F466008

General Info

Members Datasets Scaffolds Average Seq Length
580 235 580 252

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0013137|Ga0501069_0013137_3629_4378
Length 228
Sequence MITRKSARELDIMARAGSIVAGTLALMREIVRPGMTTEDLDDAAEAFIRSHPGATPSFKGLYGFPKTLCVSIDDEIVHGIPSRKRVLREGSIVSVDCGVHLEGFHADSATTIPVGTVGAEAERLMAVTQEALAAGIAAGFGVVRELVGHGIGTRFHEEPQVPNHGQPHRGAQLKPGMTIAIEPMITAGSYETRTLPDKWTVVTVDGSLSAHFEHTVAITLEGPRVLTM

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.28
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10172036 3300005293 Bacteria 1536
2 Ga0070690_100153621 3300005330 Bacteria 1572
3 Ga0070690_100173623 3300005330 Bacteria 1485
4 Ga0070677_10018546 3300005333 Bacteria 2507
5 Ga0070677_10089284 3300005333 Bacteria 1337
6 Ga0068869_100031575 3300005334 Bacteria 3726
7 Ga0068869_100107191 3300005334 Bacteria 2121
8 Ga0070666_10088375 3300005335 Bacteria 2126
9 Ga0070680_100012482 3300005336 Bacteria 6603
10 Ga0070680_100022439 3300005336 Bacteria 5028
11 Ga0070680_100740609 3300005336 Bacteria 846
12 Ga0070691_10028357 3300005341 Bacteria 2615
13 Ga0070691_10080743 3300005341 Bacteria 1592
14 Ga0070669_100031531 3300005353 Bacteria 3828
15 Ga0070669_100314702 3300005353 Bacteria 1263
16 Ga0070675_100057312 3300005354 Bacteria 3211
17 Ga0070675_100118286 3300005354 Bacteria 2250
18 Ga0070671_100015791 3300005355 Bacteria 6101
19 Ga0070671_100101892 3300005355 Bacteria 2409
20 Ga0070674_100000221 3300005356 Bacteria 27736
21 Ga0070659_100168209 3300005366 Bacteria 1794
22 Ga0070667_100017617 3300005367 Bacteria 5917
23 Ga0070703_10000400 3300005406 Bacteria 18096
24 Ga0070703_10004333 3300005406 Bacteria 4000
25 Ga0070703_10023034 3300005406 Bacteria 1832
26 Ga0070703_10036825 3300005406 Bacteria 1505
27 Ga0070709_10017281 3300005434 Bacteria 4135
28 Ga0070713_100351713 3300005436 Bacteria 1367
29 Ga0070701_10000503 3300005438 Bacteria 13404
30 Ga0070701_10027625 3300005438 Bacteria 2782
31 Ga0070711_100000073 3300005439 Bacteria 58495
32 Ga0070705_100009725 3300005440 Bacteria 4790
33 Ga0070705_100024075 3300005440 Bacteria 3281
34 Ga0070705_100031246 3300005440 Bacteria 2947
35 Ga0070705_100046042 3300005440 Bacteria 2513
36 Ga0070705_100078760 3300005440 Bacteria 2017
37 Ga0070705_100141344 3300005440 Bacteria 1584
38 Ga0070705_100513412 3300005440 Bacteria 912
39 Ga0070700_100298494 3300005441 Bacteria 1175
40 Ga0070694_100002864 3300005444 Bacteria 10248
41 Ga0070694_100004972 3300005444 Bacteria 8011
42 Ga0070694_100030788 3300005444 Bacteria 3513
43 Ga0070694_100081661 3300005444 Bacteria 2249
44 Ga0070694_100103285 3300005444 Bacteria 2019
45 Ga0070694_100243966 3300005444 Bacteria 1356
46 Ga0070694_100602971 3300005444 Bacteria 884
47 Ga0070708_100002955 3300005445 Bacteria 13216
48 Ga0070708_100003800 3300005445 Bacteria 11845
49 Ga0070708_100012155 3300005445 Bacteria 7018
50 Ga0070708_100022575 3300005445 Bacteria 5338
51 Ga0070708_100030082 3300005445 Bacteria 4690
52 Ga0070708_100073679 3300005445 Bacteria 3078
53 Ga0070708_100075367 3300005445 Bacteria 3045
54 Ga0070708_100121780 3300005445 Bacteria 2407
55 Ga0070708_100143211 3300005445 Bacteria 2218
56 Ga0070708_100213598 3300005445 Bacteria 1808
57 Ga0070708_100793220 3300005445 Bacteria 890
58 Ga0070678_100002764 3300005456 Bacteria 9697
59 Ga0070662_100000495 3300005457 Bacteria 23489
60 Ga0068867_100005437 3300005459 Bacteria 9015
61 Ga0068867_100077973 3300005459 Bacteria 2491
62 Ga0070706_100013278 3300005467 Bacteria 7618
63 Ga0070706_100027105 3300005467 Bacteria 5272
64 Ga0070706_100058698 3300005467 Bacteria 3551
65 Ga0070706_100064520 3300005467 Bacteria 3385
66 Ga0070706_100103033 3300005467 Bacteria 2653
67 Ga0070706_100198197 3300005467 Bacteria 1876
68 Ga0070706_100269523 3300005467 Bacteria 1589
69 Ga0070706_100492088 3300005467 Bacteria 1141
70 Ga0070707_100004355 3300005468 Bacteria 13269
71 Ga0070707_100019858 3300005468 Bacteria 6334
72 Ga0070707_100022307 3300005468 Bacteria 5984
73 Ga0070707_100102938 3300005468 Bacteria 2767
74 Ga0070707_100130438 3300005468 Bacteria 2444
75 Ga0070707_100151021 3300005468 Unclassified 2262
76 Ga0070707_100165154 3300005468 Bacteria 2157
77 Ga0070698_100001849 3300005471 Bacteria 23572
78 Ga0070698_100005769 3300005471 Bacteria 13540
79 Ga0070698_100059762 3300005471 Bacteria 3849
80 Ga0070698_100143327 3300005471 Bacteria 2339
81 Ga0070699_100003912 3300005518 Bacteria 13158
82 Ga0070699_100007097 3300005518 Bacteria 9730
83 Ga0070699_100014358 3300005518 Bacteria 6808
84 Ga0070699_100033605 3300005518 Bacteria 4431
85 Ga0070699_100036013 3300005518 Bacteria 4279
86 Ga0070699_100047106 3300005518 Bacteria 3730
87 Ga0070699_100050458 3300005518 Bacteria 3602
88 Ga0070699_100055580 3300005518 Bacteria 3427
89 Ga0070699_100068165 3300005518 Bacteria 3089
90 Ga0070699_100185919 3300005518 Bacteria 1845
91 Ga0070699_100198299 3300005518 Bacteria 1784
92 Ga0070699_100209320 3300005518 Bacteria 1735
93 Ga0070679_100574612 3300005530 Bacteria 1071
94 Ga0070697_100002528 3300005536 Bacteria 14082
95 Ga0070697_100011384 3300005536 Bacteria 6952
96 Ga0070697_100013208 3300005536 Bacteria 6474
97 Ga0070697_100027041 3300005536 Bacteria 4587
98 Ga0070697_100103428 3300005536 Bacteria 2367
99 Ga0070697_100166743 3300005536 Bacteria 1863
100 Ga0070697_100243663 3300005536 Bacteria 1535
101 Ga0070697_100337252 3300005536 Bacteria 1300
102 Ga0070672_100023772 3300005543 Bacteria 4521
103 Ga0070672_100063726 3300005543 Bacteria 2911
104 Ga0070672_100111119 3300005543 Bacteria 2234
105 Ga0070686_100053929 3300005544 Bacteria 2570
106 Ga0070695_100000708 3300005545 Bacteria 17797
107 Ga0070695_100002446 3300005545 Bacteria 10679
108 Ga0070695_100002490 3300005545 Bacteria 10601
109 Ga0070695_100011920 3300005545 Bacteria 5204
110 Ga0070695_100040537 3300005545 Bacteria 2948
111 Ga0070695_100043206 3300005545 Bacteria 2865
112 Ga0070695_100074795 3300005545 Bacteria 2226
113 Ga0070695_100091101 3300005545 Bacteria 2036
114 Ga0070695_100145384 3300005545 Bacteria 1649
115 Ga0070696_100001655 3300005546 Bacteria 14605
116 Ga0070696_100007194 3300005546 Bacteria 7433
117 Ga0070696_100007549 3300005546 Bacteria 7275
118 Ga0070696_100018458 3300005546 Bacteria 4714
119 Ga0070696_100063764 3300005546 Bacteria 2582
120 Ga0070696_100137147 3300005546 Bacteria 1784
121 Ga0070696_100190806 3300005546 Bacteria 1525
122 Ga0070696_100229105 3300005546 Bacteria 1397
123 Ga0070693_100060056 3300005547 Bacteria 2206
124 Ga0070704_100006456 3300005549 Bacteria 6911
125 Ga0070704_100007402 3300005549 Bacteria 6534
126 Ga0070704_100011139 3300005549 Bacteria 5498
127 Ga0070704_100026415 3300005549 Bacteria 3836
128 Ga0070704_100031354 3300005549 Bacteria 3574
129 Ga0070704_100043891 3300005549 Bacteria 3102
130 Ga0070704_100100528 3300005549 Bacteria 2177
131 Ga0070704_100162347 3300005549 Bacteria 1768
132 Ga0070704_100162822 3300005549 Bacteria 1766
133 Ga0070704_100200113 3300005549 Bacteria 1612
134 Ga0070664_100107382 3300005564 Bacteria 2433
135 Ga0068857_100006227 3300005577 Bacteria 10201
136 Ga0068854_100000444 3300005578 Bacteria 25595
137 Ga0070702_100100541 3300005615 Bacteria 1773
138 Ga0068859_100132746 3300005617 Bacteria 2562
139 Ga0068864_100005272 3300005618 Bacteria 10592
140 Ga0068864_100045691 3300005618 Bacteria 3757
141 Ga0068866_10000625 3300005718 Bacteria 16073
142 Ga0068861_100018407 3300005719 Bacteria 4977
143 Ga0068861_100135129 3300005719 Bacteria 2006
144 Ga0068861_100582865 3300005719 Bacteria 1024
145 Ga0068870_10010421 3300005840 Bacteria 4271
146 Ga0068863_100116437 3300005841 Bacteria 2547
147 Ga0068863_100495095 3300005841 Bacteria 1203
148 Ga0068858_100056283 3300005842 Bacteria 3635
149 Ga0068860_100041878 3300005843 Bacteria 4375
150 Ga0068862_100043478 3300005844 Bacteria 3830
151 Ga0070716_100049621 3300006173 Bacteria 2379
152 Ga0097621_100171709 3300006237 Bacteria 1869
153 Ga0068871_100057216 3300006358 Bacteria 3172
154 Ga0075428_100024257 3300006844 Bacteria 6709
155 Ga0075428_100074322 3300006844 Bacteria 3712
156 Ga0075431_100004690 3300006847 Bacteria 13429
157 Ga0075431_100113593 3300006847 Bacteria 2796
158 Ga0075431_100121386 3300006847 Unclassified 2696
159 Ga0075433_10019487 3300006852 Bacteria 5654
