F466007

General Info

Members Datasets Scaffolds Average Seq Length
580 249 1160 174

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0193491|Ga0501047_0193491_865_1461
Length 198
Sequence MRPSPAPPARAVPRAPGTDAASSAHVLPDVLAPGLVLVFCGTAAGKRSAAEGAYYAHPGNLFWRALAEAGITPRRFAPQEFPLLPQLGIGLTDLAKRHSGNDDQLPPGAFDVPALAAKIERNAPRLLAFTSKNAARAALGHVIARYGPQDEAFGPARVFVLPSPSGQARGRWDLGPWLALGALYRRLRRQAAAQPRKR

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
75 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
230 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
231 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
232 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
233 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
234 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
235 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
236 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
237 2734482264 Dyella sp. AD052 Isolate Unclassified
238 2738543009 Luteibacter sp. OK325 Isolate Unclassified
239 2739367700 Dyella sp. YR388 Isolate Unclassified
240 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
241 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
242 2884411467 Dyella sp. AD56 Isolate Rhizosphere
243 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
244 2919085039 Luteibacter sp. 1214 Isolate Unclassified
245 2919404418 Luteibacter sp. 3190 Isolate Unclassified
246 2928963466 Dyella japonica 1073 Isolate Unclassified
247 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
248 2941471342 Luteibacter sp. 621 Isolate Unclassified
249 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 1.21
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.72
Nodule 0
Rhizoplane 1.9
Rhizosphere 65.17
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0193491 3300049581 Bacteria 1897
2 JGI24736J21556_1009175 3300001904 Bacteria 1636
3 JGI24740J21852_10014053 3300001979 Bacteria 2966
4 JGI24740J21852_10075340 3300001979 Bacteria 894
5 JGI24739J22299_10000118 3300001989 Bacteria 24899
6 JGI24737J22298_10001221 3300001990 Bacteria 9059
7 JGI24737J22298_10065931 3300001990 Bacteria 1085
8 JGI24735J21928_10030492 3300002067 Bacteria 1602
9 JGI24735J21928_10048387 3300002067 Bacteria 1230
10 JGI24738J21930_10034924 3300002075 Bacteria 1024
11 JGI24738J21930_10049666 3300002075 Unclassified 854
12 JGI25156J39149_1001202 3300002705 Bacteria 11469
13 JGI25156J39149_1001485 3300002705 Bacteria 9822
14 JGI25156J39149_1005444 3300002705 Bacteria 3667
15 JGI25156J39149_1021623 3300002705 Bacteria 1109
16 JGI25162J39368_1000434 3300002737 Bacteria 33632
17 JGI25162J39368_1001914 3300002737 Bacteria 9538
18 JGI25162J39368_1002093 3300002737 Bacteria 8539
19 JGI25162J39368_1002729 3300002737 Bacteria 6347
20 JGI25154J39366_1010309 3300002738 Bacteria 1112
21 JGI25157J39369_1000527 3300002741 Bacteria 23321
22 JGI25157J39369_1000572 3300002741 Bacteria 21913
23 JGI25157J39369_1000860 3300002741 Bacteria 14747
24 JGI25157J39369_1000944 3300002741 Bacteria 13694
25 JGI25157J39369_1001150 3300002741 Bacteria 11440
26 JGI25157J39369_1003026 3300002741 Bacteria 3667
27 JGI25157J39369_1012002 3300002741 Bacteria 1109
28 JGI25163J39215_1000622 3300002771 Bacteria 9724
29 JGI25164J39214_1000143 3300002772 Bacteria 68773
30 JGI25164J39214_1000312 3300002772 Bacteria 31934
31 JGI25164J39214_1000535 3300002772 Bacteria 17725
32 JGI25164J39214_1011449 3300002772 Bacteria 849
33 JGI25165J46597_1000257 3300003214 Bacteria 71080
34 JGI25165J46597_1000586 3300003214 Bacteria 31905
35 rootH1_10093510 3300003316 Bacteria 2465
36 rootH2_10137045 3300003320 Bacteria 1800
37 rootL2_10212903 3300003322 Bacteria 1690
38 rootH1_10375640 3300003323 Bacteria 1702
39 Ga0006562J51391_1018437 3300003578 Bacteria 12000
40 Ga0006562J51391_1018441 3300003578 Bacteria 1930
41 Ga0006562J51391_1075948 3300003578 Bacteria 5800
42 Ga0006562J51391_1075949 3300003578 Bacteria 2833
43 Ga0055538_1002632 3300003751 Bacteria 2547
44 Ga0055533_1000283 3300003756 Bacteria 26708
45 Ga0055525_1000111 3300003759 Bacteria 127836
46 Ga0055527_1000363 3300003760 Bacteria 21234
47 Ga0055527_1000432 3300003760 Bacteria 16833
48 Ga0055527_1001741 3300003760 Bacteria 4206
49 Ga0055535_1000390 3300003761 Bacteria 41593
50 Ga0055535_1000430 3300003761 Bacteria 39174
51 Ga0055535_1000869 3300003761 Bacteria 21233
52 Ga0055535_1000923 3300003761 Bacteria 19726
53 Ga0055535_1001073 3300003761 Bacteria 16833
54 Ga0055542_1000409 3300003762 Bacteria 41890
55 Ga0055542_1000540 3300003762 Bacteria 33632
56 Ga0055542_1000559 3300003762 Bacteria 32915
57 Ga0055542_1000629 3300003762 Bacteria 29615
58 Ga0055542_1000865 3300003762 Bacteria 21233
59 Ga0055542_1001072 3300003762 Bacteria 16833
60 Ga0055542_1010914 3300003762 Bacteria 1636
61 Ga0055529_1000211 3300003763 Bacteria 76826
62 Ga0055529_1000244 3300003763 Bacteria 66990
63 Ga0055529_1000280 3300003763 Bacteria 60448
64 Ga0055529_1000737 3300003763 Bacteria 21234
65 Ga0055529_1013331 3300003763 Bacteria 1046
66 Ga0065165_1000113 3300005262 Bacteria 135963
67 Ga0065165_1005347 3300005262 Bacteria 7290
68 Ga0070658_10001084 3300005327 Bacteria 23268
69 Ga0070666_10000018 3300005335 Bacteria 187218
70 Ga0070680_100870768 3300005336 Bacteria 777
71 Ga0070682_100116495 3300005337 Bacteria 1787
72 Ga0070682_100337552 3300005337 Bacteria 1119
73 Ga0070660_100015354 3300005339 Bacteria 5527
74 Ga0070660_100220485 3300005339 Bacteria 1541
75 Ga0070689_100006031 3300005340 Bacteria 8349
76 Ga0070661_100013038 3300005344 Bacteria 5828
