2218 |
| 562 | Ga0500562_012179 | 3300053108 | Bacteria | 2186 |
| 563 | Ga0500642_0038329 | 3300053130 | Bacteria | 2054 |
| 564 | Ga0500568_0081606 | 3300053139 | Bacteria | 1227 |
| 565 | Ga0500604_0069518 | 3300053151 | Bacteria | 1120 |
| 566 | Ga0500616_0007077 | 3300053153 | Bacteria | 7197 |
| 567 | Ga0500627_0019443 | 3300053158 | Bacteria | 2707 |
| 568 | Ga0500627_0068059 | 3300053158 | Bacteria | 1574 |
| 569 | Ga0500611_053902 | 3300053727 | Bacteria | 931 |
| 570 | Ga0500645_000007 | 3300053730 | Bacteria | 233700 |
| 571 | Ga0500645_008205 | 3300053730 | Bacteria | 3583 |
| 572 | Ga0466962_0104087 | 3300061719 | Bacteria | 1364 |
| 573 | Ga0530510_0056351 | 3300061734 | Bacteria | 2839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0470535 | Ga0496115_0470535_376_1002 | 181 |
| 2 | 3300050513 | nmdc:mga0rr50_1086162_c1 | nmdc:mga0rr50_1086162_c1_32_640 | 182 |
| 3 | 3300037853 | Ga0436364_0045315 | Ga0436364_0045315_43_666 | 194 |
| 4 | 3300044735 | Ga0466968_0031496 | Ga0466968_0031496_710_1369 | 194 |
| 5 | 3300049571 | Ga0501034_0140724 | Ga0501034_0140724_943_1572 | 194 |
| 6 | 3300061719 | Ga0466962_0104087 | Ga0466962_0104087_656_1315 | 194 |
| 7 | iso_pu_bacteria | 2643221715 | 2644638192 | 194 |
| 8 | iso_pu_bacteria | 2902810491 | 2902812068 | 194 |
| 9 | 3300044658 | Ga0466972_0078539 | Ga0466972_0078539_115_744 | 195 |
| 10 | 3300050511 | nmdc:mga08y16_5095_c1 | nmdc:mga08y16_5095_c1_264_878 | 195 |
| 11 | 3300003320 | rootH2_10113120 | rootH2_101131203 | 196 |
| 12 | 3300005436 | Ga0070713_100187948 | Ga0070713_1001879482 | 196 |
| 13 | 3300005437 | Ga0070710_10173321 | Ga0070710_101733212 | 196 |
| 14 | 3300025929 | Ga0207664_10014274 | Ga0207664_100142743 | 196 |
| 15 | 3300044658 | Ga0466972_0072915 | Ga0466972_0072915_699_1334 | 196 |
| 16 | 3300045049 | Ga0466959_0081491 | Ga0466959_0081491_1144_1779 | 196 |
| 17 | 3300045976 | Ga0466967_0257586 | Ga0466967_0257586_849_1484 | 196 |
| 18 | 3300049569 | Ga0501032_0117028 | Ga0501032_0117028_632_1222 | 196 |
| 19 | 3300049570 | Ga0501033_0132369 | Ga0501033_0132369_895_1485 | 196 |
| 20 | 3300049571 | Ga0501034_0160037 | Ga0501034_0160037_691_1281 | 196 |
| 21 | 3300049822 | Ga0501035_0000556 | Ga0501035_0000556_19962_20552 | 196 |
| 22 | 3300049823 | Ga0501044_0000797 | Ga0501044_0000797_23048_23638 | 196 |
| 23 | 3300006871 | Ga0075434_100352450 | Ga0075434_1003524502 | 197 |
| 24 | 3300009094 | Ga0111539_11114981 | Ga0111539_111149812 | 197 |
| 25 | 3300013306 | Ga0163162_10733299 | Ga0163162_107332992 | 197 |
| 26 | 3300025972 | Ga0207668_10210348 | Ga0207668_102103483 | 197 |
| 27 | 3300026118 | Ga0207675_101478523 | Ga0207675_1014785231 | 197 |
| 28 | 3300031852 | Ga0307410_10274001 | Ga0307410_102740012 | 197 |
| 29 | 3300031995 | Ga0307409_100302813 | Ga0307409_1003028132 | 197 |
| 30 | 3300048905 | Ga0496102_0498566 | Ga0496102_0498566_125_763 | 197 |
| 31 | 3300048912 | Ga0496109_1064948 | Ga0496109_1064948_21_656 | 197 |
| 32 | 3300050494 | nmdc:mga06z11_233082_c1 | nmdc:mga06z11_233082_c1_319_951 | 197 |
| 33 | 3300050511 | nmdc:mga08y16_826551_c1 | nmdc:mga08y16_826551_c1_39_677 | 197 |
| 34 | 3300050512 | nmdc:mga0n895_336904_c1 | nmdc:mga0n895_336904_c1_733_1371 | 197 |
| 35 | iso_pu_bacteria | 2842134933 | 2842140082 | 197 |
| 36 | 3300001977 | JGI24746J21847_1016951 | JGI24746J21847_10169512 | 198 |
| 37 | 3300001990 | JGI24737J22298_10071779 | JGI24737J22298_100717791 | 198 |
| 38 | 3300002070 | JGI24750J21931_1028103 | JGI24750J21931_10281031 | 198 |
| 39 | 3300002073 | JGI24745J21846_1002207 | JGI24745J21846_10022072 | 198 |
| 40 | 3300002077 | JGI24744J21845_10000316 | JGI24744J21845_100003168 | 198 |
| 41 | 3300002077 | JGI24744J21845_10023989 | JGI24744J21845_100239891 | 198 |
| 42 | 3300002244 | JGI24742J22300_10017465 | JGI24742J22300_100174652 | 198 |
| 43 | 3300002244 | JGI24742J22300_10025495 | JGI24742J22300_100254951 | 198 |
| 44 | 3300002459 | JGI24751J29686_10030464 | JGI24751J29686_100304642 | 198 |
| 45 | 3300005328 | Ga0070676_10017688 | Ga0070676_100176885 | 198 |
| 46 | 3300005334 | Ga0068869_100163783 | Ga0068869_1001637833 | 198 |
| 47 | 3300005335 | Ga0070666_10020422 | Ga0070666_100204222 | 198 |
| 48 | 3300005335 | Ga0070666_10222102 | Ga0070666_102221022 | 198 |
| 49 | 3300005335 | Ga0070666_10282204 | Ga0070666_102822042 | 198 |
| 50 | 3300005336 | Ga0070680_100437035 | Ga0070680_1004370351 | 198 |
| 51 | 3300005337 | Ga0070682_100132270 | Ga0070682_1001322702 | 198 |
| 52 | 3300005337 | Ga0070682_100328810 | Ga0070682_1003288101 | 198 |
| 53 | 3300005338 | Ga0068868_100001495 | Ga0068868_1000014957 | 198 |
| 54 | 3300005338 | Ga0068868_100041231 | Ga0068868_1000412314 | 198 |
| 55 | 3300005339 | Ga0070660_100196369 | Ga0070660_1001963692 | 198 |
| 56 | 3300005340 | Ga0070689_100179182 | Ga0070689_1001791822 | 198 |
| 57 | 3300005340 | Ga0070689_100243271 | Ga0070689_1002432712 | 198 |
| 58 | 3300005341 | Ga0070691_10005058 | Ga0070691_100050587 | 198 |
| 59 | 3300005341 | Ga0070691_10112944 | Ga0070691_101129441 | 198 |
| 60 | 3300005343 | Ga0070687_100035626 | Ga0070687_1000356263 | 198 |
| 61 | 3300005344 | Ga0070661_100265326 | Ga0070661_1002653262 | 198 |
| 62 | 3300005347 | Ga0070668_100000783 | Ga0070668_1000007834 | 198 |
| 63 | 3300005347 | Ga0070668_100003719 | Ga0070668_1000037192 | 198 |
| 64 | 3300005353 | Ga0070669_100014426 | Ga0070669_1000144263 | 198 |
| 65 | 3300005354 | Ga0070675_100066497 | Ga0070675_1000664972 | 198 |
| 66 | 3300005354 | Ga0070675_100801020 | Ga0070675_1008010201 | 198 |
| 67 | 3300005355 | Ga0070671_100044151 | Ga0070671_1000441514 | 198 |