160 Ga0075433_10035328 3300006852 Bacteria 4297
161 Ga0075433_10139413 3300006852 Bacteria 2156
162 Ga0075433_10267606 3300006852 Bacteria 1515
163 Ga0075433_10283632 3300006852 Bacteria 1467
164 Ga0075433_10421723 3300006852 Bacteria 1177
165 Ga0075434_100001309 3300006871 Bacteria 20777
166 Ga0075434_100013195 3300006871 Bacteria 7851
167 Ga0075434_100035536 3300006871 Bacteria 4926
168 Ga0075434_100082939 3300006871 Bacteria 3203
169 Ga0075434_100219146 3300006871 Bacteria 1922
170 Ga0075434_100246424 3300006871 Bacteria 1806
171 Ga0075434_100368938 3300006871 Bacteria 1456
172 Ga0075429_100006438 3300006880 Bacteria 10170
173 Ga0075429_100014606 3300006880 Bacteria 6806
174 Ga0075429_100141586 3300006880 Bacteria 2105
175 Ga0075436_100016067 3300006914 Bacteria 5125
176 Ga0075436_100017112 3300006914 Bacteria 4962
177 Ga0075436_100076859 3300006914 Bacteria 2312
178 Ga0097620_100132752 3300006931 Bacteria 2562
179 Ga0075435_100008387 3300007076 Bacteria 7411
180 Ga0075435_100057282 3300007076 Bacteria 3152
181 Ga0075435_100210642 3300007076 Bacteria 1649
182 Ga0099794_10000157 3300007265 Bacteria 25131
183 Ga0099794_10008565 3300007265 Bacteria 4257
184 Ga0099794_10015189 3300007265 Bacteria 3393
185 Ga0111539_10112436 3300009094 Bacteria 3195
186 Ga0111539_10313436 3300009094 Bacteria 1826
187 Ga0111539_10390150 3300009094 Bacteria 1621
188 Ga0111539_10729194 3300009094 Bacteria 1154
189 Ga0114129_10002536 3300009147 Bacteria 25352
190 Ga0114129_10008126 3300009147 Bacteria 14956
191 Ga0114129_10074564 3300009147 Bacteria 4727
192 Ga0114129_10095879 3300009147 Bacteria 4108
193 Ga0114129_10097744 3300009147 Bacteria 4064
194 Ga0114129_10108059 3300009147 Bacteria 3841
195 Ga0114129_10215057 3300009147 Bacteria 2596
196 Ga0114129_10284320 3300009147 Bacteria 2209
197 Ga0114129_10715013 3300009147 Bacteria 1286
198 Ga0105243_10090432 3300009148 Bacteria 2519
199 Ga0105241_10002264 3300009174 Bacteria 14463
200 Ga0105241_10592482 3300009174 Bacteria 1000
201 Ga0105242_10000898 3300009176 Bacteria 23106
202 Ga0105248_10000553 3300009177 Bacteria 42444
203 Ga0105239_10029421 3300010375 Bacteria 6039
204 Ga0105239_10062386 3300010375 Bacteria 4091
205 Ga0105246_10111427 3300011119 Bacteria 2011
206 Ga0105246_10201409 3300011119 Bacteria 1548
207 Ga0157378_10007725 3300013297 Bacteria 9386
208 Ga0163162_10050140 3300013306 Bacteria 4186
209 Ga0157375_10045014 3300013308 Bacteria 4293
210 Ga0163163_10056096 3300014325 Bacteria 3894
211 Ga0163163_10120904 3300014325 Bacteria 2653
212 Ga0163163_10835971 3300014325 Bacteria 984
213 Ga0157380_10038531 3300014326 Bacteria 3712
214 Ga0157380_10491628 3300014326 Bacteria 1189
215 Ga0157376_10094164 3300014969 Bacteria 2602
216 Ga0163161_10016863 3300017792 Bacteria 5106
217 Ga0207653_10000147 3300025885 Bacteria 49999
218 Ga0207653_10006845 3300025885 Bacteria 3559
219 Ga0207653_10022887 3300025885 Bacteria 1988
220 Ga0207682_10020954 3300025893 Bacteria 2570
221 Ga0207682_10062885 3300025893 Bacteria 1557
222 Ga0207642_10091372 3300025899 Bacteria 1504
223 Ga0207680_10187639 3300025903 Bacteria 1402
224 Ga0207699_10004264 3300025906 Bacteria 6837
225 Ga0207699_10037630 3300025906 Bacteria 2768
226 Ga0207643_10035975 3300025908 Bacteria 2777
227 Ga0207684_10092582 3300025910 Bacteria 2576
228 Ga0207684_10102901 3300025910 Bacteria 2442
229 Ga0207684_10143626 3300025910 Bacteria 2053
230 Ga0207654_10277035 3300025911 Bacteria 1133
231 Ga0207663_10000058 3300025916 Bacteria 58536
232 Ga0207660_10002654 3300025917 Bacteria 11729
233 Ga0207662_10039333 3300025918 Bacteria 2774
234 Ga0207646_10001572 3300025922 Bacteria 27945
235 Ga0207646_10004802 3300025922 Bacteria 14506
236 Ga0207646_10005813 3300025922 Bacteria 12913
237 Ga0207646_10014960 3300025922 Bacteria 7347
238 Ga0207646_10031745 3300025922 Bacteria 4781
239 Ga0207646_10204155 3300025922 Bacteria 1785
240 Ga0207646_10396553 3300025922 Bacteria 1246
241 Ga0207681_10411773 3300025923 Bacteria 1094
242 Ga0207650_10265353 3300025925 Bacteria 1394
243 Ga0207687_10523742 3300025927 Bacteria 992
244 Ga0207700_10282204 3300025928 Bacteria 1429
245 Ga0207644_10213042 3300025931 Bacteria 1528
246 Ga0207690_10426900 3300025932 Bacteria 1061
247 Ga0207706_10000025 3300025933 Bacteria 150958
248 Ga0207686_10001115 3300025934 Bacteria 15582
249 Ga0207709_10004187 3300025935 Bacteria 8374
250 Ga0207669_10000638 3300025937 Bacteria 15128
251 Ga0207704_10002325 3300025938 Bacteria 8541
252 Ga0207665_10008082 3300025939 Bacteria 6943
253 Ga0207665_10069730 3300025939 Bacteria 2398
254 Ga0207691_10132311 3300025940 Bacteria 2202
255 Ga0207711_10007282 3300025941 Bacteria 9270
256 Ga0207689_10002028 3300025942 Bacteria 19145
257 Ga0207689_10123583 3300025942 Bacteria 2129
258 Ga0207651_10153211 3300025960 Bacteria 1797
259 Ga0207712_10001387 3300025961 Bacteria 16586
260 Ga0207712_10047043 3300025961 Bacteria 2993
261 Ga0207640_10001530 3300025981 Bacteria 12469
262 Ga0207658_10044377 3300025986 Bacteria 3237
263 Ga0207703_10018133 3300026035 Bacteria 5497
264 Ga0207678_10287056 3300026067 Bacteria 1413
265 Ga0207708_10011972 3300026075 Bacteria 6462
266 Ga0207708_10043509 3300026075 Bacteria 3422
267 Ga0207641_10660137 3300026088 Bacteria 1028
268 Ga0207641_10757059 3300026088 Unclassified 959
269 Ga0207648_10000138 3300026089 Bacteria 72558
270 Ga0207648_10148064 3300026089 Bacteria 2071
271 Ga0207676_10061708 3300026095 Bacteria 2969
272 Ga0207676_10132837 3300026095 Bacteria 2119
273 Ga0207674_10057059 3300026116 Bacteria 3960
274 Ga0207675_100007008 3300026118 Bacteria 10659
275 Ga0207675_100072751 3300026118 Bacteria 3216
276 Ga0207683_10006886 3300026121 Bacteria 9733
277 Ga0209588_1000118 3300027671 Bacteria 23354
278 Ga0209588_1002257 3300027671 Bacteria 5212
279 Ga0268264_10461980 3300028381 Bacteria 1232
280 Ga0307408_100024162 3300031548 Bacteria 4147
281 Ga0316575_10007541 3300031665 Bacteria 3940
282 Ga0307405_10082860 3300031731 Bacteria 2101
283 Ga0307413_10008669 3300031824 Bacteria 4818
284 Ga0307413_10023385 3300031824 Bacteria 3349
285 Ga0307413_10035744 3300031824 Bacteria 2853
286 Ga0307413_10213219 3300031824 Bacteria 1404
287 Ga0307410_10002797 3300031852 Bacteria 8549
288 Ga0307410_10011250 3300031852 Bacteria 5108
289 Ga0307410_10017270 3300031852 Bacteria 4328
290 Ga0307410_10044948 3300031852 Bacteria 2937
291 Ga0307410_10071046 3300031852 Bacteria 2413
292 Ga0307410_10156219 3300031852 Bacteria 1704
293 Ga0307406_10121626 3300031901 Bacteria 1816
294 Ga0307406_10258292 3300031901 Bacteria 1316
295 Ga0307407_10002696 3300031903 Bacteria 7041
296 Ga0307407_10054882 3300031903 Bacteria 2300
297 Ga0307407_10476287 3300031903 Bacteria 911
298 Ga0307412_10253504 3300031911 Bacteria 1368
299 Ga0307409_100000501 3300031995 Bacteria 16895
300 Ga0307409_100009842 3300031995 Bacteria 5898
301 Ga0307409_100013494 3300031995 Bacteria 5262
302 Ga0307409_100065582 3300031995 Bacteria 2858
303 Ga0307409_100072311 3300031995 Bacteria 2746
304 Ga0307409_100175416 3300031995 Bacteria 1891
305 Ga0307409_100495024 3300031995 Bacteria 1189
306 Ga0307409_100682052 3300031995 Bacteria 1025
307 Ga0307416_100003220 3300032002 Bacteria 9563
308 Ga0307416_100013407 3300032002 Bacteria 5570
309 Ga0307416_100083848 3300032002 Bacteria 2706
310 Ga0307416_100340168 3300032002 Bacteria 1513
311 Ga0307416_100386225 3300032002 Bacteria 1432
312 Ga0307416_100601895 3300032002 Bacteria 1179
313 Ga0307414_10002427 3300032004 Bacteria 9745
314 Ga0307414_10023155 3300032004 Bacteria 3934
315 Ga0307414_10058397 3300032004 Bacteria 2718
316 Ga0307414_10171058 3300032004 Bacteria 1737
317 Ga0307414_10215425 3300032004 Bacteria 1573
318 Ga0307414_10222334 3300032004 Bacteria 1551
319 Ga0307414_10736328 3300032004 Bacteria 895
320 Ga0307411_10000568 3300032005 Bacteria 13149
321 Ga0307411_10001075 3300032005 Bacteria 10594
322 Ga0307411_10002193 3300032005 Bacteria 8487
323 Ga0307411_10037682 3300032005 Bacteria 3043
324 Ga0307411_10199814 3300032005 Bacteria 1534
325 Ga0307411_10211703 3300032005 Bacteria 1497
326 Ga0307415_100004330 3300032126 Bacteria 7351
327 Ga0307415_100052304 3300032126 Bacteria 2777
328 Ga0307415_100059867 3300032126 Bacteria 2629
329 Ga0307415_100305980 3300032126 Bacteria 1319