77 Ga0070661_100363780 3300005344 Bacteria 1137
78 Ga0070661_100393602 3300005344 Unclassified 1094
79 Ga0070692_10016178 3300005345 Bacteria 3544
80 Ga0070659_100074507 3300005366 Bacteria 2704
81 Ga0070659_100363358 3300005366 Bacteria 1216
82 Ga0070659_101142372 3300005366 Bacteria 687
83 Ga0070667_100032024 3300005367 Bacteria 4384
84 Ga0070709_10130967 3300005434 Bacteria 1712
85 Ga0070714_100003062 3300005435 Bacteria 12403
86 Ga0070714_100012139 3300005435 Bacteria 6863
87 Ga0070714_100085598 3300005435 Bacteria 2753
88 Ga0070713_100008958 3300005436 Bacteria 7131
89 Ga0070710_10032219 3300005437 Bacteria 2838
90 Ga0070663_100053003 3300005455 Bacteria 2895
91 Ga0070663_100053108 3300005455 Bacteria 2892
92 Ga0070663_100241523 3300005455 Bacteria 1426
93 Ga0070663_100563614 3300005455 Bacteria 954
94 Ga0070663_100583513 3300005455 Unclassified 938
95 Ga0070663_100700258 3300005455 Unclassified 861
96 Ga0070662_100075947 3300005457 Bacteria 2489
97 Ga0070662_100852720 3300005457 Bacteria 776
98 Ga0070681_10011680 3300005458 Bacteria 8698
99 Ga0070681_10030069 3300005458 Bacteria 5450
100 Ga0070681_10967567 3300005458 Bacteria 771
101 Ga0070679_100039017 3300005530 Bacteria 4721
102 Ga0068853_100387278 3300005539 Bacteria 1306
103 Ga0068853_100638702 3300005539 Bacteria 1013
104 Ga0070696_100001026 3300005546 Bacteria 18027
105 Ga0070696_100107773 3300005546 Bacteria 2004
106 Ga0068855_100013790 3300005563 Bacteria 9743
107 Ga0068855_100046572 3300005563 Bacteria 5125
108 Ga0068855_100243506 3300005563 Bacteria 2008
109 Ga0068857_100000998 3300005577 Bacteria 21742
110 Ga0068857_100036672 3300005577 Bacteria 4344
111 Ga0068854_100001113 3300005578 Bacteria 16151
112 Ga0068854_100003601 3300005578 Bacteria 9691
113 Ga0068854_100024671 3300005578 Bacteria 4120
114 Ga0068854_100061134 3300005578 Bacteria 2727
115 Ga0068856_100000582 3300005614 Bacteria 39927
116 Ga0068856_100030736 3300005614 Bacteria 5251
117 Ga0068859_100183748 3300005617 Bacteria 2174
118 Ga0068851_10045776 3300005834 Bacteria 2212
119 Ga0068858_100003142 3300005842 Bacteria 16534
120 Ga0068858_100048183 3300005842 Bacteria 3949
121 Ga0068860_100431504 3300005843 Bacteria 1308
122 Ga0068862_100033999 3300005844 Bacteria 4312
123 Ga0097620_100183747 3300006931 Bacteria 2174
124 Ga0105240_10023357 3300009093 Bacteria 8180
125 Ga0105240_10038461 3300009093 Bacteria 6137
126 Ga0105240_10046303 3300009093 Bacteria 5512
127 Ga0105240_10113171 3300009093 Bacteria 3279
128 Ga0105247_10013285 3300009101 Bacteria 4942
129 Ga0105237_10000352 3300009545 Bacteria 64865
130 Ga0105237_10000675 3300009545 Bacteria 47159
131 Ga0105237_10104805 3300009545 Bacteria 2819
132 Ga0105238_10000319 3300009551 Bacteria 52428
133 Ga0105238_10134894 3300009551 Bacteria 2446
134 Ga0105238_10139480 3300009551 Bacteria 2402
135 Ga0105238_10158449 3300009551 Bacteria 2239
136 Ga0105238_10242673 3300009551 Bacteria 1779
137 Ga0105238_10434374 3300009551 Bacteria 1309
138 Ga0105238_10794666 3300009551 Bacteria 962
139 Ga0105239_10034580 3300010375 Bacteria 5550
140 Ga0105239_10051215 3300010375 Bacteria 4526
141 Ga0105239_10565946 3300010375 Bacteria 1295
142 Ga0157314_1000067 3300012500 Bacteria 10972
143 Ga0157373_10175488 3300013100 Bacteria 1508
144 Ga0157373_10220809 3300013100 Bacteria 1337
145 Ga0157373_10244559 3300013100 Bacteria 1268
146 Ga0157373_10350706 3300013100 Bacteria 1053
147 Ga0157371_10020571 3300013102 Bacteria 4856
148 Ga0157371_11044648 3300013102 Bacteria 625
149 Ga0157370_10005510 3300013104 Bacteria 14184
150 Ga0157370_10005522 3300013104 Bacteria 14176
151 Ga0157370_10020890 3300013104 Bacteria 6531
152 Ga0157370_10225550 3300013104 Bacteria 1735
153 Ga0157370_10385467 3300013104 Bacteria 1291
154 Ga0157370_10555975 3300013104 Bacteria 1052
155 Ga0157369_10013431 3300013105 Bacteria 9258
156 Ga0157369_10017478 3300013105 Bacteria 8059
157 Ga0157369_10077917 3300013105 Bacteria 3552
158 Ga0163162_10001986 3300013306 Bacteria 19222
159 Ga0163162_10044158 3300013306 Bacteria 4463
160 Ga0157372_10078548 3300013307 Bacteria 3729
161 Ga0157372_10187634 3300013307 Bacteria 2394
162 Ga0157372_10579649 3300013307 Bacteria 1308
163 Ga0157372_11580578 3300013307 Bacteria 755
164 Ga0182008_10024600 3300014497 Bacteria 3064
165 Ga0182008_10104256 3300014497 Bacteria 1403
166 Ga0182008_10117096 3300014497 Bacteria 1322
167 Ga0182008_10128417 3300014497 Bacteria 1263
168 Ga0182008_10175347 3300014497 Bacteria 1083
169 Ga0182006_1000223 3300015261 Bacteria 55257
170 Ga0182006_1030240 3300015261 Bacteria 2189
171 Ga0182006_1041204 3300015261 Bacteria 1814
172 Ga0182007_10017898 3300015262 Bacteria 2579
173 Ga0182007_10020699 3300015262 Bacteria 2347
174 Ga0182007_10056977 3300015262 Bacteria 1283
175 Ga0182007_10070933 3300015262 Bacteria 1141
176 Ga0182007_10094659 3300015262 Bacteria 985
177 Ga0182007_10100133 3300015262 Bacteria 959
178 Ga0182005_1000228 3300015265 Bacteria 36744
179 Ga0182005_1004950 3300015265 Bacteria 4223
180 Ga0182005_1014663 3300015265 Bacteria 2192
181 Ga0182005_1047758 3300015265 Bacteria 1163
182 Ga0183369_1007 3300015685 Bacteria 414878
183 Ga0183368_1002 3300015687 Bacteria 1865598
184 Ga0163161_10016902 3300017792 Bacteria 5099
185 Ga0197907_10972301 3300020069 Bacteria 1451
186 Ga0206356_11478499 3300020070 Bacteria 5285
187 Ga0206353_11923352 3300020082 Bacteria 2583
188 Ga0209760_100556 3300025207 Bacteria 6860
189 Ga0209784_100167 3300025224 Bacteria 56563
190 Ga0209566_108076 3300025225 Bacteria 1152