| 68 | 3300005355 | Ga0070671_100057274 | Ga0070671_1000572745 | 198 |
| 69 | 3300005355 | Ga0070671_100077328 | Ga0070671_1000773281 | 198 |
| 70 | 3300005356 | Ga0070674_100022230 | Ga0070674_1000222302 | 198 |
| 71 | 3300005356 | Ga0070674_100023965 | Ga0070674_1000239653 | 198 |
| 72 | 3300005364 | Ga0070673_100313043 | Ga0070673_1003130432 | 198 |
| 73 | 3300005364 | Ga0070673_100343493 | Ga0070673_1003434932 | 198 |
| 74 | 3300005364 | Ga0070673_100408529 | Ga0070673_1004085292 | 198 |
| 75 | 3300005365 | Ga0070688_100137511 | Ga0070688_1001375112 | 198 |
| 76 | 3300005366 | Ga0070659_100066066 | Ga0070659_1000660662 | 198 |
| 77 | 3300005367 | Ga0070667_100000073 | Ga0070667_10000007362 | 198 |
| 78 | 3300005367 | Ga0070667_100009799 | Ga0070667_1000097998 | 198 |
| 79 | 3300005367 | Ga0070667_100111654 | Ga0070667_1001116543 | 198 |
| 80 | 3300005367 | Ga0070667_100489512 | Ga0070667_1004895122 | 198 |
| 81 | 3300005406 | Ga0070703_10056619 | Ga0070703_100566192 | 198 |
| 82 | 3300005434 | Ga0070709_10073864 | Ga0070709_100738643 | 198 |
| 83 | 3300005434 | Ga0070709_10095111 | Ga0070709_100951113 | 198 |
| 84 | 3300005435 | Ga0070714_100021043 | Ga0070714_1000210433 | 198 |
| 85 | 3300005437 | Ga0070710_10009560 | Ga0070710_100095603 | 198 |
| 86 | 3300005437 | Ga0070710_10055578 | Ga0070710_100555783 | 198 |
| 87 | 3300005438 | Ga0070701_10022390 | Ga0070701_100223903 | 198 |
| 88 | 3300005439 | Ga0070711_100061683 | Ga0070711_1000616832 | 198 |
| 89 | 3300005440 | Ga0070705_100088457 | Ga0070705_1000884572 | 198 |
| 90 | 3300005441 | Ga0070700_100078182 | Ga0070700_1000781823 | 198 |
| 91 | 3300005444 | Ga0070694_100018878 | Ga0070694_1000188785 | 198 |
| 92 | 3300005444 | Ga0070694_100262384 | Ga0070694_1002623842 | 198 |
| 93 | 3300005445 | Ga0070708_100852835 | Ga0070708_1008528351 | 198 |
| 94 | 3300005455 | Ga0070663_100019188 | Ga0070663_1000191883 | 198 |
| 95 | 3300005455 | Ga0070663_100238170 | Ga0070663_1002381702 | 198 |
| 96 | 3300005455 | Ga0070663_100294216 | Ga0070663_1002942162 | 198 |
| 97 | 3300005456 | Ga0070678_100000501 | Ga0070678_10000050114 | 198 |
| 98 | 3300005456 | Ga0070678_100094977 | Ga0070678_1000949771 | 198 |
| 99 | 3300005457 | Ga0070662_100075466 | Ga0070662_1000754664 | 198 |
| 100 | 3300005459 | Ga0068867_100074364 | Ga0068867_1000743641 | 198 |
| 101 | 3300005459 | Ga0068867_100188205 | Ga0068867_1001882053 | 198 |
| 102 | 3300005466 | Ga0070685_10057168 | Ga0070685_100571682 | 198 |
| 103 | 3300005466 | Ga0070685_10097165 | Ga0070685_100971652 | 198 |
| 104 | 3300005466 | Ga0070685_10252116 | Ga0070685_102521162 | 198 |
| 105 | 3300005539 | Ga0068853_100514628 | Ga0068853_1005146281 | 198 |
| 106 | 3300005539 | Ga0068853_100692348 | Ga0068853_1006923481 | 198 |
| 107 | 3300005545 | Ga0070695_100001861 | Ga0070695_1000018616 | 198 |
| 108 | 3300005545 | Ga0070695_100354725 | Ga0070695_1003547252 | 198 |
| 109 | 3300005546 | Ga0070696_100312646 | Ga0070696_1003126462 | 198 |
| 110 | 3300005546 | Ga0070696_100536246 | Ga0070696_1005362461 | 198 |
| 111 | 3300005547 | Ga0070693_100010072 | Ga0070693_1000100723 | 198 |
| 112 | 3300005547 | Ga0070693_100097421 | Ga0070693_1000974212 | 198 |
| 113 | 3300005548 | Ga0070665_100010228 | Ga0070665_1000102285 | 198 |
| 114 | 3300005548 | Ga0070665_100061435 | Ga0070665_1000614355 | 198 |
| 115 | 3300005548 | Ga0070665_100111578 | Ga0070665_1001115783 | 198 |
| 116 | 3300005549 | Ga0070704_100333206 | Ga0070704_1003332062 | 198 |
| 117 | 3300005563 | Ga0068855_100424022 | Ga0068855_1004240222 | 198 |
| 118 | 3300005563 | Ga0068855_101037312 | Ga0068855_1010373122 | 198 |
| 119 | 3300005564 | Ga0070664_100241320 | Ga0070664_1002413202 | 198 |
| 120 | 3300005578 | Ga0068854_100002504 | Ga0068854_1000025047 | 198 |
| 121 | 3300005578 | Ga0068854_100024955 | Ga0068854_1000249558 | 198 |
| 122 | 3300005615 | Ga0070702_100020309 | Ga0070702_1000203092 | 198 |
| 123 | 3300005616 | Ga0068852_100155991 | Ga0068852_1001559912 | 198 |
| 124 | 3300005616 | Ga0068852_100157472 | Ga0068852_1001574723 | 198 |
| 125 | 3300005617 | Ga0068859_100000223 | Ga0068859_10000022318 | 198 |
| 126 | 3300005617 | Ga0068859_100008823 | Ga0068859_1000088239 | 198 |
| 127 | 3300005617 | Ga0068859_100113717 | Ga0068859_1001137173 | 198 |
| 128 | 3300005618 | Ga0068864_100314231 | Ga0068864_1003142312 | 198 |
| 129 | 3300005718 | Ga0068866_10001113 | Ga0068866_100011137 | 198 |
| 130 | 3300005718 | Ga0068866_10074122 | Ga0068866_100741222 | 198 |
| 131 | 3300005719 | Ga0068861_100002059 | Ga0068861_1000020594 | 198 |
| 132 | 3300005719 | Ga0068861_100073442 | Ga0068861_1000734424 | 198 |
| 133 | 3300005841 | Ga0068863_100001282 | Ga0068863_10000128222 | 198 |
| 134 | 3300005841 | Ga0068863_100003966 | Ga0068863_1000039666 | 198 |
| 135 | 3300005841 | Ga0068863_100183668 | Ga0068863_1001836683 | 198 |
| 136 | 3300005842 | Ga0068858_100011570 | Ga0068858_10001157011 | 198 |
| 137 | 3300005842 | Ga0068858_100015499 | Ga0068858_1000154996 | 198 |
| 138 | 3300005842 | Ga0068858_100805532 | Ga0068858_1008055321 | 198 |
| 139 | 3300005843 | Ga0068860_100000127 | Ga0068860_10000012763 | 198 |
| 140 | 3300005843 | Ga0068860_100008110 | Ga0068860_1000081108 | 198 |
| 141 | 3300005843 | Ga0068860_100072044 | Ga0068860_1000720441 | 198 |
| 142 | 3300005843 | Ga0068860_100140177 | Ga0068860_1001401773 | 198 |
| 143 | 3300005844 | Ga0068862_100000052 | Ga0068862_10000005278 | 198 |
| 144 | 3300005844 | Ga0068862_100028247 | Ga0068862_1000282476 | 198 |
| 145 | 3300005844 | Ga0068862_100073627 | Ga0068862_1000736273 | 198 |
| 146 | 3300005937 | Ga0081455_10013790 | Ga0081455_100137908 | 198 |