330 Ga0373929_0065014 3300035085 Bacteria 862
331 Ga0373932_0036424 3300035112 Bacteria 1397
332 Ga0373939_0059898 3300035114 Bacteria 1209
333 Ga0316574_0046692 3300035398 Bacteria 2686
334 Ga0373931_0011551 3300035691 Bacteria 4266
335 Ga0373931_0099991 3300035691 Bacteria 1630
336 Ga0373931_0120866 3300035691 Bacteria 1497
337 Ga0373927_0480747 3300035695 Bacteria 821
338 Ga0373937_0266127 3300036401 Bacteria 1617
339 Ga0316584_0042400 3300036712 Bacteria 3394
340 Ga0395905_0193004 3300037471 Bacteria 1910
341 Ga0395905_0269065 3300037471 Bacteria 1590
342 Ga0316581_0010755 3300037588 Bacteria 2544
343 Ga0242420_015095 3300038996 Bacteria 1333
344 Ga0439446_0036952 3300042156 Bacteria 1429
345 Ga0439446_0039794 3300042156 Bacteria 1382
346 Ga0451577_0027119 3300042876 Bacteria 5185
347 Ga0451577_0219675 3300042876 Bacteria 1718
348 Ga0451577_0353228 3300042876 Bacteria 1334
349 Ga0451577_0555488 3300042876 Bacteria 1042
350 Ga0453683_0010893 3300044673 Bacteria 6012
351 Ga0453684_1318957 3300044712 Bacteria 752
352 Ga0451576_0015443 3300045051 Bacteria 8457
353 Ga0451576_0016252 3300045051 Bacteria 8219
354 Ga0451576_0064582 3300045051 Bacteria 3812
355 Ga0451576_0156383 3300045051 Bacteria 2378
356 Ga0451576_0187739 3300045051 Bacteria 2158
357 Ga0451576_0296689 3300045051 Bacteria 1690
358 Ga0451576_0481455 3300045051 Bacteria 1303
359 Ga0466967_1029168 3300045976 Bacteria 820
360 Ga0495603_0057154 3300046455 Bacteria 2309
361 Ga0495580_0335669 3300046472 Bacteria 1026
362 Ga0495582_0026518 3300046473 Bacteria 3176
363 Ga0495639_0024118 3300046475 Bacteria 2676
364 Ga0495662_0012116 3300046476 Bacteria 4214
365 Ga0495664_0004041 3300046477 Bacteria 8003
366 Ga0495594_0179991 3300046499 Bacteria 1203
367 Ga0495618_0017017 3300046514 Bacteria 4455
368 Ga0495630_0003672 3300046517 Bacteria 10702
369 Ga0495666_0009308 3300046526 Bacteria 4912
370 Ga0495665_0099100 3300046531 Bacteria 1530
371 Ga0495640_0008996 3300046533 Bacteria 7798
372 Ga0495586_0018411 3300046535 Bacteria 3718
373 Ga0495609_0182178 3300046538 Bacteria 884
374 Ga0495621_0112915 3300046539 Bacteria 1043
375 Ga0495622_0038429 3300046557 Bacteria 2229
376 Ga0495634_0001123 3300046642 Bacteria 24774
377 Ga0495611_0096488 3300046648 Bacteria 1369
378 Ga0495635_0441738 3300046663 Bacteria 861
379 Ga0495647_0164216 3300046681 Bacteria 958
380 Ga0495658_0003647 3300046683 Bacteria 7620
381 Ga0495613_0214588 3300046689 Bacteria 1352
382 Ga0495670_0307056 3300046691 Bacteria 851
383 Ga0495636_0015671 3300047318 Bacteria 3022
384 Ga0495674_0006511 3300047319 Bacteria 11206
385 Ga0495680_0438824 3300047322 Bacteria 895
386 Ga0495684_0138581 3300047471 Bacteria 1825
387 Ga0496101_0066105 3300048904 Bacteria 2637
388 Ga0496101_0086544 3300048904 Bacteria 2324
389 Ga0496101_0227174 3300048904 Bacteria 1450
390 Ga0496101_0314979 3300048904 Bacteria 1227
391 Ga0496102_0002335 3300048905 Bacteria 16187
392 Ga0496102_0117502 3300048905 Bacteria 2482
393 Ga0496102_0129252 3300048905 Bacteria 2363
394 Ga0496102_0434624 3300048905 Bacteria 1232
395 Ga0496103_0040224 3300048906 Bacteria 2873
396 Ga0496103_0099184 3300048906 Bacteria 1843
397 Ga0496104_0003370 3300048907 Bacteria 13806
398 Ga0496104_0004916 3300048907 Bacteria 11658
399 Ga0496104_0017568 3300048907 Bacteria 6518
400 Ga0496104_0061427 3300048907 Bacteria 3563
401 Ga0496105_0133899 3300048908 Bacteria 2042
402 Ga0496106_0006627 3300048909 Bacteria 8573
403 Ga0496106_0012863 3300048909 Bacteria 6177
404 Ga0496106_0040184 3300048909 Bacteria 3503
405 Ga0496106_0179104 3300048909 Bacteria 1682
406 Ga0496106_0215436 3300048909 Bacteria 1530
407 Ga0496106_0251024 3300048909 Bacteria 1414
408 Ga0496106_0276937 3300048909 Bacteria 1344
409 Ga0496106_0336107 3300048909 Bacteria 1213
410 Ga0496107_0025969 3300048910 Bacteria 4151
411 Ga0496107_0192918 3300048910 Bacteria 1514
412 Ga0496108_0013301 3300048911 Bacteria 6709
413 Ga0496108_0015304 3300048911 Bacteria 6258
414 Ga0496109_0000716 3300048912 Bacteria 27631
415 Ga0496109_0002383 3300048912 Bacteria 15709
416 Ga0496109_0011098 3300048912 Bacteria 7725
417 Ga0496109_0041379 3300048912 Bacteria 4174
418 Ga0496110_0005386 3300048913 Bacteria 10029
419 Ga0496110_0027348 3300048913 Bacteria 4889
420 Ga0496110_0038740 3300048913 Bacteria 4149
421 Ga0496110_0039608 3300048913 Bacteria 4104
422 Ga0496111_0001415 3300048914 Bacteria 13651
423 Ga0496111_0021474 3300048914 Bacteria 4509
424 Ga0496111_0086701 3300048914 Bacteria 2291
425 Ga0496112_0005776 3300048915 Bacteria 10762
426 Ga0496112_0031663 3300048915 Bacteria 5131
427 Ga0496112_0118411 3300048915 Bacteria 2618
428 Ga0496112_0256053 3300048915 Bacteria 1701
429 Ga0496113_0001258 3300048916 Bacteria 13982
430 Ga0496113_0017483 3300048916 Bacteria 4978
431 Ga0496114_0031673 3300048917 Bacteria 4350
432 Ga0496114_0432309 3300048917 Bacteria 1166
433 Ga0496114_0611754 3300048917 Bacteria 960
434 Ga0496115_0223163 3300048918 Bacteria 1555
435 Ga0501031_0059743 3300049568 Bacteria 2484
436 Ga0501031_0299120 3300049568 Bacteria 1043
437 Ga0501031_0387596 3300049568 Bacteria 904
438 Ga0501032_0168027 3300049569 Bacteria 1439
439 Ga0501033_0101660 3300049570 Bacteria 2097
440 Ga0501034_0008138 3300049571 Bacteria 11119
441 Ga0501036_0276418 3300049572 Bacteria 1406
442 Ga0501038_0139438 3300049574 Bacteria 1985
443 Ga0501038_0344309 3300049574 Bacteria 1162
444 Ga0501040_0038105 3300049576 Bacteria 3268
445 Ga0501040_0042871 3300049576 Bacteria 3083
446 Ga0501040_0133964 3300049576 Bacteria 1743
447 Ga0501041_0005915 3300049577 Bacteria 7152
448 Ga0501041_0130025 3300049577 Bacteria 1568
449 Ga0501041_0411238 3300049577 Bacteria 857
450 Ga0501043_0513502 3300049579 Bacteria 894
451 Ga0501046_0031036 3300049580 Bacteria 4335
452 Ga0501046_0107152 3300049580 Bacteria 2138
453 Ga0501046_0149895 3300049580 Bacteria 1760
454 Ga0501046_0175840 3300049580 Bacteria 1604
455 Ga0501048_0044063 3300049582 Bacteria 3192
456 Ga0501067_0028450 3300049583 Bacteria 3096
457 Ga0501067_0076986 3300049583 Bacteria 1848
458 Ga0501067_0172676 3300049583 Bacteria 1204
459 Ga0501068_0000074 3300049584 Bacteria 39863
460 Ga0501068_0005867 3300049584 Bacteria 6740
461 Ga0501069_0002254 3300049585 Bacteria 9728
462 Ga0501069_0004361 3300049585 Bacteria 7302
463 Ga0501069_0013137 3300049585 Bacteria 4414
464 Ga0501070_0011246 3300049586 Bacteria 7558
465 Ga0501070_0086505 3300049586 Bacteria 2595
466 Ga0501070_0359505 3300049586 Bacteria 1181
467 Ga0501071_0012717 3300049587 Bacteria 5721
468 Ga0501071_0014765 3300049587 Bacteria 5346
469 Ga0501071_0039065 3300049587 Bacteria 3394
470 Ga0501071_0041914 3300049587 Bacteria 3278
471 Ga0501071_0368070 3300049587 Bacteria 1095
472 Ga0501072_0001150 3300049588 Bacteria 19668
473 Ga0501072_0009461 3300049588 Bacteria 7411
474 Ga0501072_0045433 3300049588 Bacteria 3454
475 Ga0501072_0063513 3300049588 Bacteria 2913
476 Ga0501073_0088822 3300049589 Bacteria 2148
477 Ga0501073_0103945 3300049589 Bacteria 1971
478 Ga0501074_0005104 3300049590 Bacteria 9431
479 Ga0501074_0013526 3300049590 Bacteria 5931
480 Ga0501074_0028966 3300049590 Bacteria 4012
481 Ga0501074_0087048 3300049590 Bacteria 2238
482 Ga0501074_0358761 3300049590 Bacteria 1034
483 Ga0501075_0030791 3300049591 Bacteria 3977
484 Ga0501075_0053825 3300049591 Bacteria 3026
485 Ga0501075_0085367 3300049591 Bacteria 2392
486 Ga0501075_0504197 3300049591 Bacteria 923
487 Ga0501076_0006957 3300049592 Bacteria 8222
488 Ga0501076_0018259 3300049592 Bacteria 5344
489 Ga0501076_0093530 3300049592 Bacteria 2419
490 Ga0501076_0278966 3300049592 Bacteria 1369
491 Ga0501076_0711143 3300049592 Bacteria 829
492 Ga0501077_0004692 3300049593 Bacteria 8308
493 Ga0501077_0021490 3300049593 Bacteria 4083
494 Ga0501077_0277655 3300049593 Bacteria 1066
495 Ga0501225_0086682 3300049705 Bacteria 904
496 Ga0501079_0008496 3300049741 Bacteria 7787
497 Ga0501079_0095858 3300049741 Bacteria 2299
498 Ga0501079_0183121 3300049741 Bacteria 1635
499 Ga0501079_0184104 3300049741 Bacteria 1630
500 Ga0501079_0216668 3300049741 Bacteria 1495
501 Ga0501080_0017337 3300049742 Bacteria 6658
502 Ga0501080_0053401 3300049742 Bacteria 3762
503 Ga0501080_0059282 3300049742 Bacteria 3562
504 Ga0501081_0018953 3300049743 Bacteria 4575
505 Ga0501081_0051957 3300049743 Bacteria 2827