191 Ga0209674_100043 3300025226 Bacteria 369728
192 Ga0209674_100407 3300025226 Bacteria 21399
193 Ga0209674_100902 3300025226 Bacteria 9606
194 Ga0209674_102072 3300025226 Bacteria 4567
195 Ga0209672_100004 3300025228 Bacteria 1467504
196 Ga0209672_100029 3300025228 Bacteria 339298
197 Ga0209672_100143 3300025228 Bacteria 67036
198 Ga0209672_100738 3300025228 Bacteria 15999
199 Ga0209672_101903 3300025228 Bacteria 6039
200 Ga0209672_110773 3300025228 Bacteria 1217
201 Ga0209563_100103 3300025230 Bacteria 151835
202 Ga0207427_100144 3300025231 Bacteria 82742
203 Ga0207427_100209 3300025231 Bacteria 53322
204 Ga0207427_100327 3300025231 Bacteria 31981
205 Ga0207427_105019 3300025231 Bacteria 1990
206 Ga0209437_100020 3300025233 Bacteria 656374
207 Ga0209437_100193 3300025233 Bacteria 122027
208 Ga0209437_100256 3300025233 Bacteria 82734
209 Ga0209437_100465 3300025233 Bacteria 31828
210 Ga0209437_108993 3300025233 Bacteria 1575
211 Ga0209258_100003 3300025242 Bacteria 1467504
212 Ga0209258_100053 3300025242 Bacteria 339233
213 Ga0209258_100149 3300025242 Bacteria 162184
214 Ga0209258_100329 3300025242 Bacteria 71786
215 Ga0209258_100407 3300025242 Bacteria 52342
216 Ga0209258_101049 3300025242 Bacteria 12182
217 Ga0209258_102073 3300025242 Bacteria 5682
218 Ga0209646_1001715 3300025246 Bacteria 5541
219 Ga0209646_1002822 3300025246 Bacteria 3659
220 Ga0209646_1004407 3300025246 Bacteria 2570
221 Ga0209646_1007805 3300025246 Bacteria 1736
222 Ga0209026_1000060 3300025250 Bacteria 220052
223 Ga0209026_1000098 3300025250 Bacteria 161845
224 Ga0209026_1000274 3300025250 Bacteria 61312
225 Ga0209026_1000293 3300025250 Bacteria 55650
226 Ga0209026_1000516 3300025250 Bacteria 27200
227 Ga0209026_1005183 3300025250 Bacteria 3578
228 Ga0209677_102308 3300025253 Bacteria 7335
229 Ga0209148_1000002 3300025254 Bacteria 2399500
230 Ga0209148_1000009 3300025254 Bacteria 1395625
231 Ga0209148_1000010 3300025254 Bacteria 1265567
232 Ga0209148_1000025 3300025254 Bacteria 663262
233 Ga0209148_1000039 3300025254 Bacteria 482479
234 Ga0209148_1000143 3300025254 Bacteria 162184
235 Ga0209148_1001049 3300025254 Bacteria 17095
236 Ga0209759_1000658 3300025256 Bacteria 32027
237 Ga0209759_1000668 3300025256 Bacteria 31765
238 Ga0209759_1001181 3300025256 Bacteria 16384
239 Ga0209759_1005375 3300025256 Bacteria 4506
240 Ga0209759_1008242 3300025256 Bacteria 3265
241 Ga0209759_1034101 3300025256 Bacteria 955
242 Ga0209129_1000766 3300025258 Bacteria 20440
243 Ga0209129_1009423 3300025258 Bacteria 2575
244 Ga0209233_1000009 3300025261 Bacteria 1265567
245 Ga0209233_1000020 3300025261 Bacteria 798224
246 Ga0209233_1000151 3300025261 Bacteria 176515
247 Ga0209233_1007475 3300025261 Bacteria 3458
248 Ga0209455_1000004 3300025272 Bacteria 1467504
249 Ga0209455_1000034 3300025272 Bacteria 483129
250 Ga0209455_1000060 3300025272 Bacteria 339298
251 Ga0209455_1000086 3300025272 Bacteria 244650
252 Ga0209455_1000095 3300025272 Bacteria 217487
253 Ga0209455_1010803 3300025272 Bacteria 2295
254 Ga0209455_1014179 3300025272 Bacteria 1815
255 Ga0209758_1000812 3300025297 Bacteria 43987
256 Ga0209758_1120924 3300025297 Bacteria 707
257 Ga0209051_1022835 3300025303 Bacteria 2621
258 Ga0207692_10027067 3300025898 Bacteria 2696
259 Ga0207710_10003795 3300025900 Bacteria 6677
260 Ga0207680_10000002 3300025903 Bacteria 1018646
261 Ga0207647_10000228 3300025904 Bacteria 46540
262 Ga0207647_10002628 3300025904 Bacteria 13590
263 Ga0207647_10021560 3300025904 Bacteria 4300
264 Ga0207647_10049605 3300025904 Bacteria 2603
265 Ga0207699_10117469 3300025906 Bacteria 1715
266 Ga0207705_10002226 3300025909 Bacteria 14973
267 Ga0207705_10016407 3300025909 Bacteria 5310
268 Ga0207707_10013804 3300025912 Bacteria 7045
269 Ga0207695_10003135 3300025913 Bacteria 23618
270 Ga0207695_10009256 3300025913 Bacteria 12203
271 Ga0207695_10042600 3300025913 Bacteria 4845
272 Ga0207695_10080322 3300025913 Bacteria 3303
273 Ga0207671_10000021 3300025914 Bacteria 300409
274 Ga0207671_10001518 3300025914 Bacteria 26689
275 Ga0207657_10111058 3300025919 Bacteria 2264
276 Ga0207657_10141324 3300025919 Bacteria 1966
277 Ga0207657_10312938 3300025919 Bacteria 1243
278 Ga0207657_10342392 3300025919 Bacteria 1180
279 Ga0207649_10017391 3300025920 Bacteria 4074
280 Ga0207649_10134976 3300025920 Bacteria 1681
281 Ga0207649_10340022 3300025920 Unclassified 1108
282 Ga0207649_10439231 3300025920 Bacteria 983
283 Ga0207694_10000388 3300025924 Bacteria 40972
284 Ga0207694_10077903 3300025924 Bacteria 2598
285 Ga0207694_10079355 3300025924 Bacteria 2574
286 Ga0207694_10100095 3300025924 Bacteria 2296
287 Ga0207694_10130122 3300025924 Bacteria 2017
288 Ga0207700_10144494 3300025928 Bacteria 1959
289 Ga0207664_10001322 3300025929 Bacteria 16316
290 Ga0207664_10001329 3300025929 Bacteria 16293
291 Ga0207664_10152943 3300025929 Bacteria 1961
292 Ga0207690_10002706 3300025932 Bacteria 10697
293 Ga0207690_10011239 3300025932 Bacteria 5346
294 Ga0207690_10012135 3300025932 Bacteria 5155
295 Ga0207690_10245677 3300025932 Bacteria 1380
296 Ga0207706_10044623 3300025933 Bacteria 3929
297 Ga0207706_10282740 3300025933 Bacteria 1446
298 Ga0207706_10576527 3300025933 Bacteria 967
299 Ga0207706_10852087 3300025933 Bacteria 772
300 Ga0207670_10003893 3300025936 Bacteria 7963
301 Ga0207667_10000737 3300025949 Bacteria 42563
302 Ga0207667_10002458 3300025949 Bacteria 23165
303 Ga0207667_10193917 3300025949 Bacteria 2084
304 Ga0207667_10993606 3300025949 Bacteria 827