| 147 | 3300006038 | Ga0075365_10085563 | Ga0075365_100855632 | 198 |
| 148 | 3300006038 | Ga0075365_10089023 | Ga0075365_100890233 | 198 |
| 149 | 3300006038 | Ga0075365_10134475 | Ga0075365_101344753 | 198 |
| 150 | 3300006048 | Ga0075363_100006604 | Ga0075363_1000066047 | 198 |
| 151 | 3300006048 | Ga0075363_100013738 | Ga0075363_1000137384 | 198 |
| 152 | 3300006048 | Ga0075363_100023622 | Ga0075363_1000236223 | 198 |
| 153 | 3300006048 | Ga0075363_100056693 | Ga0075363_1000566931 | 198 |
| 154 | 3300006048 | Ga0075363_100065906 | Ga0075363_1000659062 | 198 |
| 155 | 3300006048 | Ga0075363_100071350 | Ga0075363_1000713502 | 198 |
| 156 | 3300006048 | Ga0075363_100095308 | Ga0075363_1000953082 | 198 |
| 157 | 3300006048 | Ga0075363_100299646 | Ga0075363_1002996462 | 198 |
| 158 | 3300006048 | Ga0075363_100365128 | Ga0075363_1003651282 | 198 |
| 159 | 3300006051 | Ga0075364_10005662 | Ga0075364_100056627 | 198 |
| 160 | 3300006051 | Ga0075364_10007711 | Ga0075364_100077113 | 198 |
| 161 | 3300006051 | Ga0075364_10020279 | Ga0075364_100202796 | 198 |
| 162 | 3300006051 | Ga0075364_10031438 | Ga0075364_100314385 | 198 |
| 163 | 3300006051 | Ga0075364_10045093 | Ga0075364_100450932 | 198 |
| 164 | 3300006051 | Ga0075364_10137128 | Ga0075364_101371282 | 198 |
| 165 | 3300006173 | Ga0070716_100014974 | Ga0070716_1000149744 | 198 |
| 166 | 3300006175 | Ga0070712_100019330 | Ga0070712_1000193303 | 198 |
| 167 | 3300006175 | Ga0070712_100048619 | Ga0070712_1000486191 | 198 |
| 168 | 3300006177 | Ga0075362_10050307 | Ga0075362_100503072 | 198 |
| 169 | 3300006177 | Ga0075362_10066849 | Ga0075362_100668492 | 198 |
| 170 | 3300006177 | Ga0075362_10221904 | Ga0075362_102219042 | 198 |
| 171 | 3300006178 | Ga0075367_10028997 | Ga0075367_100289973 | 198 |
| 172 | 3300006178 | Ga0075367_10054198 | Ga0075367_100541982 | 198 |
| 173 | 3300006178 | Ga0075367_10125645 | Ga0075367_101256453 | 198 |
| 174 | 3300006186 | Ga0075369_10004739 | Ga0075369_100047392 | 198 |
| 175 | 3300006186 | Ga0075369_10008590 | Ga0075369_100085902 | 198 |
| 176 | 3300006186 | Ga0075369_10085012 | Ga0075369_100850122 | 198 |
| 177 | 3300006186 | Ga0075369_10158723 | Ga0075369_101587232 | 198 |
| 178 | 3300006195 | Ga0075366_10236581 | Ga0075366_102365811 | 198 |
| 179 | 3300006353 | Ga0075370_10001453 | Ga0075370_100014538 | 198 |
| 180 | 3300006353 | Ga0075370_10019258 | Ga0075370_100192581 | 198 |
| 181 | 3300006353 | Ga0075370_10021785 | Ga0075370_100217853 | 198 |
| 182 | 3300006353 | Ga0075370_10155733 | Ga0075370_101557331 | 198 |
| 183 | 3300006353 | Ga0075370_10205736 | Ga0075370_102057362 | 198 |
| 184 | 3300006844 | Ga0075428_100005457 | Ga0075428_1000054573 | 198 |
| 185 | 3300006846 | Ga0075430_100455820 | Ga0075430_1004558201 | 198 |
| 186 | 3300006847 | Ga0075431_100174664 | Ga0075431_1001746642 | 198 |
| 187 | 3300006881 | Ga0068865_100033143 | Ga0068865_1000331434 | 198 |
| 188 | 3300006931 | Ga0097620_100000223 | Ga0097620_10000022318 | 198 |
| 189 | 3300006931 | Ga0097620_100008823 | Ga0097620_1000088239 | 198 |
| 190 | 3300006931 | Ga0097620_100113717 | Ga0097620_1001137173 | 198 |
| 191 | 3300007076 | Ga0075435_101079922 | Ga0075435_1010799221 | 198 |
| 192 | 3300009094 | Ga0111539_10256005 | Ga0111539_102560052 | 198 |
| 193 | 3300009098 | Ga0105245_10739475 | Ga0105245_107394751 | 198 |
| 194 | 3300009098 | Ga0105245_10812132 | Ga0105245_108121322 | 198 |
| 195 | 3300009101 | Ga0105247_10000066 | Ga0105247_1000006652 | 198 |
| 196 | 3300009101 | Ga0105247_10071029 | Ga0105247_100710293 | 198 |
| 197 | 3300009101 | Ga0105247_10075075 | Ga0105247_100750752 | 198 |
| 198 | 3300009147 | Ga0114129_10077725 | Ga0114129_100777254 | 198 |
| 199 | 3300009148 | Ga0105243_10005180 | Ga0105243_100051806 | 198 |
| 200 | 3300009148 | Ga0105243_10158367 | Ga0105243_101583673 | 198 |
| 201 | 3300009174 | Ga0105241_10596877 | Ga0105241_105968771 | 198 |
| 202 | 3300009176 | Ga0105242_10001265 | Ga0105242_100012656 | 198 |
| 203 | 3300009176 | Ga0105242_10553813 | Ga0105242_105538131 | 198 |
| 204 | 3300009177 | Ga0105248_10000144 | Ga0105248_1000014418 | 198 |
| 205 | 3300009177 | Ga0105248_10025545 | Ga0105248_100255457 | 198 |
| 206 | 3300009177 | Ga0105248_10594467 | Ga0105248_105944672 | 198 |
| 207 | 3300009545 | Ga0105237_10233829 | Ga0105237_102338292 | 198 |
| 208 | 3300009545 | Ga0105237_10366623 | Ga0105237_103666232 | 198 |
| 209 | 3300009545 | Ga0105237_10785112 | Ga0105237_107851122 | 198 |
| 210 | 3300009551 | Ga0105238_10195401 | Ga0105238_101954013 | 198 |
| 211 | 3300009553 | Ga0105249_10000093 | Ga0105249_1000009353 | 198 |
| 212 | 3300009553 | Ga0105249_10010343 | Ga0105249_1001034311 | 198 |
| 213 | 3300009553 | Ga0105249_10017377 | Ga0105249_100173775 | 198 |
| 214 | 3300009553 | Ga0105249_10067733 | Ga0105249_100677334 | 198 |
| 215 | 3300009553 | Ga0105249_10784709 | Ga0105249_107847092 | 198 |
| 216 | 3300010159 | Ga0099796_10087690 | Ga0099796_100876902 | 198 |
| 217 | 3300010375 | Ga0105239_10065105 | Ga0105239_100651052 | 198 |
| 218 | 3300010375 | Ga0105239_10083690 | Ga0105239_100836904 | 198 |
| 219 | 3300010375 | Ga0105239_10098380 | Ga0105239_100983805 | 198 |
| 220 | 3300011119 | Ga0105246_10008144 | Ga0105246_100081446 | 198 |
| 221 | 3300013105 | Ga0157369_10784791 | Ga0157369_107847911 | 198 |
| 222 | 3300013296 | Ga0157374_10138778 | Ga0157374_101387783 | 198 |
| 223 | 3300013296 | Ga0157374_10510725 | Ga0157374_105107251 | 198 |
| 224 | 3300013297 | Ga0157378_10005801 | Ga0157378_100058017 | 198 |
| 225 | 3300013297 | Ga0157378_10043286 | Ga0157378_100432863 | 198 |
| 226 | 3300013306 | Ga0163162_10083823 | Ga0163162_100838232 | 198 |