506 Ga0501081_0131341 3300049743 Bacteria 1789
507 Ga0501081_0312882 3300049743 Bacteria 1153
508 Ga0501081_0351571 3300049743 Bacteria 1086
509 Ga0501083_0013805 3300049744 Bacteria 5648
510 Ga0501083_0098320 3300049744 Bacteria 1930
511 Ga0501083_0336031 3300049744 Bacteria 982
512 Ga0501083_0361268 3300049744 Bacteria 944
513 Ga0501044_0441680 3300049823 Bacteria 1209
514 Ga0501044_0551044 3300049823 Bacteria 1050
515 Ga0501045_0033270 3300049824 Bacteria 3738
516 Ga0501045_0053219 3300049824 Bacteria 2958
517 Ga0501045_0087153 3300049824 Bacteria 2305
518 Ga0501045_0095019 3300049824 Bacteria 2205
519 nmdc:mga05p37_164956_c1 3300050507 Bacteria 2704
520 nmdc:mga05p37_1880_c1 3300050507 Bacteria 24467
521 nmdc:mga05p37_28175_c1 3300050507 Bacteria 6848
522 nmdc:mga05p37_447704_c1 3300050507 Bacteria 1496
523 nmdc:mga05p37_550137_c1 3300050507 Bacteria 1314
524 nmdc:mga05p37_733008_c1 3300050507 Bacteria 1092
525 nmdc:mga05p37_832844_c1 3300050507 Unclassified 1004
526 nmdc:mga05p37_99343_c1 3300050507 Bacteria 3585
527 nmdc:mga09592_160873_c1 3300050508 Bacteria 1939
528 nmdc:mga09592_1960_c1 3300050508 Bacteria 16589
529 nmdc:mga09592_5396_c1 3300050508 Bacteria 10399
530 nmdc:mga09592_69229_c1 3300050508 Bacteria 2993
531 nmdc:mga0qj67_197117_c1 3300050509 Bacteria 1636
532 nmdc:mga0qj67_31067_c1 3300050509 Bacteria 4159
533 nmdc:mga06r32_148498_c1 3300050510 Bacteria 2322
534 nmdc:mga06r32_6157_c1 3300050510 Bacteria 10771
535 nmdc:mga08y16_99058_c1 3300050511 Bacteria 3035
536 nmdc:mga0n895_1677_c1 3300050512 Bacteria 16725
537 nmdc:mga0n895_26066_c1 3300050512 Bacteria 5530
538 nmdc:mga0n895_31878_c1 3300050512 Bacteria 5053
539 nmdc:mga0n895_436728_c1 3300050512 Bacteria 1323
540 nmdc:mga0n895_57617_c1 3300050512 Bacteria 3830
541 nmdc:mga0n895_78649_c1 3300050512 Bacteria 3283
542 nmdc:mga0n895_9435_c1 3300050512 Bacteria 6055
543 nmdc:mga0rr50_171814_c1 3300050513 Bacteria 1767
544 nmdc:mga0rr50_18124_c1 3300050513 Bacteria 4721
545 nmdc:mga0rr50_44095_c1 3300050513 Bacteria 3269
546 nmdc:mga08x19_169658_c1 3300050514 Bacteria 1486
547 nmdc:mga08x19_216214_c1 3300050514 Bacteria 1316
548 nmdc:mga08x19_22629_c1 3300050514 Bacteria 3892
549 nmdc:mga08x19_22843_c1 3300050514 Bacteria 3877
550 nmdc:mga08x19_48739_c1 3300050514 Bacteria 2715
551 nmdc:mga08x19_67948_c1 3300050514 Bacteria 2319
552 nmdc:mga08x19_74331_c1 3300050514 Bacteria 2220
553 nmdc:mga08x19_9469_c1 3300050514 Bacteria 2154
554 nmdc:mga0a205_105201_c1 3300050515 Bacteria 2721
555 nmdc:mga0a205_114875_c2 3300050515 Bacteria 887
556 nmdc:mga0a205_169520_c1 3300050515 Bacteria 2079
557 nmdc:mga0a205_20540_c1 3300050515 Bacteria 6233
558 nmdc:mga0a205_37980_c2 3300050515 Bacteria 2677
559 nmdc:mga0a205_67853_c1 3300050515 Bacteria 2792
560 Ga0501084_0019923 3300054114 Bacteria 5591
561 Ga0501084_0062580 3300054114 Bacteria 3115
562 Ga0501084_0127328 3300054114 Bacteria 2143
563 Ga0501084_0180391 3300054114 Bacteria 1782
564 Ga0501084_0186501 3300054114 Bacteria 1750
565 Ga0501084_0392109 3300054114 Bacteria 1173
566 Ga0590071_001007 3300059421 Bacteria 7690
567 Ga0590071_002282 3300059421 Bacteria 4852
568 Ga0590071_004274 3300059421 Bacteria 3474
569 Ga0590075_017982 3300059424 Bacteria 1746
570 Ga0590077_022214 3300059426 Bacteria 1353
571 Ga0501082_0018050 3300060353 Bacteria 6076
572 Ga0501082_0037358 3300060353 Bacteria 4186
573 Ga0501082_0049443 3300060353 Bacteria 3626
574 Ga0501082_0051060 3300060353 Bacteria 3564
575 Ga0501082_0052999 3300060353 Bacteria 3497
576 Ga0501082_0161650 3300060353 Bacteria 1946
577 Ga0501082_0219164 3300060353 Bacteria 1656
578 Ga0501082_0445516 3300060353 Bacteria 1131
579 Ga0530510_0109229 3300061734 Bacteria 2025
580 Ga0530510_0342836 3300061734 Bacteria 1122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0172676 Ga0501067_0172676_13_660 194
2 3300050514 nmdc:mga08x19_22843_c1 nmdc:mga08x19_22843_c1_18_680 220
3 3300044712 Ga0453684_1318957 Ga0453684_1318957_56_727 223
4 3300050512 nmdc:mga0n895_57617_c1 nmdc:mga0n895_57617_c1_3140_3817 223
5 3300035695 Ga0373927_0480747 Ga0373927_0480747_134_808 224
6 3300049744 Ga0501083_0361268 Ga0501083_0361268_26_700 224
7 3300049823 Ga0501044_0441680 Ga0501044_0441680_10_687 224
8 3300014325 Ga0163163_10056096 Ga0163163_100560963 225
9 3300005618 Ga0068864_100045691 Ga0068864_1000456913 227
10 3300005841 Ga0068863_100116437 Ga0068863_1001164373 227
11 3300026095 Ga0207676_10132837 Ga0207676_101328371 227
12 3300049585 Ga0501069_0013137 Ga0501069_0013137_3629_4378 228
13 3300049586 Ga0501070_0359505 Ga0501070_0359505_270_1019 228
14 3300026088 Ga0207641_10757059 Ga0207641_107570591 230
15 3300045051 Ga0451576_0187739 Ga0451576_0187739_677_1438 232
16 3300042876 Ga0451577_0555488 Ga0451577_0555488_300_1019 237
17 3300046681 Ga0495647_0164216 Ga0495647_0164216_235_948 237
18 3300047322 Ga0495680_0438824 Ga0495680_0438824_126_839 237
19 3300005336 Ga0070680_100022439 Ga0070680_1000224392 238
20 3300005366 Ga0070659_100168209 Ga0070659_1001682092 238
21 3300005438 Ga0070701_10000503 Ga0070701_1000050320 238
22 3300005440 Ga0070705_100024075 Ga0070705_1000240754 238
23 3300005444 Ga0070694_100081661 Ga0070694_1000816613 238
24 3300005544 Ga0070686_100053929 Ga0070686_1000539293 238
25 3300005564 Ga0070664_100107382 Ga0070664_1001073823 238
26 3300005719 Ga0068861_100582865 Ga0068861_1005828652 238
27 3300006852 Ga0075433_10139413 Ga0075433_101394133 238
28 3300025932 Ga0207690_10426900 Ga0207690_104269002 238
29 3300031901 Ga0307406_10258292 Ga0307406_102582922 238
30 3300045976 Ga0466967_1029168 Ga0466967_1029168_87_806 238
31 3300046539 Ga0495621_0112915 Ga0495621_0112915_304_1026 238
32 3300048906 Ga0496103_0040224 Ga0496103_0040224_11_727 238
33 3300048909 Ga0496106_0276937 Ga0496106_0276937_20_736 238
34 3300049587 Ga0501071_0368070 Ga0501071_0368070_117_854 238
35 3300049705 Ga0501225_0086682 Ga0501225_0086682_163_879 238
36 3300060353 Ga0501082_0445516 Ga0501082_0445516_345_1082 238
37 3300014325 Ga0163163_10835971 Ga0163163_108359711 239
38 3300035112 Ga0373932_0036424 Ga0373932_0036424_369_1121 239
39 3300035691 Ga0373931_0120866 Ga0373931_0120866_164_916 239
40 3300048907 Ga0496104_0004916 Ga0496104_0004916_10256_11008 239
41 3300048908 Ga0496105_0133899 Ga0496105_0133899_637_1389 239
42 3300048909 Ga0496106_0215436 Ga0496106_0215436_198_950 239
43 3300048912 Ga0496109_0000716 Ga0496109_0000716_653_1405 239
44 3300048913 Ga0496110_0039608 Ga0496110_0039608_605_1357 239
45 3300048914 Ga0496111_0086701 Ga0496111_0086701_497_1249 239
46 3300048915 Ga0496112_0118411 Ga0496112_0118411_680_1432 239
47 3300048916 Ga0496113_0017483 Ga0496113_0017483_3525_4277 239
48 3300035691 Ga0373931_0099991 Ga0373931_0099991_628_1365 245
49 3300005444 Ga0070694_100103285 Ga0070694_1001032853 248
50 3300005518 Ga0070699_100185919 Ga0070699_1001859192 248
51 3300005545 Ga0070695_100145384 Ga0070695_1001453842 248
52 3300049742 Ga0501080_0017337 Ga0501080_0017337_5646_6392 248
53 3300005330 Ga0070690_100173623 Ga0070690_1001736232 249
54 3300005333 Ga0070677_10018546 Ga0070677_100185462 249
55 3300005334 Ga0068869_100031575 Ga0068869_1000315753 249
56 3300005335 Ga0070666_10088375 Ga0070666_100883752 249
57 3300005341 Ga0070691_10028357 Ga0070691_100283573 249
58 3300005353 Ga0070669_100031531 Ga0070669_1000315314 249
59 3300005354 Ga0070675_100057312 Ga0070675_1000573124 249
60 3300005354 Ga0070675_100118286 Ga0070675_1001182863 249
61 3300005355 Ga0070671_100101892 Ga0070671_1001018921 249
62 3300005356 Ga0070674_100000221 Ga0070674_10000022113 249
63 3300005367 Ga0070667_100017617 Ga0070667_1000176173 249
64 3300005440 Ga0070705_100009725 Ga0070705_1000097253 249
65 3300005445 Ga0070708_100073679 Ga0070708_1000736792 249
66 3300005456 Ga0070678_100002764 Ga0070678_1000027643 249
67 3300005457 Ga0070662_100000495 Ga0070662_10000049514 249
68 3300005459 Ga0068867_100005437 Ga0068867_10000543713 249
69 3300005536 Ga0070697_100243663 Ga0070697_1002436632 249
70 3300005543 Ga0070672_100111119 Ga0070672_1001111192 249
71 3300005545 Ga0070695_100011920 Ga0070695_1000119205 249
72 3300005547 Ga0070693_100060056 Ga0070693_1000600564 249
73 3300005549 Ga0070704_100200113 Ga0070704_1002001132 249
74 3300005577 Ga0068857_100006227 Ga0068857_10000622716 249