305 Ga0207667_11323550 3300025949 Bacteria 696
306 Ga0207668_10227036 3300025972 Bacteria 1503
307 Ga0207640_10000095 3300025981 Bacteria 69753
308 Ga0207640_10003159 3300025981 Bacteria 8866
309 Ga0207640_10014885 3300025981 Bacteria 4488
310 Ga0207640_10335726 3300025981 Bacteria 1209
311 Ga0207658_10222345 3300025986 Bacteria 1589
312 Ga0207703_10013607 3300026035 Bacteria 6341
313 Ga0207639_10143187 3300026041 Bacteria 1994
314 Ga0207678_10043258 3300026067 Bacteria 3898
315 Ga0207678_10053142 3300026067 Bacteria 3492
316 Ga0207678_10111625 3300026067 Bacteria 2332
317 Ga0207678_10681408 3300026067 Unclassified 904
318 Ga0207702_10000132 3300026078 Bacteria 88794
319 Ga0207702_10000718 3300026078 Bacteria 35528
320 Ga0207674_10002447 3300026116 Bacteria 23450
321 Ga0207674_10041964 3300026116 Bacteria 4728
322 Ga0207674_10313573 3300026116 Bacteria 1518
323 Ga0268266_10000004 3300028379 Bacteria 1495817
324 Ga0268265_10019013 3300028380 Bacteria 4770
325 Ga0268264_10460845 3300028381 Bacteria 1233
326 Ga0307517_10106765 3300028786 Bacteria 2163
327 Ga0307405_10271708 3300031731 Bacteria 1271
328 Ga0307413_10317349 3300031824 Bacteria 1189
329 Ga0307412_10008842 3300031911 Bacteria 5766
330 Ga0307510_10005448 3300033180 Bacteria 15156
331 Ga0307510_10036409 3300033180 Bacteria 5476
332 Ga0395899_0000068 3300037312 Bacteria 202264
333 Ga0395899_0003136 3300037312 Bacteria 13152
334 Ga0395899_0037111 3300037312 Bacteria 3653
335 Ga0395899_0060697 3300037312 Bacteria 2785
336 Ga0395899_0113194 3300037312 Bacteria 1949
337 Ga0395900_0382753 3300037418 Bacteria 1374
338 Ga0395900_0537975 3300037418 Bacteria 1114
339 Ga0395900_1009231 3300037418 Bacteria 752
340 Ga0395898_0000558 3300037466 Bacteria 69802
341 Ga0395898_0000600 3300037466 Bacteria 66858
342 Ga0395898_0007440 3300037466 Bacteria 11622
343 Ga0395898_0068334 3300037466 Bacteria 3438
344 Ga0395898_0415275 3300037466 Bacteria 1282
345 Ga0395901_0001533 3300038443 Bacteria 23956
346 Ga0395901_0009999 3300038443 Bacteria 9614
347 Ga0395901_0015703 3300038443 Bacteria 7714
348 Ga0395901_0059771 3300038443 Bacteria 3965
349 Ga0395901_0206482 3300038443 Bacteria 2057
350 Ga0395901_0607444 3300038443 Bacteria 1102
351 Ga0439436_0000010 3300041404 Bacteria 104480
352 Ga0439465_0001623 3300041413 Bacteria 7321
353 Ga0451793_1564549 3300041452 Bacteria 3988
354 Ga0451802_0494732 3300041460 Bacteria 774
355 Ga0439448_0084631 3300042005 Bacteria 1068
356 Ga0439432_056434 3300042006 Bacteria 1217
357 Ga0466969_0002795 3300044656 Bacteria 9322
358 Ga0466969_0016222 3300044656 Bacteria 3901
359 Ga0466969_0024665 3300044656 Bacteria 3094
360 Ga0466972_0318676 3300044658 Bacteria 726
361 Ga0466982_0000005 3300044672 Bacteria 364340
362 Ga0466982_0000059 3300044672 Bacteria 30023
363 Ga0466965_0003379 3300044683 Bacteria 6989
364 Ga0466965_0254167 3300044683 Bacteria 943
365 Ga0466966_0002888 3300044684 Bacteria 11330
366 Ga0466966_0006724 3300044684 Bacteria 7616
367 Ga0466966_0042154 3300044684 Bacteria 2931
368 Ga0466961_0007178 3300044693 Bacteria 7088
369 Ga0466961_0049701 3300044693 Bacteria 2679
370 Ga0466961_0394083 3300044693 Bacteria 840
371 Ga0466961_0533300 3300044693 Unclassified 707
372 Ga0466963_0065789 3300044694 Bacteria 2431
373 Ga0466963_0753279 3300044694 Unclassified 687
374 Ga0466964_0007368 3300044706 Bacteria 4114
375 Ga0466971_0000868 3300044719 Bacteria 12384
376 Ga0466971_0009485 3300044719 Bacteria 4249
377 Ga0466968_0014483 3300044735 Bacteria 3117
378 Ga0466970_0044712 3300044765 Bacteria 2357
379 Ga0466970_0050452 3300044765 Bacteria 2219
380 Ga0466970_0058181 3300044765 Bacteria 2068
381 Ga0466970_0127624 3300044765 Bacteria 1395
382 Ga0466957_0012485 3300044842 Bacteria 4916
383 Ga0466957_0027616 3300044842 Bacteria 3374
384 Ga0466957_0102791 3300044842 Bacteria 1803
385 Ga0466960_0000662 3300044901 Bacteria 11973
386 Ga0466959_0000131 3300045049 Bacteria 48526
387 Ga0466959_0011100 3300045049 Bacteria 6464
388 Ga0466959_0028532 3300045049 Bacteria 4138
389 Ga0466959_0048446 3300045049 Bacteria 3122
390 Ga0466959_0721859 3300045049 Bacteria 667
391 Ga0466958_0008396 3300045836 Bacteria 5726
392 Ga0466958_0026487 3300045836 Bacteria 3427
393 Ga0466967_0340317 3300045976 Bacteria 1450
394 Ga0495617_000882 3300046452 Bacteria 14118
395 Ga0495617_001439 3300046452 Bacteria 10453
396 Ga0495638_0000007 3300046460 Bacteria 602783
397 Ga0495638_0001066 3300046460 Bacteria 26750
398 Ga0495638_0001368 3300046460 Bacteria 22358
399 Ga0495638_0001395 3300046460 Bacteria 22035
400 Ga0495638_0114140 3300046460 Bacteria 1602
401 Ga0495638_0297329 3300046460 Bacteria 871
402 Ga0495650_0000202 3300046471 Bacteria 129910
403 Ga0495650_0000637 3300046471 Bacteria 46877
404 Ga0495650_0004341 3300046471 Bacteria 9773
405 Ga0495650_0005105 3300046471 Bacteria 8680
406 Ga0495584_0000625 3300046491 Bacteria 23650
407 Ga0495585_0000938 3300046492 Bacteria 24597
408 Ga0495585_0010697 3300046492 Bacteria 5449
409 Ga0495607_0000098 3300046501 Bacteria 92012
410 Ga0495607_0000430 3300046501 Bacteria 42487
411 Ga0495607_0017253 3300046501 Bacteria 4639
412 Ga0495607_0062472 3300046501 Bacteria 2111
413 Ga0495583_0007068 3300046506 Bacteria 7173
414 Ga0495606_0001329 3300046507 Bacteria 33751
415 Ga0495606_0002701 3300046507 Bacteria 20033
416 Ga0495606_0003017 3300046507 Bacteria 18439
417 Ga0495606_0045238 3300046507 Bacteria 2919
418 Ga0495606_0098057 3300046507 Bacteria 1789
419 Ga0495610_0005146 3300046512 Bacteria 9384
420 Ga0495616_0001848 3300046513 Bacteria 14329