| 227 | 3300013306 | Ga0163162_10157947 | Ga0163162_101579473 | 198 |
| 228 | 3300013306 | Ga0163162_10312469 | Ga0163162_103124692 | 198 |
| 229 | 3300013306 | Ga0163162_10351783 | Ga0163162_103517832 | 198 |
| 230 | 3300013306 | Ga0163162_10565186 | Ga0163162_105651863 | 198 |
| 231 | 3300013307 | Ga0157372_10023638 | Ga0157372_100236382 | 198 |
| 232 | 3300013307 | Ga0157372_10597592 | Ga0157372_105975921 | 198 |
| 233 | 3300013308 | Ga0157375_10021798 | Ga0157375_100217986 | 198 |
| 234 | 3300013308 | Ga0157375_10033105 | Ga0157375_100331055 | 198 |
| 235 | 3300013308 | Ga0157375_10485297 | Ga0157375_104852973 | 198 |
| 236 | 3300014325 | Ga0163163_10077208 | Ga0163163_100772084 | 198 |
| 237 | 3300014325 | Ga0163163_10123874 | Ga0163163_101238745 | 198 |
| 238 | 3300014326 | Ga0157380_10004282 | Ga0157380_1000428211 | 198 |
| 239 | 3300014326 | Ga0157380_10533748 | Ga0157380_105337482 | 198 |
| 240 | 3300014497 | Ga0182008_10061117 | Ga0182008_100611173 | 198 |
| 241 | 3300014968 | Ga0157379_10016326 | Ga0157379_100163266 | 198 |
| 242 | 3300014968 | Ga0157379_10025675 | Ga0157379_100256755 | 198 |
| 243 | 3300017792 | Ga0163161_10015015 | Ga0163161_100150155 | 198 |
| 244 | 3300017792 | Ga0163161_10026591 | Ga0163161_100265915 | 198 |
| 245 | 3300017792 | Ga0163161_10143081 | Ga0163161_101430811 | 198 |
| 246 | 3300021384 | Ga0213876_10313239 | Ga0213876_103132391 | 198 |
| 247 | 3300025885 | Ga0207653_10023312 | Ga0207653_100233122 | 198 |
| 248 | 3300025898 | Ga0207692_10066928 | Ga0207692_100669282 | 198 |
| 249 | 3300025899 | Ga0207642_10000575 | Ga0207642_1000057511 | 198 |
| 250 | 3300025899 | Ga0207642_10116703 | Ga0207642_101167032 | 198 |
| 251 | 3300025900 | Ga0207710_10000090 | Ga0207710_1000009052 | 198 |
| 252 | 3300025900 | Ga0207710_10011885 | Ga0207710_100118853 | 198 |
| 253 | 3300025900 | Ga0207710_10072953 | Ga0207710_100729532 | 198 |
| 254 | 3300025901 | Ga0207688_10140344 | Ga0207688_101403443 | 198 |
| 255 | 3300025904 | Ga0207647_10070846 | Ga0207647_100708462 | 198 |
| 256 | 3300025906 | Ga0207699_10067524 | Ga0207699_100675243 | 198 |
| 257 | 3300025906 | Ga0207699_10293131 | Ga0207699_102931312 | 198 |
| 258 | 3300025907 | Ga0207645_10055165 | Ga0207645_100551653 | 198 |
| 259 | 3300025907 | Ga0207645_10088521 | Ga0207645_100885211 | 198 |
| 260 | 3300025914 | Ga0207671_10385702 | Ga0207671_103857022 | 198 |
| 261 | 3300025915 | Ga0207693_10000428 | Ga0207693_1000042831 | 198 |
| 262 | 3300025915 | Ga0207693_10003739 | Ga0207693_1000373913 | 198 |
| 263 | 3300025916 | Ga0207663_10461405 | Ga0207663_104614051 | 198 |
| 264 | 3300025916 | Ga0207663_10578995 | Ga0207663_105789952 | 198 |
| 265 | 3300025917 | Ga0207660_10067205 | Ga0207660_100672052 | 198 |
| 266 | 3300025918 | Ga0207662_10106023 | Ga0207662_101060231 | 198 |
| 267 | 3300025919 | Ga0207657_10110869 | Ga0207657_101108693 | 198 |
| 268 | 3300025920 | Ga0207649_10192964 | Ga0207649_101929642 | 198 |
| 269 | 3300025923 | Ga0207681_10009333 | Ga0207681_100093335 | 198 |
| 270 | 3300025923 | Ga0207681_10023815 | Ga0207681_100238155 | 198 |
| 271 | 3300025924 | Ga0207694_10091957 | Ga0207694_100919572 | 198 |
| 272 | 3300025926 | Ga0207659_10053405 | Ga0207659_100534054 | 198 |
| 273 | 3300025926 | Ga0207659_10710127 | Ga0207659_107101271 | 198 |
| 274 | 3300025927 | Ga0207687_10012498 | Ga0207687_100124988 | 198 |
| 275 | 3300025927 | Ga0207687_10135411 | Ga0207687_101354113 | 198 |
| 276 | 3300025931 | Ga0207644_10069103 | Ga0207644_100691034 | 198 |
| 277 | 3300025931 | Ga0207644_10538101 | Ga0207644_105381012 | 198 |
| 278 | 3300025932 | Ga0207690_10022015 | Ga0207690_100220155 | 198 |
| 279 | 3300025932 | Ga0207690_10045255 | Ga0207690_100452554 | 198 |
| 280 | 3300025933 | Ga0207706_10001922 | Ga0207706_100019222 | 198 |
| 281 | 3300025933 | Ga0207706_10005781 | Ga0207706_100057817 | 198 |
| 282 | 3300025934 | Ga0207686_10010548 | Ga0207686_100105486 | 198 |
| 283 | 3300025935 | Ga0207709_10002942 | Ga0207709_100029425 | 198 |
| 284 | 3300025935 | Ga0207709_10084979 | Ga0207709_100849794 | 198 |
| 285 | 3300025935 | Ga0207709_10092748 | Ga0207709_100927483 | 198 |
| 286 | 3300025936 | Ga0207670_10050743 | Ga0207670_100507433 | 198 |
| 287 | 3300025936 | Ga0207670_10245607 | Ga0207670_102456072 | 198 |
| 288 | 3300025937 | Ga0207669_10001292 | Ga0207669_100012927 | 198 |
| 289 | 3300025938 | Ga0207704_10005436 | Ga0207704_100054368 | 198 |
| 290 | 3300025939 | Ga0207665_10008506 | Ga0207665_100085067 | 198 |
| 291 | 3300025939 | Ga0207665_10018260 | Ga0207665_100182602 | 198 |
| 292 | 3300025940 | Ga0207691_10113196 | Ga0207691_101131963 | 198 |
| 293 | 3300025941 | Ga0207711_10000183 | Ga0207711_1000018363 | 198 |
| 294 | 3300025944 | Ga0207661_10354693 | Ga0207661_103546932 | 198 |
| 295 | 3300025949 | Ga0207667_11018917 | Ga0207667_110189172 | 198 |
| 296 | 3300025960 | Ga0207651_10607915 | Ga0207651_106079151 | 198 |
| 297 | 3300025961 | Ga0207712_10000073 | Ga0207712_1000007353 | 198 |
| 298 | 3300025961 | Ga0207712_10030405 | Ga0207712_100304054 | 198 |
| 299 | 3300025961 | Ga0207712_10428225 | Ga0207712_104282251 | 198 |
| 300 | 3300025972 | Ga0207668_10000804 | Ga0207668_1000080416 | 198 |
| 301 | 3300025972 | Ga0207668_10005657 | Ga0207668_100056574 | 198 |
| 302 | 3300025972 | Ga0207668_10225298 | Ga0207668_102252982 | 198 |
| 303 | 3300025972 | Ga0207668_10438795 | Ga0207668_104387951 | 198 |
| 304 | 3300025981 | Ga0207640_10127817 | Ga0207640_101278171 | 198 |
| 305 | 3300025981 | Ga0207640_10175390 | Ga0207640_101753902 | 198 |
| 306 | 3300025981 | Ga0207640_11131171 | Ga0207640_111311711 | 198 |