75 3300005578 Ga0068854_100000444 Ga0068854_10000044425 249
76 3300005618 Ga0068864_100005272 Ga0068864_10000527217 249
77 3300005718 Ga0068866_10000625 Ga0068866_100006252 249
78 3300005719 Ga0068861_100018407 Ga0068861_1000184075 249
79 3300005840 Ga0068870_10010421 Ga0068870_100104214 249
80 3300005841 Ga0068863_100495095 Ga0068863_1004950952 249
81 3300005842 Ga0068858_100056283 Ga0068858_1000562833 249
82 3300005843 Ga0068860_100041878 Ga0068860_1000418783 249
83 3300005844 Ga0068862_100043478 Ga0068862_1000434784 249
84 3300006237 Ga0097621_100171709 Ga0097621_1001717091 249
85 3300006358 Ga0068871_100057216 Ga0068871_1000572162 249
86 3300006847 Ga0075431_100004690 Ga0075431_1000046902 249
87 3300006871 Ga0075434_100001309 Ga0075434_10000130913 249
88 3300006880 Ga0075429_100014606 Ga0075429_1000146065 249
89 3300006914 Ga0075436_100076859 Ga0075436_1000768592 249
90 3300007076 Ga0075435_100210642 Ga0075435_1002106422 249
91 3300009147 Ga0114129_10284320 Ga0114129_102843202 249
92 3300009148 Ga0105243_10090432 Ga0105243_100904322 249
93 3300009174 Ga0105241_10002264 Ga0105241_100022649 249
94 3300009176 Ga0105242_10000898 Ga0105242_1000089812 249
95 3300009177 Ga0105248_10000553 Ga0105248_1000055339 249
96 3300010375 Ga0105239_10062386 Ga0105239_100623866 249
97 3300011119 Ga0105246_10111427 Ga0105246_101114272 249
98 3300013297 Ga0157378_10007725 Ga0157378_100077257 249
99 3300013306 Ga0163162_10050140 Ga0163162_100501403 249
100 3300014325 Ga0163163_10120904 Ga0163163_101209043 249
101 3300014326 Ga0157380_10038531 Ga0157380_100385313 249
102 3300017792 Ga0163161_10016863 Ga0163161_100168636 249
103 3300025893 Ga0207682_10062885 Ga0207682_100628851 249
104 3300025899 Ga0207642_10091372 Ga0207642_100913722 249
105 3300025903 Ga0207680_10187639 Ga0207680_101876392 249
106 3300025908 Ga0207643_10035975 Ga0207643_100359751 249
107 3300025911 Ga0207654_10277035 Ga0207654_102770352 249
108 3300025927 Ga0207687_10523742 Ga0207687_105237422 249
109 3300025931 Ga0207644_10213042 Ga0207644_102130422 249
110 3300025933 Ga0207706_10000025 Ga0207706_1000002556 249
111 3300025934 Ga0207686_10001115 Ga0207686_1000111526 249
112 3300025935 Ga0207709_10004187 Ga0207709_100041873 249
113 3300025937 Ga0207669_10000638 Ga0207669_1000063826 249
114 3300025938 Ga0207704_10002325 Ga0207704_100023255 249
115 3300025940 Ga0207691_10132311 Ga0207691_101323111 249
116 3300025941 Ga0207711_10007282 Ga0207711_100072826 249
117 3300025942 Ga0207689_10002028 Ga0207689_1000202810 249
118 3300025961 Ga0207712_10001387 Ga0207712_1000138715 249
119 3300025961 Ga0207712_10047043 Ga0207712_100470433 249
120 3300025981 Ga0207640_10001530 Ga0207640_1000153011 249
121 3300025986 Ga0207658_10044377 Ga0207658_100443773 249
122 3300026035 Ga0207703_10018133 Ga0207703_100181334 249
123 3300026067 Ga0207678_10287056 Ga0207678_102870562 249
124 3300026075 Ga0207708_10011972 Ga0207708_100119726 249
125 3300026088 Ga0207641_10660137 Ga0207641_106601372 249
126 3300026089 Ga0207648_10000138 Ga0207648_1000013852 249
127 3300026095 Ga0207676_10061708 Ga0207676_100617083 249
128 3300026116 Ga0207674_10057059 Ga0207674_100570593 249
129 3300026118 Ga0207675_100007008 Ga0207675_10000700814 249
130 3300026121 Ga0207683_10006886 Ga0207683_1000688610 249
131 3300028381 Ga0268264_10461980 Ga0268264_104619801 249
132 3300031665 Ga0316575_10007541 Ga0316575_100075416 249
133 3300035398 Ga0316574_0046692 Ga0316574_0046692_1895_2647 249
134 3300036401 Ga0373937_0266127 Ga0373937_0266127_818_1567 249
135 3300036712 Ga0316584_0042400 Ga0316584_0042400_385_1137 249
136 3300037588 Ga0316581_0010755 Ga0316581_0010755_1357_2109 249
137 3300042876 Ga0451577_0027119 Ga0451577_0027119_4157_4981 249
138 3300045051 Ga0451576_0064582 Ga0451576_0064582_695_1450 249
139 3300045051 Ga0451576_0481455 Ga0451576_0481455_405_1160 249
140 3300046455 Ga0495603_0057154 Ga0495603_0057154_461_1210 249
141 3300046472 Ga0495580_0335669 Ga0495580_0335669_127_882 249
142 3300046473 Ga0495582_0026518 Ga0495582_0026518_2409_3158 249
143 3300046475 Ga0495639_0024118 Ga0495639_0024118_178_927 249
144 3300046476 Ga0495662_0012116 Ga0495662_0012116_3414_4163 249
145 3300046477 Ga0495664_0004041 Ga0495664_0004041_1929_2678 249
146 3300046499 Ga0495594_0179991 Ga0495594_0179991_390_1139 249
147 3300046514 Ga0495618_0017017 Ga0495618_0017017_3563_4312 249
148 3300046517 Ga0495630_0003672 Ga0495630_0003672_6683_7432 249
149 3300046526 Ga0495666_0009308 Ga0495666_0009308_4142_4891 249
150 3300046531 Ga0495665_0099100 Ga0495665_0099100_717_1466 249
151 3300046533 Ga0495640_0008996 Ga0495640_0008996_2520_3269 249
152 3300046535 Ga0495586_0018411 Ga0495586_0018411_1473_2222 249
153 3300046557 Ga0495622_0038429 Ga0495622_0038429_1385_2134 249
154 3300046642 Ga0495634_0001123 Ga0495634_0001123_11887_12636 249
155 3300046648 Ga0495611_0096488 Ga0495611_0096488_262_1011 249
156 3300046663 Ga0495635_0441738 Ga0495635_0441738_28_777 249
157 3300046683 Ga0495658_0003647 Ga0495658_0003647_4203_4952 249
158 3300046689 Ga0495613_0214588 Ga0495613_0214588_515_1264 249
159 3300046691 Ga0495670_0307056 Ga0495670_0307056_31_780 249
160 3300047318 Ga0495636_0015671 Ga0495636_0015671_2244_2993 249
161 3300047319 Ga0495674_0006511 Ga0495674_0006511_6224_6973 249
162 3300047471 Ga0495684_0138581 Ga0495684_0138581_1049_1798 249
163 3300048904 Ga0496101_0086544 Ga0496101_0086544_1324_2073 249
164 3300048904 Ga0496101_0227174 Ga0496101_0227174_96_920 249
165 3300048907 Ga0496104_0061427 Ga0496104_0061427_1217_1966 249
166 3300048909 Ga0496106_0012863 Ga0496106_0012863_3533_4282 249
167 3300048909 Ga0496106_0179104 Ga0496106_0179104_478_1302 249
168 3300048912 Ga0496109_0011098 Ga0496109_0011098_5470_6219 249
169 3300048913 Ga0496110_0027348 Ga0496110_0027348_2499_3248 249
170 3300048914 Ga0496111_0001415 Ga0496111_0001415_983_1732 249
171 3300048915 Ga0496112_0031663 Ga0496112_0031663_2485_3234 249
172 3300048917 Ga0496114_0031673 Ga0496114_0031673_2757_3581 249
173 3300049743 Ga0501081_0312882 Ga0501081_0312882_229_993 249
174 3300050507 nmdc:mga05p37_99343_c1 nmdc:mga05p37_99343_c1_307_1062 249
175 3300050508 nmdc:mga09592_1960_c1 nmdc:mga09592_1960_c1_13167_13922 249
176 3300050510 nmdc:mga06r32_6157_c1 nmdc:mga06r32_6157_c1_709_1464 249
177 3300050512 nmdc:mga0n895_9435_c1 nmdc:mga0n895_9435_c1_938_1693 249
178 3300050514 nmdc:mga08x19_67948_c1 nmdc:mga08x19_67948_c1_1395_2150 249
179 3300050515 nmdc:mga0a205_37980_c2 nmdc:mga0a205_37980_c2_1599_2354 249
180 3300005293 Ga0065715_10172036 Ga0065715_101720362 250
181 3300005330 Ga0070690_100153621 Ga0070690_1001536212 250
182 3300005333 Ga0070677_10089284 Ga0070677_100892842 250
183 3300005334 Ga0068869_100107191 Ga0068869_1001071912 250
184 3300005336 Ga0070680_100012482 Ga0070680_1000124824 250
185 3300005336 Ga0070680_100740609 Ga0070680_1007406091 250
186 3300005341 Ga0070691_10080743 Ga0070691_100807432 250
187 3300005353 Ga0070669_100314702 Ga0070669_1003147022 250
188 3300005355 Ga0070671_100015791 Ga0070671_1000157914 250
189 3300005406 Ga0070703_10000400 Ga0070703_1000040011 250
190 3300005406 Ga0070703_10004333 Ga0070703_100043333 250
191 3300005406 Ga0070703_10023034 Ga0070703_100230343 250
192 3300005406 Ga0070703_10036825 Ga0070703_100368252 250
193 3300005434 Ga0070709_10017281 Ga0070709_100172814 250
194 3300005436 Ga0070713_100351713 Ga0070713_1003517132 250
195 3300005438 Ga0070701_10027625 Ga0070701_100276253 250
196 3300005439 Ga0070711_100000073 Ga0070711_1000000736 250
197 3300005440 Ga0070705_100031246 Ga0070705_1000312462 250
198 3300005440 Ga0070705_100046042 Ga0070705_1000460421 250
199 3300005440 Ga0070705_100078760 Ga0070705_1000787603 250
200 3300005440 Ga0070705_100141344 Ga0070705_1001413442 250
201 3300005440 Ga0070705_100513412 Ga0070705_1005134121 250
202 3300005441 Ga0070700_100298494 Ga0070700_1002984942 250
203 3300005444 Ga0070694_100002864 Ga0070694_1000028646 250
204 3300005444 Ga0070694_100004972 Ga0070694_1000049726 250
205 3300005444 Ga0070694_100030788 Ga0070694_1000307883 250
206 3300005444 Ga0070694_100243966 Ga0070694_1002439662 250
207 3300005444 Ga0070694_100602971 Ga0070694_1006029711 250
208 3300005445 Ga0070708_100002955 Ga0070708_10000295511 250