421 Ga0495616_0028122 3300046513 Bacteria 2978
422 Ga0495620_0004280 3300046515 Bacteria 8072
423 Ga0495631_0000460 3300046518 Bacteria 27635
424 Ga0495631_0001776 3300046518 Bacteria 12785
425 Ga0495632_0000262 3300046519 Bacteria 52466
426 Ga0495632_0033023 3300046519 Bacteria 2660
427 Ga0495632_0129622 3300046519 Bacteria 1174
428 Ga0495637_0032325 3300046520 Bacteria 2306
429 Ga0495648_0014149 3300046524 Bacteria 5855
430 Ga0495648_0014563 3300046524 Bacteria 5750
431 Ga0495609_0011236 3300046538 Bacteria 4270
432 Ga0495597_0053505 3300046542 Bacteria 1775
433 Ga0495622_0009667 3300046557 Bacteria 4460
434 Ga0495668_0026526 3300046616 Bacteria 3287
435 Ga0495611_0000001 3300046648 Bacteria 2628469
436 Ga0495611_0001038 3300046648 Bacteria 14701
437 Ga0495625_0000001 3300046660 Bacteria 1641829
438 Ga0495625_0014495 3300046660 Bacteria 6285
439 Ga0495625_0026367 3300046660 Bacteria 4393
440 Ga0495625_0034880 3300046660 Bacteria 3710
441 Ga0495625_0083047 3300046660 Bacteria 2227
442 Ga0495625_0248599 3300046660 Bacteria 1155
443 Ga0495625_0570859 3300046660 Bacteria 683
444 Ga0495661_0002187 3300046665 Bacteria 15271
445 Ga0495670_0004398 3300046691 Bacteria 6913
446 Ga0495670_0015489 3300046691 Bacteria 3745
447 Ga0495670_0018572 3300046691 Bacteria 3423
448 Ga0495671_0000272 3300046692 Bacteria 43513
449 Ga0495649_0000383 3300046694 Bacteria 38398
450 Ga0495589_0000458 3300046794 Bacteria 29894
451 Ga0495660_0000410 3300046810 Bacteria 36526
452 Ga0495660_0002140 3300046810 Bacteria 12744
453 Ga0495679_000001 3300047446 Bacteria 1607568
454 Ga0495673_0000001 3300047469 Bacteria 1630730
455 Ga0495673_0000099 3300047469 Bacteria 179978
456 Ga0495673_0002529 3300047469 Bacteria 12769
457 Ga0495686_0000276 3300047472 Bacteria 91066
458 Ga0495686_0000975 3300047472 Bacteria 35076
459 Ga0495686_0006028 3300047472 Bacteria 9410
460 Ga0495686_0125863 3300047472 Bacteria 1523
461 Ga0496100_0048118 3300048903 Bacteria 2751
462 Ga0496100_0130550 3300048903 Bacteria 1769
463 Ga0496101_0024338 3300048904 Bacteria 4190
464 Ga0496106_0001459 3300048909 Bacteria 17765
465 Ga0496106_0604332 3300048909 Bacteria 878
466 Ga0496107_0457078 3300048910 Bacteria 948
467 Ga0496115_0000567 3300048918 Bacteria 28695
468 Ga0496115_0006012 3300048918 Bacteria 8860
469 Ga0496115_0046638 3300048918 Bacteria 3464
470 Ga0496116_0228503 3300048919 Bacteria 946
471 Ga0496117_0017588 3300048920 Bacteria 5966
472 Ga0496117_0039775 3300048920 Bacteria 3466
473 Ga0496117_0044688 3300048920 Bacteria 3206
474 Ga0496118_0001687 3300048921 Bacteria 32276
475 Ga0496118_0005142 3300048921 Bacteria 15002
476 Ga0496118_0010934 3300048921 Bacteria 8924
477 Ga0496118_0277165 3300048921 Bacteria 936
478 Ga0496119_0047058 3300048922 Bacteria 2687
479 Ga0496121_0000210 3300048924 Bacteria 128287
480 Ga0496121_0007339 3300048924 Bacteria 13330
481 Ga0496121_0007902 3300048924 Bacteria 12728
482 Ga0496121_0020685 3300048924 Bacteria 6493
483 Ga0496121_0034035 3300048924 Bacteria 4594
484 Ga0496121_0044528 3300048924 Bacteria 3826
485 Ga0496121_0065774 3300048924 Bacteria 2947
486 Ga0496122_0028548 3300048925 Bacteria 4729
487 Ga0496122_0047981 3300048925 Bacteria 3290
488 Ga0496122_0100298 3300048925 Bacteria 1938
489 Ga0496122_0145659 3300048925 Bacteria 1472
490 Ga0496122_0203351 3300048925 Bacteria 1156
491 Ga0496123_0032467 3300048926 Bacteria 3779
492 Ga0496123_0050389 3300048926 Bacteria 2782
493 Ga0496123_0094303 3300048926 Bacteria 1764
494 Ga0496123_0112422 3300048926 Bacteria 1553
495 Ga0496124_0016665 3300048927 Bacteria 6971
496 Ga0496124_0324781 3300048927 Bacteria 1100
497 Ga0496125_0000379 3300048928 Bacteria 83187
498 Ga0496125_0006519 3300048928 Bacteria 12590
499 Ga0496125_0318015 3300048928 Bacteria 945
500 Ga0496126_0001924 3300048929 Bacteria 29736
501 Ga0496126_0008492 3300048929 Bacteria 11069
502 Ga0496126_0087043 3300048929 Bacteria 2753
503 Ga0496126_0123985 3300048929 Bacteria 2237
504 Ga0496126_0209796 3300048929 Bacteria 1640
505 Ga0496126_0371848 3300048929 Bacteria 1165
506 Ga0495678_000132 3300049459 Bacteria 88496
507 Ga0495678_037082 3300049459 Bacteria 1984
508 Ga0495682_0003591 3300049460 Bacteria 6840
509 Ga0495682_0033426 3300049460 Bacteria 1898
510 Ga0495682_0101897 3300049460 Bacteria 1029
511 Ga0501031_0010344 3300049568 Bacteria 6079
512 Ga0501031_0580640 3300049568 Bacteria 721
513 Ga0501032_0009136 3300049569 Bacteria 7193
514 Ga0501032_0562613 3300049569 Bacteria 726
515 Ga0501032_0857906 3300049569 Bacteria 572
516 Ga0501033_0002369 3300049570 Bacteria 16069
517 Ga0501033_0005146 3300049570 Bacteria 10397
518 Ga0501033_0269592 3300049570 Bacteria 1203
519 Ga0501034_0056650 3300049571 Bacteria 3943
520 Ga0501034_0184343 3300049571 Bacteria 2051
521 Ga0501034_0325178 3300049571 Bacteria 1470
522 Ga0501036_0414479 3300049572 Bacteria 1123
523 Ga0501037_0026448 3300049573 Bacteria 4290
524 Ga0501038_0110190 3300049574 Bacteria 2281
525 Ga0501038_0242850 3300049574 Bacteria 1429
526 Ga0501039_0353822 3300049575 Bacteria 1154
527 Ga0501043_0009237 3300049579 Bacteria 7748
528 Ga0501043_0010787 3300049579 Bacteria 7156
529 Ga0501046_0005419 3300049580 Bacteria 11404
530 Ga0501046_0187719 3300049580 Bacteria 1543
531 Ga0501046_0363906 3300049580 Bacteria 1048
532 Ga0501047_0002764 3300049581 Bacteria 16669
533 Ga0501047_0007561 3300049581 Bacteria 10225
534 Ga0501047_0076182 3300049581 Bacteria 3228
535 Ga0501047_0153690 3300049581 Bacteria 2176
536 Ga0501048_0135318 3300049582 Bacteria 1741