| 307 | 3300025986 | Ga0207658_10000304 | Ga0207658_1000030422 | 198 |
| 308 | 3300025986 | Ga0207658_10008729 | Ga0207658_100087296 | 198 |
| 309 | 3300025986 | Ga0207658_10336223 | Ga0207658_103362232 | 198 |
| 310 | 3300025986 | Ga0207658_10350038 | Ga0207658_103500382 | 198 |
| 311 | 3300025986 | Ga0207658_10617685 | Ga0207658_106176851 | 198 |
| 312 | 3300026023 | Ga0207677_10020820 | Ga0207677_100208205 | 198 |
| 313 | 3300026023 | Ga0207677_10025297 | Ga0207677_100252974 | 198 |
| 314 | 3300026035 | Ga0207703_10016203 | Ga0207703_100162035 | 198 |
| 315 | 3300026035 | Ga0207703_10034314 | Ga0207703_100343144 | 198 |
| 316 | 3300026035 | Ga0207703_11169748 | Ga0207703_111697482 | 198 |
| 317 | 3300026067 | Ga0207678_10017856 | Ga0207678_100178565 | 198 |
| 318 | 3300026067 | Ga0207678_10159080 | Ga0207678_101590803 | 198 |
| 319 | 3300026067 | Ga0207678_10396601 | Ga0207678_103966011 | 198 |
| 320 | 3300026075 | Ga0207708_10001568 | Ga0207708_1000156813 | 198 |
| 321 | 3300026075 | Ga0207708_10027129 | Ga0207708_100271292 | 198 |
| 322 | 3300026088 | Ga0207641_10000413 | Ga0207641_100004136 | 198 |
| 323 | 3300026088 | Ga0207641_10027640 | Ga0207641_100276403 | 198 |
| 324 | 3300026088 | Ga0207641_10174931 | Ga0207641_101749312 | 198 |
| 325 | 3300026089 | Ga0207648_10017088 | Ga0207648_100170886 | 198 |
| 326 | 3300026089 | Ga0207648_10028388 | Ga0207648_100283882 | 198 |
| 327 | 3300026095 | Ga0207676_10833429 | Ga0207676_108334292 | 198 |
| 328 | 3300026118 | Ga0207675_100000876 | Ga0207675_10000087630 | 198 |
| 329 | 3300026118 | Ga0207675_100021869 | Ga0207675_1000218693 | 198 |
| 330 | 3300026118 | Ga0207675_100244324 | Ga0207675_1002443243 | 198 |
| 331 | 3300026121 | Ga0207683_10001137 | Ga0207683_1000113725 | 198 |
| 332 | 3300026142 | Ga0207698_10091578 | Ga0207698_100915782 | 198 |
| 333 | 3300026142 | Ga0207698_10116832 | Ga0207698_101168322 | 198 |
| 334 | 3300027907 | Ga0207428_10588650 | Ga0207428_105886501 | 198 |
| 335 | 3300028379 | Ga0268266_10052494 | Ga0268266_100524941 | 198 |
| 336 | 3300028379 | Ga0268266_10082887 | Ga0268266_100828873 | 198 |
| 337 | 3300028379 | Ga0268266_10108114 | Ga0268266_101081142 | 198 |
| 338 | 3300028380 | Ga0268265_10000063 | Ga0268265_1000006378 | 198 |
| 339 | 3300028380 | Ga0268265_10270093 | Ga0268265_102700932 | 198 |
| 340 | 3300028381 | Ga0268264_10000007 | Ga0268264_1000000763 | 198 |
| 341 | 3300028381 | Ga0268264_10022353 | Ga0268264_100223531 | 198 |
| 342 | 3300028381 | Ga0268264_10119260 | Ga0268264_101192603 | 198 |
| 343 | 3300031852 | Ga0307410_10523279 | Ga0307410_105232791 | 198 |
| 344 | 3300031901 | Ga0307406_10067866 | Ga0307406_100678662 | 198 |
| 345 | 3300035241 | Ga0373961_0162226 | Ga0373961_0162226_10_669 | 198 |
| 346 | 3300035691 | Ga0373931_0120332 | Ga0373931_0120332_44_703 | 198 |
| 347 | 3300037853 | Ga0436364_0218929 | Ga0436364_0218929_6010_6606 | 198 |
| 348 | 3300039437 | Ga0436365_1302860 | Ga0436365_1302860_36_632 | 198 |
| 349 | 3300039437 | Ga0436365_1319574 | Ga0436365_1319574_1707_2318 | 198 |
| 350 | 3300041410 | Ga0439461_0025583 | Ga0439461_0025583_23_661 | 198 |
| 351 | 3300041411 | Ga0439466_0012644 | Ga0439466_0012644_2326_2964 | 198 |
| 352 | 3300041411 | Ga0439466_0018266 | Ga0439466_0018266_1207_1881 | 198 |
| 353 | 3300041413 | Ga0439465_0127072 | Ga0439465_0127072_83_757 | 198 |
| 354 | 3300041511 | Ga0451855_1772296 | Ga0451855_1772296_239_895 | 198 |
| 355 | 3300041997 | Ga0439431_0144666 | Ga0439431_0144666_23_661 | 198 |
| 356 | 3300042004 | Ga0439445_0013044 | Ga0439445_0013044_580_1254 | 198 |
| 357 | 3300042005 | Ga0439448_0063764 | Ga0439448_0063764_374_1012 | 198 |
| 358 | 3300042435 | Ga0439434_0024358 | Ga0439434_0024358_573_1247 | 198 |
| 359 | 3300042435 | Ga0439434_0071524 | Ga0439434_0071524_334_972 | 198 |
| 360 | 3300044658 | Ga0466972_0025438 | Ga0466972_0025438_329_967 | 198 |
| 361 | 3300044735 | Ga0466968_0201137 | Ga0466968_0201137_91_729 | 198 |
| 362 | 3300044842 | Ga0466957_0026915 | Ga0466957_0026915_1914_2552 | 198 |
| 363 | 3300044901 | Ga0466960_0018037 | Ga0466960_0018037_1844_2482 | 198 |
| 364 | 3300045976 | Ga0466967_0007445 | Ga0466967_0007445_5281_5919 | 198 |
| 365 | 3300046455 | Ga0495603_0265882 | Ga0495603_0265882_44_664 | 198 |
| 366 | 3300046459 | Ga0495629_0011744 | Ga0495629_0011744_217_837 | 198 |
| 367 | 3300046460 | Ga0495638_0001056 | Ga0495638_0001056_14023_14643 | 198 |
| 368 | 3300046463 | Ga0495653_0031275 | Ga0495653_0031275_542_1156 | 198 |
| 369 | 3300046473 | Ga0495582_0064233 | Ga0495582_0064233_736_1356 | 198 |
| 370 | 3300046476 | Ga0495662_0367136 | Ga0495662_0367136_22_642 | 198 |
| 371 | 3300046506 | Ga0495583_0248818 | Ga0495583_0248818_29_655 | 198 |
| 372 | 3300046517 | Ga0495630_0114797 | Ga0495630_0114797_635_1249 | 198 |
| 373 | 3300046531 | Ga0495665_0355783 | Ga0495665_0355783_73_693 | 198 |
| 374 | 3300046533 | Ga0495640_0095527 | Ga0495640_0095527_860_1480 | 198 |
| 375 | 3300046535 | Ga0495586_0305544 | Ga0495586_0305544_237_857 | 198 |
| 376 | 3300046559 | Ga0495667_0151162 | Ga0495667_0151162_561_1181 | 198 |
| 377 | 3300046616 | Ga0495668_0118527 | Ga0495668_0118527_167_787 | 198 |
| 378 | 3300046660 | Ga0495625_0204006 | Ga0495625_0204006_75_695 | 198 |
| 379 | 3300046675 | Ga0495657_0090627 | Ga0495657_0090627_919_1533 | 198 |
| 380 | 3300046694 | Ga0495649_0045101 | Ga0495649_0045101_1687_2307 | 198 |
| 381 | 3300046809 | Ga0495600_0103642 | Ga0495600_0103642_480_1094 | 198 |
| 382 | 3300046810 | Ga0495660_0263985 | Ga0495660_0263985_108_764 | 198 |
| 383 | 3300047315 | Ga0495581_0067137 | Ga0495581_0067137_430_1050 | 198 |