209 3300005445 Ga0070708_100003800 Ga0070708_10000380020 250
210 3300005445 Ga0070708_100012155 Ga0070708_1000121556 250
211 3300005445 Ga0070708_100022575 Ga0070708_1000225753 250
212 3300005445 Ga0070708_100030082 Ga0070708_1000300822 250
213 3300005445 Ga0070708_100075367 Ga0070708_1000753671 250
214 3300005445 Ga0070708_100121780 Ga0070708_1001217803 250
215 3300005445 Ga0070708_100143211 Ga0070708_1001432112 250
216 3300005445 Ga0070708_100213598 Ga0070708_1002135981 250
217 3300005445 Ga0070708_100793220 Ga0070708_1007932201 250
218 3300005459 Ga0068867_100077973 Ga0068867_1000779732 250
219 3300005467 Ga0070706_100013278 Ga0070706_1000132783 250
220 3300005467 Ga0070706_100027105 Ga0070706_1000271054 250
221 3300005467 Ga0070706_100058698 Ga0070706_1000586983 250
222 3300005467 Ga0070706_100064520 Ga0070706_1000645203 250
223 3300005467 Ga0070706_100103033 Ga0070706_1001030332 250
224 3300005467 Ga0070706_100198197 Ga0070706_1001981973 250
225 3300005467 Ga0070706_100269523 Ga0070706_1002695232 250
226 3300005467 Ga0070706_100492088 Ga0070706_1004920882 250
227 3300005468 Ga0070707_100004355 Ga0070707_1000043554 250
228 3300005468 Ga0070707_100019858 Ga0070707_1000198582 250
229 3300005468 Ga0070707_100022307 Ga0070707_1000223072 250
230 3300005468 Ga0070707_100102938 Ga0070707_1001029383 250
231 3300005468 Ga0070707_100130438 Ga0070707_1001304383 250
232 3300005468 Ga0070707_100151021 Ga0070707_1001510212 250
233 3300005468 Ga0070707_100165154 Ga0070707_1001651542 250
234 3300005471 Ga0070698_100001849 Ga0070698_10000184922 250
235 3300005471 Ga0070698_100005769 Ga0070698_1000057694 250
236 3300005471 Ga0070698_100059762 Ga0070698_1000597622 250
237 3300005471 Ga0070698_100143327 Ga0070698_1001433272 250
238 3300005518 Ga0070699_100003912 Ga0070699_1000039124 250
239 3300005518 Ga0070699_100007097 Ga0070699_1000070975 250
240 3300005518 Ga0070699_100014358 Ga0070699_1000143587 250
241 3300005518 Ga0070699_100033605 Ga0070699_1000336052 250
242 3300005518 Ga0070699_100036013 Ga0070699_1000360135 250
243 3300005518 Ga0070699_100047106 Ga0070699_1000471063 250
244 3300005518 Ga0070699_100050458 Ga0070699_1000504582 250
245 3300005518 Ga0070699_100055580 Ga0070699_1000555803 250
246 3300005518 Ga0070699_100068165 Ga0070699_1000681653 250
247 3300005518 Ga0070699_100198299 Ga0070699_1001982992 250
248 3300005518 Ga0070699_100209320 Ga0070699_1002093202 250
249 3300005530 Ga0070679_100574612 Ga0070679_1005746121 250
250 3300005536 Ga0070697_100002528 Ga0070697_10000252811 250
251 3300005536 Ga0070697_100011384 Ga0070697_1000113847 250
252 3300005536 Ga0070697_100013208 Ga0070697_1000132084 250
253 3300005536 Ga0070697_100027041 Ga0070697_1000270412 250
254 3300005536 Ga0070697_100103428 Ga0070697_1001034282 250
255 3300005536 Ga0070697_100166743 Ga0070697_1001667432 250
256 3300005536 Ga0070697_100337252 Ga0070697_1003372521 250
257 3300005543 Ga0070672_100023772 Ga0070672_1000237723 250
258 3300005543 Ga0070672_100063726 Ga0070672_1000637263 250
259 3300005545 Ga0070695_100000708 Ga0070695_10000070810 250
260 3300005545 Ga0070695_100002446 Ga0070695_1000024462 250
261 3300005545 Ga0070695_100002490 Ga0070695_10000249010 250
262 3300005545 Ga0070695_100040537 Ga0070695_1000405373 250
263 3300005545 Ga0070695_100043206 Ga0070695_1000432063 250
264 3300005545 Ga0070695_100074795 Ga0070695_1000747953 250
265 3300005545 Ga0070695_100091101 Ga0070695_1000911013 250
266 3300005546 Ga0070696_100001655 Ga0070696_10000165523 250
267 3300005546 Ga0070696_100007194 Ga0070696_1000071947 250
268 3300005546 Ga0070696_100007549 Ga0070696_10000754913 250
269 3300005546 Ga0070696_100018458 Ga0070696_1000184582 250
270 3300005546 Ga0070696_100063764 Ga0070696_1000637643 250
271 3300005546 Ga0070696_100137147 Ga0070696_1001371472 250
272 3300005546 Ga0070696_100190806 Ga0070696_1001908062 250
273 3300005546 Ga0070696_100229105 Ga0070696_1002291052 250
274 3300005549 Ga0070704_100006456 Ga0070704_1000064569 250
275 3300005549 Ga0070704_100007402 Ga0070704_1000074024 250
276 3300005549 Ga0070704_100011139 Ga0070704_1000111392 250
277 3300005549 Ga0070704_100026415 Ga0070704_1000264152 250
278 3300005549 Ga0070704_100031354 Ga0070704_1000313543 250
279 3300005549 Ga0070704_100043891 Ga0070704_1000438912 250
280 3300005549 Ga0070704_100100528 Ga0070704_1001005282 250
281 3300005549 Ga0070704_100162347 Ga0070704_1001623472 250
282 3300005549 Ga0070704_100162822 Ga0070704_1001628222 250
283 3300005615 Ga0070702_100100541 Ga0070702_1001005412 250
284 3300005617 Ga0068859_100132746 Ga0068859_1001327463 250
285 3300005719 Ga0068861_100135129 Ga0068861_1001351292 250
286 3300006173 Ga0070716_100049621 Ga0070716_1000496213 250
287 3300006844 Ga0075428_100024257 Ga0075428_1000242572 250
288 3300006844 Ga0075428_100074322 Ga0075428_1000743223 250
289 3300006847 Ga0075431_100113593 Ga0075431_1001135933 250
290 3300006847 Ga0075431_100121386 Ga0075431_1001213863 250
291 3300006852 Ga0075433_10019487 Ga0075433_100194873 250
292 3300006852 Ga0075433_10035328 Ga0075433_100353283 250
293 3300006852 Ga0075433_10267606 Ga0075433_102676062 250
294 3300006852 Ga0075433_10283632 Ga0075433_102836322 250
295 3300006852 Ga0075433_10421723 Ga0075433_104217231 250
296 3300006871 Ga0075434_100013195 Ga0075434_1000131959 250
297 3300006871 Ga0075434_100035536 Ga0075434_1000355361 250
298 3300006871 Ga0075434_100082939 Ga0075434_1000829392 250
299 3300006871 Ga0075434_100219146 Ga0075434_1002191463 250
300 3300006871 Ga0075434_100246424 Ga0075434_1002464243 250
301 3300006871 Ga0075434_100368938 Ga0075434_1003689382 250
302 3300006880 Ga0075429_100006438 Ga0075429_1000064388 250
303 3300006880 Ga0075429_100141586 Ga0075429_1001415863 250
304 3300006914 Ga0075436_100016067 Ga0075436_1000160676 250
305 3300006914 Ga0075436_100017112 Ga0075436_1000171124 250
306 3300006931 Ga0097620_100132752 Ga0097620_1001327523 250
307 3300007076 Ga0075435_100008387 Ga0075435_1000083877 250
308 3300007076 Ga0075435_100057282 Ga0075435_1000572822 250
309 3300007265 Ga0099794_10000157 Ga0099794_1000015725 250
310 3300007265 Ga0099794_10008565 Ga0099794_100085652 250
311 3300007265 Ga0099794_10015189 Ga0099794_100151892 250
312 3300009094 Ga0111539_10112436 Ga0111539_101124363 250
313 3300009094 Ga0111539_10313436 Ga0111539_103134362 250
314 3300009094 Ga0111539_10390150 Ga0111539_103901502 250
315 3300009094 Ga0111539_10729194 Ga0111539_107291941 250
316 3300009147 Ga0114129_10002536 Ga0114129_1000253624 250
317 3300009147 Ga0114129_10008126 Ga0114129_1000812611 250
318 3300009147 Ga0114129_10074564 Ga0114129_100745644 250
319 3300009147 Ga0114129_10095879 Ga0114129_100958794 250
320 3300009147 Ga0114129_10097744 Ga0114129_100977443 250
321 3300009147 Ga0114129_10108059 Ga0114129_101080593 250
322 3300009147 Ga0114129_10215057 Ga0114129_102150572 250
323 3300009147 Ga0114129_10715013 Ga0114129_107150132 250
324 3300009174 Ga0105241_10592482 Ga0105241_105924822 250
325 3300010375 Ga0105239_10029421 Ga0105239_100294212 250
326 3300011119 Ga0105246_10201409 Ga0105246_102014092 250
327 3300013308 Ga0157375_10045014 Ga0157375_100450143 250
328 3300014326 Ga0157380_10491628 Ga0157380_104916282 250
329 3300014969 Ga0157376_10094164 Ga0157376_100941642 250
330 3300025885 Ga0207653_10000147 Ga0207653_1000014725 250
331 3300025885 Ga0207653_10006845 Ga0207653_100068454 250
332 3300025885 Ga0207653_10022887 Ga0207653_100228873 250
333 3300025893 Ga0207682_10020954 Ga0207682_100209543 250
334 3300025906 Ga0207699_10004264 Ga0207699_100042647 250
335 3300025906 Ga0207699_10037630 Ga0207699_100376303 250
336 3300025910 Ga0207684_10092582 Ga0207684_100925823 250
337 3300025910 Ga0207684_10102901 Ga0207684_101029012 250
338 3300025910 Ga0207684_10143626 Ga0207684_101436262 250
339 3300025916 Ga0207663_10000058 Ga0207663_1000005851 250
340 3300025917 Ga0207660_10002654 Ga0207660_100026549 250
341 3300025918 Ga0207662_10039333 Ga0207662_100393334 250
342 3300025922 Ga0207646_10001572 Ga0207646_1000157219 250
343 3300025922 Ga0207646_10004802 Ga0207646_100048022 250
344 3300025922 Ga0207646_10005813 Ga0207646_100058134 250
345 3300025922 Ga0207646_10014960 Ga0207646_100149606 250
346 3300025922 Ga0207646_10031745 Ga0207646_100317456 250
347 3300025922 Ga0207646_10204155 Ga0207646_102041552 250