537 Ga0501070_0423411 3300049586 Bacteria 1075
538 Ga0501073_0377552 3300049589 Bacteria 979
539 Ga0501035_0014502 3300049822 Bacteria 7273
540 Ga0501035_0051960 3300049822 Bacteria 3667
541 Ga0501035_0134535 3300049822 Bacteria 2153
542 Ga0501035_0224892 3300049822 Bacteria 1601
543 Ga0501035_0311656 3300049822 Bacteria 1324
544 Ga0501044_0009489 3300049823 Bacteria 10594
545 Ga0501044_0011731 3300049823 Bacteria 9492
546 Ga0501044_0015409 3300049823 Bacteria 8233
547 Ga0501044_0059512 3300049823 Bacteria 3913
548 Ga0501044_0171559 3300049823 Bacteria 2140
549 nmdc:mga0sz30_9535_c2 3300050516 Bacteria 2620
550 Ga0500643_000002 3300053087 Bacteria 1277657
551 Ga0500583_0322865 3300053092 Bacteria 752
552 Ga0500555_000611 3300053103 Bacteria 13888
553 Ga0500652_140511 3300053131 Bacteria 1005
554 Ga0500633_0003242 3300053160 Bacteria 3514
555 Ga0500645_004097 3300053730 Bacteria 5701
556 Ga0466962_0003750 3300061719 Bacteria 7255
557 Ga0466962_0029698 3300061719 Bacteria 2617
558 Ga0466962_0041531 3300061719 Bacteria 2200
559 Ga0466962_0170581 3300061719 Bacteria 1059
560 2538834099 2537561836 Bacteria 3910579
561 2595445801 2593339238 Bacteria 4182970
562 2595449352 2593339239 Bacteria 4124669
563 2643829557 2643221562 Bacteria 4048635
564 2643895191 2643221577 Bacteria 3710843
565 2644477350 2643221685 Bacteria 3673288
566 2687584008 2687453130 Bacteria 4227172
567 2721027895 2718218334 Bacteria 4765486
568 2735836533 2734482264 Unclassified 5014763
569 2739228447 2738543009 Bacteria 4944499
570 2739732091 2739367700 Bacteria 4747630
571 2842916143 2842914999 Bacteria 4419378
572 2884340179 2884338543 Bacteria 4610696
573 2884413762 2884411467 Bacteria 5246714
574 2895397504 2895395659 Bacteria 3983269
575 2919085736 2919085039 Bacteria 4532964
576 2919405865 2919404418 Bacteria 4232372
577 2928964789 2928963466 Bacteria 5165703
578 2939612702 2939611941 Bacteria 3892017
579 2941474659 2941471342 Bacteria 5018624
580 2953994962 2953994433 Bacteria 4303959
581 Ga0501047_0193491
582 JGI24736J21556_1009175
583 JGI24740J21852_10014053
584 JGI24740J21852_10075340
585 JGI24739J22299_10000118
586 JGI24737J22298_10001221
587 JGI24737J22298_10065931
588 JGI24735J21928_10030492
589 JGI24735J21928_10048387
590 JGI24738J21930_10034924
591 JGI24738J21930_10049666
592 JGI25156J39149_1001202
593 JGI25156J39149_1001485
594 JGI25156J39149_1005444
595 JGI25156J39149_1021623
596 JGI25162J39368_1000434
597 JGI25162J39368_1001914
598 JGI25162J39368_1002093
599 JGI25162J39368_1002729
600 JGI25154J39366_1010309
601 JGI25157J39369_1000527
602 JGI25157J39369_1000572
603 JGI25157J39369_1000860
604 JGI25157J39369_1000944
605 JGI25157J39369_1001150
606 JGI25157J39369_1003026
607 JGI25157J39369_1012002
608 JGI25163J39215_1000622
609 JGI25164J39214_1000143
610 JGI25164J39214_1000312
611 JGI25164J39214_1000535
612 JGI25164J39214_1011449
613 JGI25165J46597_1000257
614 JGI25165J46597_1000586
615 rootH1_10093510
616 rootH2_10137045
617 rootL2_10212903
618 rootH1_10375640
619 Ga0006562J51391_1018437
620 Ga0006562J51391_1018441
621 Ga0006562J51391_1075948
622 Ga0006562J51391_1075949
623 Ga0055538_1002632
624 Ga0055533_1000283
625 Ga0055525_1000111
626 Ga0055527_1000363
627 Ga0055527_1000432
628 Ga0055527_1001741
629 Ga0055535_1000390
630 Ga0055535_1000430
631 Ga0055535_1000869
632 Ga0055535_1000923
633 Ga0055535_1001073
634 Ga0055542_1000409
635 Ga0055542_1000540
636 Ga0055542_1000559
637 Ga0055542_1000629
638 Ga0055542_1000865
639 Ga0055542_1001072
640 Ga0055542_1010914
641 Ga0055529_1000211
642 Ga0055529_1000244
643 Ga0055529_1000280
644 Ga0055529_1000737
645 Ga0055529_1013331
646 Ga0065165_1000113
647 Ga0065165_1005347
648 Ga0070658_10001084
649 Ga0070666_10000018
650 Ga0070680_100870768
651 Ga0070682_100116495
652 Ga0070682_100337552
653 Ga0070660_100015354
654 Ga0070660_100220485
655 Ga0070689_100006031
656 Ga0070661_100013038
657 Ga0070661_100363780
658 Ga0070661_100393602
659 Ga0070692_10016178
660 Ga0070659_100074507
661 Ga0070659_100363358
662 Ga0070659_101142372
663 Ga0070667_100032024
664 Ga0070709_10130967
665 Ga0070714_100003062
666 Ga0070714_100012139
667 Ga0070714_100085598
668 Ga0070713_100008958
669 Ga0070710_10032219
670 Ga0070663_100053003
671 Ga0070663_100053108
672 Ga0070663_100241523
673 Ga0070663_100563614
674 Ga0070663_100583513
675 Ga0070663_100700258
676 Ga0070662_100075947
677 Ga0070662_100852720
678 Ga0070681_10011680
679 Ga0070681_10030069
680 Ga0070681_10967567
681 Ga0070679_100039017
682 Ga0068853_100387278
683 Ga0068853_100638702
684 Ga0070696_100001026
685 Ga0070696_100107773
686 Ga0068855_100013790
687 Ga0068855_100046572
688 Ga0068855_100243506
689 Ga0068857_100000998
690 Ga0068857_100036672
691 Ga0068854_100001113
692 Ga0068854_100003601
693 Ga0068854_100024671
694 Ga0068854_100061134
695 Ga0068856_100000582
696 Ga0068856_100030736
697 Ga0068859_100183748
698 Ga0068851_10045776
699 Ga0068858_100003142
700 Ga0068858_100048183
701 Ga0068860_100431504
702 Ga0068862_100033999
703 Ga0097620_100183747
704 Ga0105240_10023357
705 Ga0105240_10038461
706 Ga0105240_10046303
707 Ga0105240_10113171
708 Ga0105247_10013285
709 Ga0105237_10000352
710 Ga0105237_10000675
711 Ga0105237_10104805
712 Ga0105238_10000319
713 Ga0105238_10134894
714 Ga0105238_10139480
715 Ga0105238_10158449
716 Ga0105238_10242673
717 Ga0105238_10434374
718 Ga0105238_10794666
719 Ga0105239_10034580
720 Ga0105239_10051215
721 Ga0105239_10565946
722 Ga0157314_1000067
723 Ga0157373_10175488
724 Ga0157373_10220809
725 Ga0157373_10244559
726 Ga0157373_10350706