| 384 | 3300047317 | Ga0495604_0167185 | Ga0495604_0167185_760_1380 | 198 |
| 385 | 3300047319 | Ga0495674_0153209 | Ga0495674_0153209_1065_1685 | 198 |
| 386 | 3300047320 | Ga0495672_0021028 | Ga0495672_0021028_2374_3012 | 198 |
| 387 | 3300047320 | Ga0495672_0119899 | Ga0495672_0119899_379_1005 | 198 |
| 388 | 3300048903 | Ga0496100_0025472 | Ga0496100_0025472_2367_3077 | 198 |
| 389 | 3300048903 | Ga0496100_0101067 | Ga0496100_0101067_1105_1755 | 198 |
| 390 | 3300048904 | Ga0496101_0007372 | Ga0496101_0007372_5696_6346 | 198 |
| 391 | 3300048904 | Ga0496101_0273729 | Ga0496101_0273729_309_1019 | 198 |
| 392 | 3300048905 | Ga0496102_0000168 | Ga0496102_0000168_57846_58466 | 198 |
| 393 | 3300048905 | Ga0496102_0001819 | Ga0496102_0001819_10647_11357 | 198 |
| 394 | 3300048905 | Ga0496102_0055058 | Ga0496102_0055058_2919_3587 | 198 |
| 395 | 3300048905 | Ga0496102_0576384 | Ga0496102_0576384_267_905 | 198 |
| 396 | 3300048906 | Ga0496103_0000550 | Ga0496103_0000550_12203_12823 | 198 |
| 397 | 3300048906 | Ga0496103_0002065 | Ga0496103_0002065_4682_5392 | 198 |
| 398 | 3300048907 | Ga0496104_0589941 | Ga0496104_0589941_11_670 | 198 |
| 399 | 3300048908 | Ga0496105_0181249 | Ga0496105_0181249_46_684 | 198 |
| 400 | 3300048908 | Ga0496105_0262294 | Ga0496105_0262294_707_1366 | 198 |
| 401 | 3300048909 | Ga0496106_0017361 | Ga0496106_0017361_261_971 | 198 |
| 402 | 3300048909 | Ga0496106_0051295 | Ga0496106_0051295_664_1323 | 198 |
| 403 | 3300048909 | Ga0496106_0115196 | Ga0496106_0115196_105_755 | 198 |
| 404 | 3300048909 | Ga0496106_0759995 | Ga0496106_0759995_23_679 | 198 |
| 405 | 3300048910 | Ga0496107_0015968 | Ga0496107_0015968_148_858 | 198 |
| 406 | 3300048910 | Ga0496107_0032518 | Ga0496107_0032518_2836_3486 | 198 |
| 407 | 3300048910 | Ga0496107_0309520 | Ga0496107_0309520_324_980 | 198 |
| 408 | 3300048910 | Ga0496107_0434793 | Ga0496107_0434793_294_953 | 198 |
| 409 | 3300048911 | Ga0496108_0000223 | Ga0496108_0000223_32016_32675 | 198 |
| 410 | 3300048911 | Ga0496108_0067427 | Ga0496108_0067427_2106_2762 | 198 |
| 411 | 3300048912 | Ga0496109_0020947 | Ga0496109_0020947_31_690 | 198 |
| 412 | 3300048912 | Ga0496109_0060320 | Ga0496109_0060320_1545_2201 | 198 |
| 413 | 3300048912 | Ga0496109_0808242 | Ga0496109_0808242_24_692 | 198 |
| 414 | 3300048913 | Ga0496110_0171341 | Ga0496110_0171341_1072_1728 | 198 |
| 415 | 3300048913 | Ga0496110_0640225 | Ga0496110_0640225_283_942 | 198 |
| 416 | 3300048915 | Ga0496112_0004133 | Ga0496112_0004133_7272_7910 | 198 |
| 417 | 3300048915 | Ga0496112_0024856 | Ga0496112_0024856_4753_5409 | 198 |
| 418 | 3300048916 | Ga0496113_0033773 | Ga0496113_0033773_2815_3453 | 198 |
| 419 | 3300048916 | Ga0496113_0049411 | Ga0496113_0049411_1816_2472 | 198 |
| 420 | 3300048916 | Ga0496113_0068065 | Ga0496113_0068065_43_702 | 198 |
| 421 | 3300048917 | Ga0496114_0018865 | Ga0496114_0018865_2291_3001 | 198 |
| 422 | 3300048917 | Ga0496114_0057404 | Ga0496114_0057404_1388_2047 | 198 |
| 423 | 3300048918 | Ga0496115_0604152 | Ga0496115_0604152_29_685 | 198 |
| 424 | 3300048920 | Ga0496117_0000869 | Ga0496117_0000869_30078_30698 | 198 |
| 425 | 3300048921 | Ga0496118_0000171 | Ga0496118_0000171_40394_41014 | 198 |
| 426 | 3300048922 | Ga0496119_0017669 | Ga0496119_0017669_495_1115 | 198 |
| 427 | 3300048924 | Ga0496121_0013171 | Ga0496121_0013171_6678_7328 | 198 |
| 428 | 3300048927 | Ga0496124_0084821 | Ga0496124_0084821_1818_2438 | 198 |
| 429 | 3300048928 | Ga0496125_0020492 | Ga0496125_0020492_3757_4407 | 198 |
| 430 | 3300048929 | Ga0496126_0005442 | Ga0496126_0005442_5720_6370 | 198 |
| 431 | 3300049586 | Ga0501070_0490708 | Ga0501070_0490708_215_835 | 198 |
| 432 | 3300049742 | Ga0501080_0145210 | Ga0501080_0145210_1115_1735 | 198 |
| 433 | 3300050490 | nmdc:mga03n38_13639_c1 | nmdc:mga03n38_13639_c1_1019_1636 | 198 |
| 434 | 3300050490 | nmdc:mga03n38_26817_c1 | nmdc:mga03n38_26817_c1_666_1283 | 198 |
| 435 | 3300050490 | nmdc:mga03n38_44530_c1 | nmdc:mga03n38_44530_c1_397_1035 | 198 |
| 436 | 3300050490 | nmdc:mga03n38_7596_c1 | nmdc:mga03n38_7596_c1_2576_3232 | 198 |
| 437 | 3300050491 | nmdc:mga00v17_141698_c1 | nmdc:mga00v17_141698_c1_395_1012 | 198 |
| 438 | 3300050491 | nmdc:mga00v17_147144_c1 | nmdc:mga00v17_147144_c1_361_996 | 198 |
| 439 | 3300050491 | nmdc:mga00v17_21928_c1 | nmdc:mga00v17_21928_c1_1729_2346 | 198 |
| 440 | 3300050491 | nmdc:mga00v17_2306_c1 | nmdc:mga00v17_2306_c1_2855_3523 | 198 |
| 441 | 3300050491 | nmdc:mga00v17_260_c1 | nmdc:mga00v17_260_c1_29502_30140 | 198 |
| 442 | 3300050491 | nmdc:mga00v17_432888_c1 | nmdc:mga00v17_432888_c1_193_831 | 198 |
| 443 | 3300050492 | nmdc:mga0yw44_130684_c1 | nmdc:mga0yw44_130684_c1_678_1346 | 198 |
| 444 | 3300050492 | nmdc:mga0yw44_211674_c1 | nmdc:mga0yw44_211674_c1_528_1151 | 198 |
| 445 | 3300050492 | nmdc:mga0yw44_33275_c1 | nmdc:mga0yw44_33275_c1_1515_2162 | 198 |
| 446 | 3300050492 | nmdc:mga0yw44_67901_c1 | nmdc:mga0yw44_67901_c1_288_926 | 198 |
| 447 | 3300050493 | nmdc:mga0k408_111190_c1 | nmdc:mga0k408_111190_c1_484_1122 | 198 |
| 448 | 3300050494 | nmdc:mga06z11_139089_c1 | nmdc:mga06z11_139089_c1_20_640 | 198 |
| 449 | 3300050494 | nmdc:mga06z11_145050_c1 | nmdc:mga06z11_145050_c1_444_1082 | 198 |
| 450 | 3300050494 | nmdc:mga06z11_17661_c1 | nmdc:mga06z11_17661_c1_776_1393 | 198 |
| 451 | 3300050494 | nmdc:mga06z11_202363_c1 | nmdc:mga06z11_202363_c1_314_952 | 198 |
| 452 | 3300050496 | nmdc:mga07m45_205785_c1 | nmdc:mga07m45_205785_c1_512_1135 | 198 |
| 453 | 3300050496 | nmdc:mga07m45_211266_c1 | nmdc:mga07m45_211266_c1_322_960 | 198 |
| 454 | 3300050496 | nmdc:mga07m45_38224_c1 | nmdc:mga07m45_38224_c1_556_1173 | 198 |