348 3300025922 Ga0207646_10396553 Ga0207646_103965532 250
349 3300025923 Ga0207681_10411773 Ga0207681_104117732 250
350 3300025925 Ga0207650_10265353 Ga0207650_102653532 250
351 3300025928 Ga0207700_10282204 Ga0207700_102822042 250
352 3300025939 Ga0207665_10008082 Ga0207665_1000808212 250
353 3300025939 Ga0207665_10069730 Ga0207665_100697302 250
354 3300025942 Ga0207689_10123583 Ga0207689_101235832 250
355 3300025960 Ga0207651_10153211 Ga0207651_101532112 250
356 3300026075 Ga0207708_10043509 Ga0207708_100435095 250
357 3300026089 Ga0207648_10148064 Ga0207648_101480642 250
358 3300026118 Ga0207675_100072751 Ga0207675_1000727513 250
359 3300027671 Ga0209588_1000118 Ga0209588_100011822 250
360 3300027671 Ga0209588_1002257 Ga0209588_10022578 250
361 3300031548 Ga0307408_100024162 Ga0307408_1000241622 250
362 3300031731 Ga0307405_10082860 Ga0307405_100828602 250
363 3300031824 Ga0307413_10008669 Ga0307413_100086696 250
364 3300031824 Ga0307413_10023385 Ga0307413_100233853 250
365 3300031824 Ga0307413_10035744 Ga0307413_100357443 250
366 3300031824 Ga0307413_10213219 Ga0307413_102132191 250
367 3300031852 Ga0307410_10002797 Ga0307410_100027978 250
368 3300031852 Ga0307410_10011250 Ga0307410_100112506 250
369 3300031852 Ga0307410_10017270 Ga0307410_100172704 250
370 3300031852 Ga0307410_10044948 Ga0307410_100449483 250
371 3300031852 Ga0307410_10071046 Ga0307410_100710462 250
372 3300031852 Ga0307410_10156219 Ga0307410_101562192 250
373 3300031901 Ga0307406_10121626 Ga0307406_101216262 250
374 3300031903 Ga0307407_10002696 Ga0307407_100026965 250
375 3300031903 Ga0307407_10054882 Ga0307407_100548821 250
376 3300031903 Ga0307407_10476287 Ga0307407_104762872 250
377 3300031911 Ga0307412_10253504 Ga0307412_102535042 250
378 3300031995 Ga0307409_100000501 Ga0307409_1000005016 250
379 3300031995 Ga0307409_100009842 Ga0307409_1000098425 250
380 3300031995 Ga0307409_100013494 Ga0307409_1000134946 250
381 3300031995 Ga0307409_100065582 Ga0307409_1000655823 250
382 3300031995 Ga0307409_100072311 Ga0307409_1000723114 250
383 3300031995 Ga0307409_100175416 Ga0307409_1001754162 250
384 3300031995 Ga0307409_100495024 Ga0307409_1004950241 250
385 3300031995 Ga0307409_100682052 Ga0307409_1006820521 250
386 3300032002 Ga0307416_100003220 Ga0307416_10000322012 250
387 3300032002 Ga0307416_100013407 Ga0307416_1000134076 250
388 3300032002 Ga0307416_100083848 Ga0307416_1000838483 250
389 3300032002 Ga0307416_100340168 Ga0307416_1003401682 250
390 3300032002 Ga0307416_100386225 Ga0307416_1003862252 250
391 3300032002 Ga0307416_100601895 Ga0307416_1006018952 250
392 3300032004 Ga0307414_10002427 Ga0307414_100024272 250
393 3300032004 Ga0307414_10023155 Ga0307414_100231554 250
394 3300032004 Ga0307414_10058397 Ga0307414_100583972 250
395 3300032004 Ga0307414_10171058 Ga0307414_101710583 250
396 3300032004 Ga0307414_10215425 Ga0307414_102154252 250
397 3300032004 Ga0307414_10222334 Ga0307414_102223342 250
398 3300032004 Ga0307414_10736328 Ga0307414_107363282 250
399 3300032005 Ga0307411_10000568 Ga0307411_100005685 250
400 3300032005 Ga0307411_10001075 Ga0307411_1000107520 250
401 3300032005 Ga0307411_10002193 Ga0307411_100021935 250
402 3300032005 Ga0307411_10037682 Ga0307411_100376823 250
403 3300032005 Ga0307411_10199814 Ga0307411_101998142 250
404 3300032005 Ga0307411_10211703 Ga0307411_102117032 250
405 3300032126 Ga0307415_100004330 Ga0307415_1000043302 250
406 3300032126 Ga0307415_100052304 Ga0307415_1000523043 250
407 3300032126 Ga0307415_100059867 Ga0307415_1000598673 250
408 3300032126 Ga0307415_100305980 Ga0307415_1003059801 250
409 3300035085 Ga0373929_0065014 Ga0373929_0065014_77_829 250
410 3300035114 Ga0373939_0059898 Ga0373939_0059898_260_1012 250
411 3300035691 Ga0373931_0011551 Ga0373931_0011551_3097_3849 250
412 3300037471 Ga0395905_0193004 Ga0395905_0193004_597_1349 250
413 3300037471 Ga0395905_0269065 Ga0395905_0269065_166_918 250
414 3300038996 Ga0242420_015095 Ga0242420_015095_414_1166 250
415 3300042156 Ga0439446_0036952 Ga0439446_0036952_102_854 250
416 3300042156 Ga0439446_0039794 Ga0439446_0039794_15_767 250
417 3300042876 Ga0451577_0219675 Ga0451577_0219675_230_982 250
418 3300042876 Ga0451577_0353228 Ga0451577_0353228_394_1221 250
419 3300044673 Ga0453683_0010893 Ga0453683_0010893_133_885 250
420 3300045051 Ga0451576_0015443 Ga0451576_0015443_5772_6524 250
421 3300045051 Ga0451576_0016252 Ga0451576_0016252_3299_4051 250
422 3300045051 Ga0451576_0156383 Ga0451576_0156383_471_1229 250
423 3300045051 Ga0451576_0296689 Ga0451576_0296689_47_808 250
424 3300046538 Ga0495609_0182178 Ga0495609_0182178_65_817 250
425 3300048904 Ga0496101_0066105 Ga0496101_0066105_1095_1847 250
426 3300048904 Ga0496101_0314979 Ga0496101_0314979_178_930 250
427 3300048905 Ga0496102_0002335 Ga0496102_0002335_8047_8799 250
428 3300048905 Ga0496102_0117502 Ga0496102_0117502_356_1108 250
429 3300048905 Ga0496102_0129252 Ga0496102_0129252_1046_1798 250
430 3300048905 Ga0496102_0434624 Ga0496102_0434624_185_937 250
431 3300048906 Ga0496103_0099184 Ga0496103_0099184_406_1158 250
432 3300048907 Ga0496104_0003370 Ga0496104_0003370_11390_12142 250
433 3300048907 Ga0496104_0017568 Ga0496104_0017568_678_1430 250
434 3300048909 Ga0496106_0006627 Ga0496106_0006627_7643_8395 250
435 3300048909 Ga0496106_0040184 Ga0496106_0040184_2665_3417 250
436 3300048909 Ga0496106_0251024 Ga0496106_0251024_228_980 250
437 3300048909 Ga0496106_0336107 Ga0496106_0336107_287_1039 250
438 3300048910 Ga0496107_0025969 Ga0496107_0025969_52_804 250
439 3300048910 Ga0496107_0192918 Ga0496107_0192918_581_1333 250
440 3300048911 Ga0496108_0013301 Ga0496108_0013301_5151_5903 250
441 3300048911 Ga0496108_0015304 Ga0496108_0015304_688_1440 250
442 3300048912 Ga0496109_0002383 Ga0496109_0002383_3430_4182 250
443 3300048912 Ga0496109_0041379 Ga0496109_0041379_2779_3531 250
444 3300048913 Ga0496110_0005386 Ga0496110_0005386_8152_8904 250
445 3300048913 Ga0496110_0038740 Ga0496110_0038740_2758_3510 250
446 3300048914 Ga0496111_0021474 Ga0496111_0021474_1749_2501 250
447 3300048915 Ga0496112_0005776 Ga0496112_0005776_6518_7270 250
448 3300048915 Ga0496112_0256053 Ga0496112_0256053_659_1411 250
449 3300048916 Ga0496113_0001258 Ga0496113_0001258_8619_9371 250
450 3300048917 Ga0496114_0432309 Ga0496114_0432309_299_1051 250
451 3300048917 Ga0496114_0611754 Ga0496114_0611754_116_868 250
452 3300048918 Ga0496115_0223163 Ga0496115_0223163_319_1071 250
453 3300049568 Ga0501031_0059743 Ga0501031_0059743_1284_2048 250
454 3300049568 Ga0501031_0299120 Ga0501031_0299120_38_790 250
455 3300049568 Ga0501031_0387596 Ga0501031_0387596_60_830 250
456 3300049569 Ga0501032_0168027 Ga0501032_0168027_545_1297 250
457 3300049570 Ga0501033_0101660 Ga0501033_0101660_1231_1995 250
458 3300049571 Ga0501034_0008138 Ga0501034_0008138_7889_8647 250
459 3300049572 Ga0501036_0276418 Ga0501036_0276418_154_906 250
460 3300049574 Ga0501038_0139438 Ga0501038_0139438_950_1714 250
461 3300049574 Ga0501038_0344309 Ga0501038_0344309_29_781 250
462 3300049576 Ga0501040_0038105 Ga0501040_0038105_2014_2766 250
463 3300049576 Ga0501040_0042871 Ga0501040_0042871_1365_2117 250
464 3300049576 Ga0501040_0133964 Ga0501040_0133964_888_1640 250
465 3300049577 Ga0501041_0005915 Ga0501041_0005915_6094_6858 250
466 3300049577 Ga0501041_0130025 Ga0501041_0130025_184_936 250
467 3300049577 Ga0501041_0411238 Ga0501041_0411238_16_768 250
468 3300049579 Ga0501043_0513502 Ga0501043_0513502_121_873 250
469 3300049580 Ga0501046_0031036 Ga0501046_0031036_1770_2534 250
470 3300049580 Ga0501046_0107152 Ga0501046_0107152_1282_2034 250
471 3300049580 Ga0501046_0149895 Ga0501046_0149895_63_815 250
472 3300049580 Ga0501046_0175840 Ga0501046_0175840_166_918 250
473 3300049582 Ga0501048_0044063 Ga0501048_0044063_1621_2385 250
474 3300049583 Ga0501067_0028450 Ga0501067_0028450_2140_2898 250
475 3300049583 Ga0501067_0076986 Ga0501067_0076986_542_1294 250
476 3300049584 Ga0501068_0000074 Ga0501068_0000074_35302_36057 250
477 3300049584 Ga0501068_0005867 Ga0501068_0005867_3997_4755 250
478 3300049585 Ga0501069_0002254 Ga0501069_0002254_878_1654 250
479 3300049585 Ga0501069_0004361 Ga0501069_0004361_6091_6849 250
480 3300049586 Ga0501070_0011246 Ga0501070_0011246_2948_3706 250