727 Ga0157371_10020571
728 Ga0157371_11044648
729 Ga0157370_10005510
730 Ga0157370_10005522
731 Ga0157370_10020890
732 Ga0157370_10225550
733 Ga0157370_10385467
734 Ga0157370_10555975
735 Ga0157369_10013431
736 Ga0157369_10017478
737 Ga0157369_10077917
738 Ga0163162_10001986
739 Ga0163162_10044158
740 Ga0157372_10078548
741 Ga0157372_10187634
742 Ga0157372_10579649
743 Ga0157372_11580578
744 Ga0182008_10024600
745 Ga0182008_10104256
746 Ga0182008_10117096
747 Ga0182008_10128417
748 Ga0182008_10175347
749 Ga0182006_1000223
750 Ga0182006_1030240
751 Ga0182006_1041204
752 Ga0182007_10017898
753 Ga0182007_10020699
754 Ga0182007_10056977
755 Ga0182007_10070933
756 Ga0182007_10094659
757 Ga0182007_10100133
758 Ga0182005_1000228
759 Ga0182005_1004950
760 Ga0182005_1014663
761 Ga0182005_1047758
762 Ga0183369_1007
763 Ga0183368_1002
764 Ga0163161_10016902
765 Ga0197907_10972301
766 Ga0206356_11478499
767 Ga0206353_11923352
768 Ga0209760_100556
769 Ga0209784_100167
770 Ga0209566_108076
771 Ga0209674_100043
772 Ga0209674_100407
773 Ga0209674_100902
774 Ga0209674_102072
775 Ga0209672_100004
776 Ga0209672_100029
777 Ga0209672_100143
778 Ga0209672_100738
779 Ga0209672_101903
780 Ga0209672_110773
781 Ga0209563_100103
782 Ga0207427_100144
783 Ga0207427_100209
784 Ga0207427_100327
785 Ga0207427_105019
786 Ga0209437_100020
787 Ga0209437_100193
788 Ga0209437_100256
789 Ga0209437_100465
790 Ga0209437_108993
791 Ga0209258_100003
792 Ga0209258_100053
793 Ga0209258_100149
794 Ga0209258_100329
795 Ga0209258_100407
796 Ga0209258_101049
797 Ga0209258_102073
798 Ga0209646_1001715
799 Ga0209646_1002822
800 Ga0209646_1004407
801 Ga0209646_1007805
802 Ga0209026_1000060
803 Ga0209026_1000098
804 Ga0209026_1000274
805 Ga0209026_1000293
806 Ga0209026_1000516
807 Ga0209026_1005183
808 Ga0209677_102308
809 Ga0209148_1000002
810 Ga0209148_1000009
811 Ga0209148_1000010
812 Ga0209148_1000025
813 Ga0209148_1000039
814 Ga0209148_1000143
815 Ga0209148_1001049
816 Ga0209759_1000658
817 Ga0209759_1000668
818 Ga0209759_1001181
819 Ga0209759_1005375
820 Ga0209759_1008242
821 Ga0209759_1034101
822 Ga0209129_1000766
823 Ga0209129_1009423
824 Ga0209233_1000009
825 Ga0209233_1000020
826 Ga0209233_1000151
827 Ga0209233_1007475
828 Ga0209455_1000004
829 Ga0209455_1000034
830 Ga0209455_1000060
831 Ga0209455_1000086
832 Ga0209455_1000095
833 Ga0209455_1010803
834 Ga0209455_1014179
835 Ga0209758_1000812
836 Ga0209758_1120924
837 Ga0209051_1022835
838 Ga0207692_10027067
839 Ga0207710_10003795
840 Ga0207680_10000002
841 Ga0207647_10000228
842 Ga0207647_10002628
843 Ga0207647_10021560
844 Ga0207647_10049605
845 Ga0207699_10117469
846 Ga0207705_10002226
847 Ga0207705_10016407
848 Ga0207707_10013804
849 Ga0207695_10003135
850 Ga0207695_10009256
851 Ga0207695_10042600
852 Ga0207695_10080322
853 Ga0207671_10000021
854 Ga0207671_10001518
855 Ga0207657_10111058
856 Ga0207657_10141324
857 Ga0207657_10312938
858 Ga0207657_10342392
859 Ga0207649_10017391
860 Ga0207649_10134976
861 Ga0207649_10340022
862 Ga0207649_10439231
863 Ga0207694_10000388
864 Ga0207694_10077903
865 Ga0207694_10079355
866 Ga0207694_10100095
867 Ga0207694_10130122
868 Ga0207700_10144494
869 Ga0207664_10001322
870 Ga0207664_10001329
871 Ga0207664_10152943
872 Ga0207690_10002706
873 Ga0207690_10011239
874 Ga0207690_10012135
875 Ga0207690_10245677
876 Ga0207706_10044623
877 Ga0207706_10282740
878 Ga0207706_10576527
879 Ga0207706_10852087
880 Ga0207670_10003893
881 Ga0207667_10000737
882 Ga0207667_10002458
883 Ga0207667_10193917
884 Ga0207667_10993606
885 Ga0207667_11323550
886 Ga0207668_10227036
887 Ga0207640_10000095
888 Ga0207640_10003159
889 Ga0207640_10014885
890 Ga0207640_10335726
891 Ga0207658_10222345
892 Ga0207703_10013607
893 Ga0207639_10143187
894 Ga0207678_10043258
895 Ga0207678_10053142
896 Ga0207678_10111625
897 Ga0207678_10681408
898 Ga0207702_10000132
899 Ga0207702_10000718
900 Ga0207674_10002447
901 Ga0207674_10041964
902 Ga0207674_10313573
903 Ga0268266_10000004
904 Ga0268265_10019013
905 Ga0268264_10460845
906 Ga0307517_10106765
907 Ga0307405_10271708
908 Ga0307413_10317349
909 Ga0307412_10008842
910 Ga0307510_10005448
911 Ga0307510_10036409
912 Ga0395899_0000068
913 Ga0395899_0003136
914 Ga0395899_0037111
915 Ga0395899_0060697
916 Ga0395899_0113194
917 Ga0395900_0382753
918 Ga0395900_0537975
919 Ga0395900_1009231
920 Ga0395898_0000558
921 Ga0395898_0000600
922 Ga0395898_0007440
923 Ga0395898_0068334
924 Ga0395898_0415275
925 Ga0395901_0001533
926 Ga0395901_0009999
927 Ga0395901_0015703
928 Ga0395901_0059771
929 Ga0395901_0206482
930 Ga0395901_0607444
931 Ga0439436_0000010
932 Ga0439465_0001623
933 Ga0451793_1564549
934 Ga0451802_0494732
935 Ga0439448_0084631
936 Ga0439432_056434
937 Ga0466969_0002795
938 Ga0466969_0016222
939 Ga0466969_0024665
940 Ga0466972_0318676
941 Ga0466982_0000005
942 Ga0466982_0000059
943 Ga0466965_0003379
944 Ga0466965_0254167
945 Ga0466966_0002888
946 Ga0466966_0006724
947 Ga0466966_0042154
948 Ga0466961_0007178
949 Ga0466961_0049701
950 Ga0466961_0394083
951 Ga0466961_0533300
952 Ga0466963_0065789
953 Ga0466963_0753279
954 Ga0466964_0007368
955 Ga0466971_0000868
956 Ga0466971_0009485
957 Ga0466968_0014483
958 Ga0466970_0044712
959 Ga0466970_0050452
960 Ga0466970_0058181
961 Ga0466970_0127624
962 Ga0466957_0012485
963 Ga0466957_0027616
964 Ga0466957_0102791
965 Ga0466960_0000662
966 Ga0466959_0000131
967 Ga0466959_0011100
968 Ga0466959_0028532
969 Ga0466959_0048446
970 Ga0466959_0721859
971 Ga0466958_0008396
972 Ga0466958_0026487
973 Ga0466967_0340317