| 455 | 3300050507 | nmdc:mga05p37_1121643_c1 | nmdc:mga05p37_1121643_c1_144_782 | 198 |
| 456 | 3300050507 | nmdc:mga05p37_214516_c1 | nmdc:mga05p37_214516_c1_337_975 | 198 |
| 457 | 3300050509 | nmdc:mga0qj67_472924_c1 | nmdc:mga0qj67_472924_c1_104_742 | 198 |
| 458 | 3300050510 | nmdc:mga06r32_161127_c1 | nmdc:mga06r32_161127_c1_1175_1813 | 198 |
| 459 | 3300050511 | nmdc:mga08y16_859511_c1 | nmdc:mga08y16_859511_c1_111_767 | 198 |
| 460 | 3300050516 | nmdc:mga0sz30_18694_c1 | nmdc:mga0sz30_18694_c1_294_932 | 198 |
| 461 | 3300050516 | nmdc:mga0sz30_1955_c1 | nmdc:mga0sz30_1955_c1_4755_5393 | 198 |
| 462 | 3300050516 | nmdc:mga0sz30_223918_c1 | nmdc:mga0sz30_223918_c1_180_818 | 198 |
| 463 | 3300053083 | Ga0495655_0009755 | Ga0495655_0009755_1110_1766 | 198 |
| 464 | 3300053084 | Ga0495595_0085128 | Ga0495595_0085128_859_1473 | 198 |
| 465 | 3300053104 | Ga0500556_0018092 | Ga0500556_0018092_1264_1884 | 198 |
| 466 | 3300053108 | Ga0500562_012179 | Ga0500562_012179_227_847 | 198 |
| 467 | 3300053139 | Ga0500568_0081606 | Ga0500568_0081606_304_924 | 198 |
| 468 | 3300053151 | Ga0500604_0069518 | Ga0500604_0069518_466_1086 | 198 |
| 469 | 3300053158 | Ga0500627_0068059 | Ga0500627_0068059_425_1045 | 198 |
| 470 | 3300053727 | Ga0500611_053902 | Ga0500611_053902_94_714 | 198 |
| 471 | 3300061734 | Ga0530510_0056351 | Ga0530510_0056351_191_841 | 198 |
| 472 | iso_pu_bacteria | 2929212328 | 2929216723 | 198 |
| 473 | 3300005435 | Ga0070714_100836877 | Ga0070714_1008368771 | 199 |
| 474 | 3300044765 | Ga0466970_0060060 | Ga0466970_0060060_1401_2006 | 199 |
| 475 | 3300039437 | Ga0436365_1352201 | Ga0436365_1352201_2601_3284 | 200 |
| 476 | 3300039437 | Ga0436365_0464410 | Ga0436365_0464410_4498_5106 | 202 |
| 477 | 3300046507 | Ga0495606_0354595 | Ga0495606_0354595_35_643 | 202 |
| 478 | iso_pu_bacteria | 2738541274 | 2738705743 | 202 |
| 479 | iso_pu_bacteria | 2738543028 | 2739330233 | 202 |
| 480 | iso_pu_bacteria | 2902799365 | 2902800084 | 202 |
| 481 | 3300006038 | Ga0075365_10049552 | Ga0075365_100495523 | 203 |
| 482 | 3300006051 | Ga0075364_10110545 | Ga0075364_101105453 | 203 |
| 483 | 3300006186 | Ga0075369_10256327 | Ga0075369_102563271 | 203 |
| 484 | 3300026041 | Ga0207639_10016205 | Ga0207639_100162054 | 203 |
| 485 | 3300044656 | Ga0466969_0088649 | Ga0466969_0088649_595_1206 | 203 |
| 486 | 3300044684 | Ga0466966_0008407 | Ga0466966_0008407_312_923 | 203 |
| 487 | 3300044693 | Ga0466961_0005701 | Ga0466961_0005701_6881_7492 | 203 |
| 488 | 3300044694 | Ga0466963_0041783 | Ga0466963_0041783_775_1452 | 203 |
| 489 | 3300044735 | Ga0466968_0043155 | Ga0466968_0043155_1205_1816 | 203 |
| 490 | 3300044842 | Ga0466957_0006255 | Ga0466957_0006255_5654_6265 | 203 |
| 491 | 3300045049 | Ga0466959_0003108 | Ga0466959_0003108_2553_3164 | 203 |
| 492 | 3300045836 | Ga0466958_0000569 | Ga0466958_0000569_7984_8595 | 203 |
| 493 | 3300047472 | Ga0495686_0038665 | Ga0495686_0038665_2100_2711 | 203 |
| 494 | 3300047472 | Ga0495686_0125386 | Ga0495686_0125386_503_1114 | 203 |
| 495 | 3300050492 | nmdc:mga0yw44_57308_c1 | nmdc:mga0yw44_57308_c1_342_953 | 203 |
| 496 | 3300053087 | Ga0500643_001380 | Ga0500643_001380_5370_5981 | 203 |
| 497 | 3300053153 | Ga0500616_0007077 | Ga0500616_0007077_6133_6744 | 203 |
| 498 | 3300021384 | Ga0213876_10006661 | Ga0213876_100066616 | 204 |
| 499 | 3300039437 | Ga0436365_1765865 | Ga0436365_1765865_8298_8999 | 204 |
| 500 | 3300005335 | Ga0070666_10200190 | Ga0070666_102001903 | 205 |
| 501 | 3300005356 | Ga0070674_100015666 | Ga0070674_1000156663 | 205 |
| 502 | 3300005466 | Ga0070685_10110263 | Ga0070685_101102632 | 205 |
| 503 | 3300009177 | Ga0105248_10286967 | Ga0105248_102869672 | 205 |
| 504 | 3300014968 | Ga0157379_10077493 | Ga0157379_100774933 | 205 |
| 505 | 3300025903 | Ga0207680_10505033 | Ga0207680_105050331 | 205 |
| 506 | 3300025937 | Ga0207669_10019081 | Ga0207669_100190813 | 205 |
| 507 | 3300025941 | Ga0207711_10243986 | Ga0207711_102439862 | 205 |
| 508 | 3300044901 | Ga0466960_0000688 | Ga0466960_0000688_4091_4714 | 205 |
| 509 | 3300048903 | Ga0496100_0005502 | Ga0496100_0005502_5060_5755 | 205 |
| 510 | 3300048904 | Ga0496101_0004333 | Ga0496101_0004333_6178_6873 | 205 |
| 511 | 3300048907 | Ga0496104_0001250 | Ga0496104_0001250_2291_2986 | 205 |
| 512 | 3300048908 | Ga0496105_0025816 | Ga0496105_0025816_2957_3652 | 205 |
| 513 | 3300048909 | Ga0496106_0001250 | Ga0496106_0001250_9051_9746 | 205 |
| 514 | 3300048910 | Ga0496107_0000831 | Ga0496107_0000831_574_1269 | 205 |
| 515 | 3300048912 | Ga0496109_0353927 | Ga0496109_0353927_758_1375 | 205 |
| 516 | 3300048917 | Ga0496114_0000320 | Ga0496114_0000320_14927_15622 | 205 |
| 517 | 3300048918 | Ga0496115_0008280 | Ga0496115_0008280_3019_3714 | 205 |
| 518 | 3300000546 | LJNas_1002176 | LJNas_10021763 | 206 |
| 519 | 3300005435 | Ga0070714_100668797 | Ga0070714_1006687971 | 206 |
| 520 | 3300006038 | Ga0075365_10144935 | Ga0075365_101449352 | 206 |
| 521 | 3300006186 | Ga0075369_10001688 | Ga0075369_100016884 | 206 |
| 522 | 3300006186 | Ga0075369_10006908 | Ga0075369_100069083 | 206 |
| 523 | 3300021384 | Ga0213876_10013586 | Ga0213876_100135863 | 206 |
| 524 | 3300021384 | Ga0213876_10050116 | Ga0213876_100501162 | 206 |
| 525 | 3300021388 | Ga0213875_10042878 | Ga0213875_100428781 | 206 |
| 526 | 3300025929 | Ga0207664_10639054 | Ga0207664_106390541 | 206 |
| 527 | 3300037853 | Ga0436364_0559448 | Ga0436364_0559448_4924_5625 | 206 |
| 528 | 3300039437 | Ga0436365_0456575 | Ga0436365_0456575_27134_27835 | 206 |
| 529 | 3300041413 | Ga0439465_0010197 | Ga0439465_0010197_1152_1910 | 206 |