481 3300049586 Ga0501070_0086505 Ga0501070_0086505_644_1408 250
482 3300049587 Ga0501071_0012717 Ga0501071_0012717_3853_4611 250
483 3300049587 Ga0501071_0014765 Ga0501071_0014765_2756_3511 250
484 3300049587 Ga0501071_0039065 Ga0501071_0039065_1712_2464 250
485 3300049587 Ga0501071_0041914 Ga0501071_0041914_1176_1940 250
486 3300049588 Ga0501072_0001150 Ga0501072_0001150_16583_17341 250
487 3300049588 Ga0501072_0009461 Ga0501072_0009461_4416_5180 250
488 3300049588 Ga0501072_0045433 Ga0501072_0045433_1650_2402 250
489 3300049588 Ga0501072_0063513 Ga0501072_0063513_2039_2791 250
490 3300049589 Ga0501073_0088822 Ga0501073_0088822_1376_2131 250
491 3300049589 Ga0501073_0103945 Ga0501073_0103945_256_1014 250
492 3300049590 Ga0501074_0005104 Ga0501074_0005104_1507_2265 250
493 3300049590 Ga0501074_0013526 Ga0501074_0013526_3819_4595 250
494 3300049590 Ga0501074_0028966 Ga0501074_0028966_50_814 250
495 3300049590 Ga0501074_0087048 Ga0501074_0087048_485_1237 250
496 3300049590 Ga0501074_0358761 Ga0501074_0358761_209_961 250
497 3300049591 Ga0501075_0030791 Ga0501075_0030791_1075_1827 250
498 3300049591 Ga0501075_0053825 Ga0501075_0053825_1621_2385 250
499 3300049591 Ga0501075_0085367 Ga0501075_0085367_754_1506 250
500 3300049591 Ga0501075_0504197 Ga0501075_0504197_91_852 250
501 3300049592 Ga0501076_0006957 Ga0501076_0006957_1755_2507 250
502 3300049592 Ga0501076_0018259 Ga0501076_0018259_3566_4318 250
503 3300049592 Ga0501076_0093530 Ga0501076_0093530_589_1353 250
504 3300049592 Ga0501076_0278966 Ga0501076_0278966_49_810 250
505 3300049592 Ga0501076_0711143 Ga0501076_0711143_52_807 250
506 3300049593 Ga0501077_0004692 Ga0501077_0004692_173_925 250
507 3300049593 Ga0501077_0021490 Ga0501077_0021490_2536_3288 250
508 3300049593 Ga0501077_0277655 Ga0501077_0277655_113_865 250
509 3300049741 Ga0501079_0008496 Ga0501079_0008496_1653_2417 250
510 3300049741 Ga0501079_0095858 Ga0501079_0095858_212_964 250
511 3300049741 Ga0501079_0183121 Ga0501079_0183121_104_859 250
512 3300049741 Ga0501079_0184104 Ga0501079_0184104_193_945 250
513 3300049741 Ga0501079_0216668 Ga0501079_0216668_140_901 250
514 3300049742 Ga0501080_0053401 Ga0501080_0053401_2941_3705 250
515 3300049742 Ga0501080_0059282 Ga0501080_0059282_1837_2592 250
516 3300049743 Ga0501081_0018953 Ga0501081_0018953_1805_2557 250
517 3300049743 Ga0501081_0051957 Ga0501081_0051957_1233_1985 250
518 3300049743 Ga0501081_0131341 Ga0501081_0131341_19_780 250
519 3300049743 Ga0501081_0351571 Ga0501081_0351571_295_1053 250
520 3300049744 Ga0501083_0013805 Ga0501083_0013805_2216_2974 250
521 3300049744 Ga0501083_0098320 Ga0501083_0098320_571_1347 250
522 3300049744 Ga0501083_0336031 Ga0501083_0336031_98_862 250
523 3300049823 Ga0501044_0551044 Ga0501044_0551044_261_1037 250
524 3300049824 Ga0501045_0033270 Ga0501045_0033270_1621_2385 250
525 3300049824 Ga0501045_0053219 Ga0501045_0053219_1165_1917 250
526 3300049824 Ga0501045_0087153 Ga0501045_0087153_386_1138 250
527 3300049824 Ga0501045_0095019 Ga0501045_0095019_869_1621 250
528 3300050507 nmdc:mga05p37_164956_c1 nmdc:mga05p37_164956_c1_1887_2639 250
529 3300050507 nmdc:mga05p37_1880_c1 nmdc:mga05p37_1880_c1_18206_18967 250
530 3300050507 nmdc:mga05p37_28175_c1 nmdc:mga05p37_28175_c1_5998_6750 250
531 3300050507 nmdc:mga05p37_447704_c1 nmdc:mga05p37_447704_c1_286_1062 250
532 3300050507 nmdc:mga05p37_550137_c1 nmdc:mga05p37_550137_c1_122_874 250
533 3300050507 nmdc:mga05p37_733008_c1 nmdc:mga05p37_733008_c1_33_785 250
534 3300050507 nmdc:mga05p37_832844_c1 nmdc:mga05p37_832844_c1_10_762 250
535 3300050508 nmdc:mga09592_160873_c1 nmdc:mga09592_160873_c1_20_793 250
536 3300050508 nmdc:mga09592_5396_c1 nmdc:mga09592_5396_c1_9174_9929 250
537 3300050508 nmdc:mga09592_69229_c1 nmdc:mga09592_69229_c1_309_1061 250
538 3300050509 nmdc:mga0qj67_197117_c1 nmdc:mga0qj67_197117_c1_382_1137 250
539 3300050509 nmdc:mga0qj67_31067_c1 nmdc:mga0qj67_31067_c1_3210_3965 250
540 3300050510 nmdc:mga06r32_148498_c1 nmdc:mga06r32_148498_c1_358_1119 250
541 3300050511 nmdc:mga08y16_99058_c1 nmdc:mga08y16_99058_c1_1620_2375 250
542 3300050512 nmdc:mga0n895_1677_c1 nmdc:mga0n895_1677_c1_11412_12173 250
543 3300050512 nmdc:mga0n895_26066_c1 nmdc:mga0n895_26066_c1_1864_2616 250
544 3300050512 nmdc:mga0n895_31878_c1 nmdc:mga0n895_31878_c1_2540_3316 250
545 3300050512 nmdc:mga0n895_436728_c1 nmdc:mga0n895_436728_c1_368_1126 250
546 3300050512 nmdc:mga0n895_78649_c1 nmdc:mga0n895_78649_c1_2306_3067 250
547 3300050513 nmdc:mga0rr50_171814_c1 nmdc:mga0rr50_171814_c1_240_998 250
548 3300050513 nmdc:mga0rr50_18124_c1 nmdc:mga0rr50_18124_c1_1290_2051 250
549 3300050513 nmdc:mga0rr50_44095_c1 nmdc:mga0rr50_44095_c1_1843_2619 250
550 3300050514 nmdc:mga08x19_169658_c1 nmdc:mga08x19_169658_c1_549_1310 250
551 3300050514 nmdc:mga08x19_216214_c1 nmdc:mga08x19_216214_c1_337_1089 250
552 3300050514 nmdc:mga08x19_22629_c1 nmdc:mga08x19_22629_c1_770_1528 250
553 3300050514 nmdc:mga08x19_48739_c1 nmdc:mga08x19_48739_c1_1483_2244 250
554 3300050514 nmdc:mga08x19_74331_c1 nmdc:mga08x19_74331_c1_280_1056 250
555 3300050514 nmdc:mga08x19_9469_c1 nmdc:mga08x19_9469_c1_865_1626 250
556 3300050515 nmdc:mga0a205_105201_c1 nmdc:mga0a205_105201_c1_1917_2669 250
557 3300050515 nmdc:mga0a205_114875_c2 nmdc:mga0a205_114875_c2_81_833 250
558 3300050515 nmdc:mga0a205_169520_c1 nmdc:mga0a205_169520_c1_749_1501 250
559 3300050515 nmdc:mga0a205_20540_c1 nmdc:mga0a205_20540_c1_2754_3506 250
560 3300050515 nmdc:mga0a205_67853_c1 nmdc:mga0a205_67853_c1_1829_2581 250
561 3300054114 Ga0501084_0019923 Ga0501084_0019923_4651_5409 250
562 3300054114 Ga0501084_0062580 Ga0501084_0062580_1287_2039 250
563 3300054114 Ga0501084_0127328 Ga0501084_0127328_961_1725 250
564 3300054114 Ga0501084_0180391 Ga0501084_0180391_203_955 250
565 3300054114 Ga0501084_0186501 Ga0501084_0186501_957_1733 250
566 3300054114 Ga0501084_0392109 Ga0501084_0392109_18_779 250
567 3300059421 Ga0590071_001007 Ga0590071_001007_2521_3273 250
568 3300059421 Ga0590071_002282 Ga0590071_002282_3402_4154 250
569 3300059421 Ga0590071_004274 Ga0590071_004274_2541_3293 250
570 3300059424 Ga0590075_017982 Ga0590075_017982_485_1237 250
571 3300059426 Ga0590077_022214 Ga0590077_022214_364_1116 250
572 3300060353 Ga0501082_0018050 Ga0501082_0018050_2737_3495 250
573 3300060353 Ga0501082_0037358 Ga0501082_0037358_731_1483 250
574 3300060353 Ga0501082_0049443 Ga0501082_0049443_2726_3478 250
575 3300060353 Ga0501082_0051060 Ga0501082_0051060_974_1729 250
576 3300060353 Ga0501082_0052999 Ga0501082_0052999_454_1218 250
577 3300060353 Ga0501082_0161650 Ga0501082_0161650_629_1381 250
578 3300060353 Ga0501082_0219164 Ga0501082_0219164_444_1196 250
579 3300061734 Ga0530510_0109229 Ga0530510_0109229_804_1556 250
580 3300061734 Ga0530510_0342836 Ga0530510_0342836_54_806 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

140

0.9

PF00557

Peptidase_M24

Metallopeptidase family M24

136

220

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tb5-assembly3.cif.gz_C crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.974 3 249
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9572 1 250
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9564 1 248
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9534 1 250
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9522 1 248
ID Description Score Start End Superfamily
3tb5C00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.974 3 249 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9737 13 126 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9572 1 250 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9567 1 248 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9534 1 250 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7Y4VXI4-F1-model_v4 M24 family metallopeptidase 0.9926 1 147 GO:0005829
GO:0070006
AF-A0A7Y4VXI4-F1-model_v4 M24 family metallopeptidase 0.986 1 147 GO:0005829
GO:0070006
AF-A0A7C4H0N2-F1-model_v4 M24 family metallopeptidase 0.9785 1 160 GO:0005829
GO:0070006
AF-A0A5E4CC99-F1-model_v4 Peptidase M24 domain-containing protein 0.9774 1 159 GO:0070006
AF-A0A7X6VPR9-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9767 1 135 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
91.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map