974 Ga0495617_000882
975 Ga0495617_001439
976 Ga0495638_0000007
977 Ga0495638_0001066
978 Ga0495638_0001368
979 Ga0495638_0001395
980 Ga0495638_0114140
981 Ga0495638_0297329
982 Ga0495650_0000202
983 Ga0495650_0000637
984 Ga0495650_0004341
985 Ga0495650_0005105
986 Ga0495584_0000625
987 Ga0495585_0000938
988 Ga0495585_0010697
989 Ga0495607_0000098
990 Ga0495607_0000430
991 Ga0495607_0017253
992 Ga0495607_0062472
993 Ga0495583_0007068
994 Ga0495606_0001329
995 Ga0495606_0002701
996 Ga0495606_0003017
997 Ga0495606_0045238
998 Ga0495606_0098057
999 Ga0495610_0005146
1000 Ga0495616_0001848
1001 Ga0495616_0028122
1002 Ga0495620_0004280
1003 Ga0495631_0000460
1004 Ga0495631_0001776
1005 Ga0495632_0000262
1006 Ga0495632_0033023
1007 Ga0495632_0129622
1008 Ga0495637_0032325
1009 Ga0495648_0014149
1010 Ga0495648_0014563
1011 Ga0495609_0011236
1012 Ga0495597_0053505
1013 Ga0495622_0009667
1014 Ga0495668_0026526
1015 Ga0495611_0000001
1016 Ga0495611_0001038
1017 Ga0495625_0000001
1018 Ga0495625_0014495
1019 Ga0495625_0026367
1020 Ga0495625_0034880
1021 Ga0495625_0083047
1022 Ga0495625_0248599
1023 Ga0495625_0570859
1024 Ga0495661_0002187
1025 Ga0495670_0004398
1026 Ga0495670_0015489
1027 Ga0495670_0018572
1028 Ga0495671_0000272
1029 Ga0495649_0000383
1030 Ga0495589_0000458
1031 Ga0495660_0000410
1032 Ga0495660_0002140
1033 Ga0495679_000001
1034 Ga0495673_0000001
1035 Ga0495673_0000099
1036 Ga0495673_0002529
1037 Ga0495686_0000276
1038 Ga0495686_0000975
1039 Ga0495686_0006028
1040 Ga0495686_0125863
1041 Ga0496100_0048118
1042 Ga0496100_0130550
1043 Ga0496101_0024338
1044 Ga0496106_0001459
1045 Ga0496106_0604332
1046 Ga0496107_0457078
1047 Ga0496115_0000567
1048 Ga0496115_0006012
1049 Ga0496115_0046638
1050 Ga0496116_0228503
1051 Ga0496117_0017588
1052 Ga0496117_0039775
1053 Ga0496117_0044688
1054 Ga0496118_0001687
1055 Ga0496118_0005142
1056 Ga0496118_0010934
1057 Ga0496118_0277165
1058 Ga0496119_0047058
1059 Ga0496121_0000210
1060 Ga0496121_0007339
1061 Ga0496121_0007902
1062 Ga0496121_0020685
1063 Ga0496121_0034035
1064 Ga0496121_0044528
1065 Ga0496121_0065774
1066 Ga0496122_0028548
1067 Ga0496122_0047981
1068 Ga0496122_0100298
1069 Ga0496122_0145659
1070 Ga0496122_0203351
1071 Ga0496123_0032467
1072 Ga0496123_0050389
1073 Ga0496123_0094303
1074 Ga0496123_0112422
1075 Ga0496124_0016665
1076 Ga0496124_0324781
1077 Ga0496125_0000379
1078 Ga0496125_0006519
1079 Ga0496125_0318015
1080 Ga0496126_0001924
1081 Ga0496126_0008492
1082 Ga0496126_0087043
1083 Ga0496126_0123985
1084 Ga0496126_0209796
1085 Ga0496126_0371848
1086 Ga0495678_000132
1087 Ga0495678_037082
1088 Ga0495682_0003591
1089 Ga0495682_0033426
1090 Ga0495682_0101897
1091 Ga0501031_0010344
1092 Ga0501031_0580640
1093 Ga0501032_0009136
1094 Ga0501032_0562613
1095 Ga0501032_0857906
1096 Ga0501033_0002369
1097 Ga0501033_0005146
1098 Ga0501033_0269592
1099 Ga0501034_0056650
1100 Ga0501034_0184343
1101 Ga0501034_0325178
1102 Ga0501036_0414479
1103 Ga0501037_0026448
1104 Ga0501038_0110190
1105 Ga0501038_0242850
1106 Ga0501039_0353822
1107 Ga0501043_0009237
1108 Ga0501043_0010787
1109 Ga0501046_0005419
1110 Ga0501046_0187719
1111 Ga0501046_0363906
1112 Ga0501047_0002764
1113 Ga0501047_0007561
1114 Ga0501047_0076182
1115 Ga0501047_0153690
1116 Ga0501048_0135318
1117 Ga0501070_0423411
1118 Ga0501073_0377552
1119 Ga0501035_0014502
1120 Ga0501035_0051960
1121 Ga0501035_0134535
1122 Ga0501035_0224892
1123 Ga0501035_0311656
1124 Ga0501044_0009489
1125 Ga0501044_0011731
1126 Ga0501044_0015409
1127 Ga0501044_0059512
1128 Ga0501044_0171559
1129 nmdc:mga0sz30_9535_c2
1130 Ga0500643_000002
1131 Ga0500583_0322865
1132 Ga0500555_000611
1133 Ga0500652_140511
1134 Ga0500633_0003242
1135 Ga0500645_004097
1136 Ga0466962_0003750
1137 Ga0466962_0029698
1138 Ga0466962_0041531
1139 Ga0466962_0170581
1140 2538834099
1141 2595445801
1142 2595449352
1143 2643829557
1144 2643895191
1145 2644477350
1146 2687584008
1147 2721027895
1148 2735836533
1149 2739228447
1150 2739732091
1151 2842916143
1152 2884340179
1153 2884413762
1154 2895397504
1155 2919085736
1156 2919405865
1157 2928964789
1158 2939612702
1159 2941474659
1160 2953994962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

28

185

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.9447 6 169
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.9442 6 169
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.9032 11 169
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.8774 6 169
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.8769 6 169
ID Description Score Start End Superfamily
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9475 13 169 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8986 11 169 3.40.470.10
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.872 13 169 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.86 11 170 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8577 1 169 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A1G3FL43-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9824 6 126 GO:0004844
GO:0006285
GO:0008263
AF-A6GLD3-F1-model_v4 G/U mismatch-specific DNA glycosylase 0.9637 8 165 GO:0004844
GO:0006285
GO:0008263
AF-A0A418VB33-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9636 9 169 GO:0004844
GO:0006285
GO:0008263
AF-A0A318SAP7-F1-model_v4 G/U mismatch-specific uracil-DNA glycosylase 0.9633 15 169 GO:0004844
GO:0006285
GO:0008263
AF-A0A538C750-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9632 10 167 GO:0004844
GO:0006285
GO:0008263

Map