| 530 | 3300042004 | Ga0439445_0002473 | Ga0439445_0002473_2625_3383 | 206 |
| 531 | 3300044658 | Ga0466972_0004838 | Ga0466972_0004838_3392_4057 | 206 |
| 532 | 3300044683 | Ga0466965_0001888 | Ga0466965_0001888_4833_5498 | 206 |
| 533 | 3300044694 | Ga0466963_0015491 | Ga0466963_0015491_3078_3797 | 206 |
| 534 | 3300044694 | Ga0466963_0298266 | Ga0466963_0298266_217_936 | 206 |
| 535 | 3300044735 | Ga0466968_0000457 | Ga0466968_0000457_4764_5429 | 206 |
| 536 | 3300044765 | Ga0466970_0005515 | Ga0466970_0005515_2273_2938 | 206 |
| 537 | 3300044842 | Ga0466957_0012416 | Ga0466957_0012416_1088_1753 | 206 |
| 538 | 3300044842 | Ga0466957_0013759 | Ga0466957_0013759_1684_2403 | 206 |
| 539 | 3300044901 | Ga0466960_0001536 | Ga0466960_0001536_5789_6454 | 206 |
| 540 | 3300044901 | Ga0466960_0002878 | Ga0466960_0002878_5531_6250 | 206 |
| 541 | 3300045049 | Ga0466959_0018065 | Ga0466959_0018065_1811_2476 | 206 |
| 542 | 3300045836 | Ga0466958_0042518 | Ga0466958_0042518_101_766 | 206 |
| 543 | 3300045976 | Ga0466967_0060633 | Ga0466967_0060633_1510_2229 | 206 |
| 544 | 3300045976 | Ga0466967_0079233 | Ga0466967_0079233_43_708 | 206 |
| 545 | 3300045976 | Ga0466967_0229774 | Ga0466967_0229774_1019_1738 | 206 |
| 546 | 3300046460 | Ga0495638_0068791 | Ga0495638_0068791_1053_1739 | 206 |
| 547 | 3300046460 | Ga0495638_0102273 | Ga0495638_0102273_913_1599 | 206 |
| 548 | 3300046557 | Ga0495622_0238536 | Ga0495622_0238536_56_742 | 206 |
| 549 | 3300048903 | Ga0496100_0033526 | Ga0496100_0033526_2001_2666 | 206 |
| 550 | 3300048904 | Ga0496101_0019605 | Ga0496101_0019605_556_1221 | 206 |
| 551 | 3300048915 | Ga0496112_0065410 | Ga0496112_0065410_1104_1769 | 206 |
| 552 | 3300048916 | Ga0496113_0016603 | Ga0496113_0016603_4128_4793 | 206 |
| 553 | 3300048918 | Ga0496115_0475300 | Ga0496115_0475300_29_715 | 206 |
| 554 | 3300048923 | Ga0496120_0094625 | Ga0496120_0094625_399_1064 | 206 |
| 555 | 3300048925 | Ga0496122_0036885 | Ga0496122_0036885_1787_2452 | 206 |
| 556 | 3300048926 | Ga0496123_0020808 | Ga0496123_0020808_2196_2861 | 206 |
| 557 | 3300048928 | Ga0496125_0053441 | Ga0496125_0053441_2533_3219 | 206 |
| 558 | 3300048928 | Ga0496125_0219837 | Ga0496125_0219837_328_993 | 206 |
| 559 | 3300048929 | Ga0496126_0006823 | Ga0496126_0006823_1686_2387 | 206 |
| 560 | 3300048929 | Ga0496126_0025483 | Ga0496126_0025483_3461_4126 | 206 |
| 561 | 3300049570 | Ga0501033_0516439 | Ga0501033_0516439_56_757 | 206 |
| 562 | 3300049571 | Ga0501034_0005982 | Ga0501034_0005982_11361_12080 | 206 |
| 563 | 3300049571 | Ga0501034_0293644 | Ga0501034_0293644_449_1186 | 206 |
| 564 | 3300049572 | Ga0501036_0661303 | Ga0501036_0661303_31_750 | 206 |
| 565 | 3300049573 | Ga0501037_0044169 | Ga0501037_0044169_488_1207 | 206 |
| 566 | 3300049580 | Ga0501046_0003366 | Ga0501046_0003366_2827_3546 | 206 |
| 567 | 3300049581 | Ga0501047_0027428 | Ga0501047_0027428_1636_2355 | 206 |
| 568 | 3300049582 | Ga0501048_0011970 | Ga0501048_0011970_2827_3546 | 206 |
| 569 | 3300049586 | Ga0501070_0001967 | Ga0501070_0001967_4585_5304 | 206 |
| 570 | 3300049822 | Ga0501035_0007575 | Ga0501035_0007575_2684_3403 | 206 |
| 571 | 3300049823 | Ga0501044_0000935 | Ga0501044_0000935_5377_6096 | 206 |
| 572 | 3300050491 | nmdc:mga00v17_85546_c1 | nmdc:mga00v17_85546_c1_907_1593 | 206 |
| 573 | 3300050492 | nmdc:mga0yw44_52524_c1 | nmdc:mga0yw44_52524_c1_336_1022 | 206 |
| 574 | 3300050516 | nmdc:mga0sz30_27919_c1 | nmdc:mga0sz30_27919_c1_1125_1811 | 206 |
| 575 | 3300050516 | nmdc:mga0sz30_28780_c1 | nmdc:mga0sz30_28780_c1_782_1468 | 206 |
| 576 | 3300053087 | Ga0500643_030047 | Ga0500643_030047_812_1498 | 206 |
| 577 | 3300053130 | Ga0500642_0038329 | Ga0500642_0038329_1118_1819 | 206 |
| 578 | 3300053158 | Ga0500627_0019443 | Ga0500627_0019443_844_1530 | 206 |
| 579 | 3300053730 | Ga0500645_000007 | Ga0500645_000007_22598_23284 | 206 |
| 580 | 3300053730 | Ga0500645_008205 | Ga0500645_008205_1660_2346 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zui-assembly1.cif.gz_A | crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid | 0.8572 | 14 | 90 |
| 3knw-assembly1.cif.gz_A | crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) | 0.7784 | 14 | 187 |
| 3knw-assembly1.cif.gz_B | crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) | 0.758 | 15 | 187 |
| 4kwa-assembly1.cif.gz_B | crystal structure of a putative transcriptional regulator from saccharomonospora viridis in complex with choline | 0.7534 | 15 | 187 |
| 3knw-assembly1.cif.gz_A | crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) | 0.7463 | 14 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2of7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9634 | 14 | 54 | 1.10.10.60 |
| 2y31A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.947 | 15 | 67 | 1.10.10.60 |
| 2y30B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9349 | 13 | 66 | 1.10.10.60 |
| 2y2zA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9331 | 15 | 67 | 1.10.10.60 |
| 3zqlD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9327 | 15 | 67 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6VQ08-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9512 | 15 | 134 |
GO:0000976
GO:0003700 |
| AF-X8C4E2-F1-model_v4 | deleted | 0.9231 | 18 | 199 |
|
| AF-A0A6H0S973-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9032 | 1 | 198 |
GO:0000976
GO:0003700 |
| AF-A0A7I7KWC5-F1-model_v4 | TetR family transcriptional regulator | 0.9003 | 1 | 195 |
GO:0000976
GO:0003700 |
| AF-A0A1G4V4M9-F1-model_v4 | Transcriptional regulator, TetR family | 0.9001 | 26 | 195 |
GO:0003677
GO:0006355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar