F466008
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 580 | 235 | 580 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0013137|Ga0501069_0013137_3629_4378 |
| Length | 228 |
| Sequence | MITRKSARELDIMARAGSIVAGTLALMREIVRPGMTTEDLDDAAEAFIRSHPGATPSFKGLYGFPKTLCVSIDDEIVHGIPSRKRVLREGSIVSVDCGVHLEGFHADSATTIPVGTVGAEAERLMAVTQEALAAGIAAGFGVVRELVGHGIGTRFHEEPQVPNHGQPHRGAQLKPGMTIAIEPMITAGSYETRTLPDKWTVVTVDGSLSAHFEHTVAITLEGPRVLTM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 134 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 143 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 144 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 188 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 189 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 232 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.28 |
| Rhizosphere | 91.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10172036 | 3300005293 | Bacteria | 1536 |
| 2 | Ga0070690_100153621 | 3300005330 | Bacteria | 1572 |
| 3 | Ga0070690_100173623 | 3300005330 | Bacteria | 1485 |
| 4 | Ga0070677_10018546 | 3300005333 | Bacteria | 2507 |
| 5 | Ga0070677_10089284 | 3300005333 | Bacteria | 1337 |
| 6 | Ga0068869_100031575 | 3300005334 | Bacteria | 3726 |
| 7 | Ga0068869_100107191 | 3300005334 | Bacteria | 2121 |
| 8 | Ga0070666_10088375 | 3300005335 | Bacteria | 2126 |
| 9 | Ga0070680_100012482 | 3300005336 | Bacteria | 6603 |
| 10 | Ga0070680_100022439 | 3300005336 | Bacteria | 5028 |
| 11 | Ga0070680_100740609 | 3300005336 | Bacteria | 846 |
| 12 | Ga0070691_10028357 | 3300005341 | Bacteria | 2615 |
| 13 | Ga0070691_10080743 | 3300005341 | Bacteria | 1592 |
| 14 | Ga0070669_100031531 | 3300005353 | Bacteria | 3828 |
| 15 | Ga0070669_100314702 | 3300005353 | Bacteria | 1263 |
| 16 | Ga0070675_100057312 | 3300005354 | Bacteria | 3211 |
| 17 | Ga0070675_100118286 | 3300005354 | Bacteria | 2250 |
| 18 | Ga0070671_100015791 | 3300005355 | Bacteria | 6101 |
| 19 | Ga0070671_100101892 | 3300005355 | Bacteria | 2409 |
| 20 | Ga0070674_100000221 | 3300005356 | Bacteria | 27736 |
| 21 | Ga0070659_100168209 | 3300005366 | Bacteria | 1794 |
| 22 | Ga0070667_100017617 | 3300005367 | Bacteria | 5917 |
| 23 | Ga0070703_10000400 | 3300005406 | Bacteria | 18096 |
| 24 | Ga0070703_10004333 | 3300005406 | Bacteria | 4000 |
| 25 | Ga0070703_10023034 | 3300005406 | Bacteria | 1832 |
| 26 | Ga0070703_10036825 | 3300005406 | Bacteria | 1505 |
| 27 | Ga0070709_10017281 | 3300005434 | Bacteria | 4135 |
| 28 | Ga0070713_100351713 | 3300005436 | Bacteria | 1367 |
| 29 | Ga0070701_10000503 | 3300005438 | Bacteria | 13404 |
| 30 | Ga0070701_10027625 | 3300005438 | Bacteria | 2782 |
| 31 | Ga0070711_100000073 | 3300005439 | Bacteria | 58495 |
| 32 | Ga0070705_100009725 | 3300005440 | Bacteria | 4790 |
| 33 | Ga0070705_100024075 | 3300005440 | Bacteria | 3281 |
| 34 | Ga0070705_100031246 | 3300005440 | Bacteria | 2947 |
| 35 | Ga0070705_100046042 | 3300005440 | Bacteria | 2513 |
| 36 | Ga0070705_100078760 | 3300005440 | Bacteria | 2017 |
| 37 | Ga0070705_100141344 | 3300005440 | Bacteria | 1584 |
| 38 | Ga0070705_100513412 | 3300005440 | Bacteria | 912 |
| 39 | Ga0070700_100298494 | 3300005441 | Bacteria | 1175 |
| 40 | Ga0070694_100002864 | 3300005444 | Bacteria | 10248 |
| 41 | Ga0070694_100004972 | 3300005444 | Bacteria | 8011 |
| 42 | Ga0070694_100030788 | 3300005444 | Bacteria | 3513 |
| 43 | Ga0070694_100081661 | 3300005444 | Bacteria | 2249 |
| 44 | Ga0070694_100103285 | 3300005444 | Bacteria | 2019 |
| 45 | Ga0070694_100243966 | 3300005444 | Bacteria | 1356 |
| 46 | Ga0070694_100602971 | 3300005444 | Bacteria | 884 |
| 47 | Ga0070708_100002955 | 3300005445 | Bacteria | 13216 |
| 48 | Ga0070708_100003800 | 3300005445 | Bacteria | 11845 |
| 49 | Ga0070708_100012155 | 3300005445 | Bacteria | 7018 |
| 50 | Ga0070708_100022575 | 3300005445 | Bacteria | 5338 |
| 51 | Ga0070708_100030082 | 3300005445 | Bacteria | 4690 |
| 52 | Ga0070708_100073679 | 3300005445 | Bacteria | 3078 |
| 53 | Ga0070708_100075367 | 3300005445 | Bacteria | 3045 |
| 54 | Ga0070708_100121780 | 3300005445 | Bacteria | 2407 |
| 55 | Ga0070708_100143211 | 3300005445 | Bacteria | 2218 |
| 56 | Ga0070708_100213598 | 3300005445 | Bacteria | 1808 |
| 57 | Ga0070708_100793220 | 3300005445 | Bacteria | 890 |
| 58 | Ga0070678_100002764 | 3300005456 | Bacteria | 9697 |
| 59 | Ga0070662_100000495 | 3300005457 | Bacteria | 23489 |
| 60 | Ga0068867_100005437 | 3300005459 | Bacteria | 9015 |
| 61 | Ga0068867_100077973 | 3300005459 | Bacteria | 2491 |
| 62 | Ga0070706_100013278 | 3300005467 | Bacteria | 7618 |
| 63 | Ga0070706_100027105 | 3300005467 | Bacteria | 5272 |
| 64 | Ga0070706_100058698 | 3300005467 | Bacteria | 3551 |
| 65 | Ga0070706_100064520 | 3300005467 | Bacteria | 3385 |
| 66 | Ga0070706_100103033 | 3300005467 | Bacteria | 2653 |
| 67 | Ga0070706_100198197 | 3300005467 | Bacteria | 1876 |
| 68 | Ga0070706_100269523 | 3300005467 | Bacteria | 1589 |
| 69 | Ga0070706_100492088 | 3300005467 | Bacteria | 1141 |
| 70 | Ga0070707_100004355 | 3300005468 | Bacteria | 13269 |
| 71 | Ga0070707_100019858 | 3300005468 | Bacteria | 6334 |
| 72 | Ga0070707_100022307 | 3300005468 | Bacteria | 5984 |
| 73 | Ga0070707_100102938 | 3300005468 | Bacteria | 2767 |
| 74 | Ga0070707_100130438 | 3300005468 | Bacteria | 2444 |
| 75 | Ga0070707_100151021 | 3300005468 | Unclassified | 2262 |
| 76 | Ga0070707_100165154 | 3300005468 | Bacteria | 2157 |
| 77 | Ga0070698_100001849 | 3300005471 | Bacteria | 23572 |
| 78 | Ga0070698_100005769 | 3300005471 | Bacteria | 13540 |
| 79 | Ga0070698_100059762 | 3300005471 | Bacteria | 3849 |
| 80 | Ga0070698_100143327 | 3300005471 | Bacteria | 2339 |
| 81 | Ga0070699_100003912 | 3300005518 | Bacteria | 13158 |
| 82 | Ga0070699_100007097 | 3300005518 | Bacteria | 9730 |
| 83 | Ga0070699_100014358 | 3300005518 | Bacteria | 6808 |
| 84 | Ga0070699_100033605 | 3300005518 | Bacteria | 4431 |
| 85 | Ga0070699_100036013 | 3300005518 | Bacteria | 4279 |
| 86 | Ga0070699_100047106 | 3300005518 | Bacteria | 3730 |
| 87 | Ga0070699_100050458 | 3300005518 | Bacteria | 3602 |
| 88 | Ga0070699_100055580 | 3300005518 | Bacteria | 3427 |
| 89 | Ga0070699_100068165 | 3300005518 | Bacteria | 3089 |
| 90 | Ga0070699_100185919 | 3300005518 | Bacteria | 1845 |
| 91 | Ga0070699_100198299 | 3300005518 | Bacteria | 1784 |
| 92 | Ga0070699_100209320 | 3300005518 | Bacteria | 1735 |
| 93 | Ga0070679_100574612 | 3300005530 | Bacteria | 1071 |
| 94 | Ga0070697_100002528 | 3300005536 | Bacteria | 14082 |
| 95 | Ga0070697_100011384 | 3300005536 | Bacteria | 6952 |
| 96 | Ga0070697_100013208 | 3300005536 | Bacteria | 6474 |
| 97 | Ga0070697_100027041 | 3300005536 | Bacteria | 4587 |
| 98 | Ga0070697_100103428 | 3300005536 | Bacteria | 2367 |
| 99 | Ga0070697_100166743 | 3300005536 | Bacteria | 1863 |
| 100 | Ga0070697_100243663 | 3300005536 | Bacteria | 1535 |
| 101 | Ga0070697_100337252 | 3300005536 | Bacteria | 1300 |
| 102 | Ga0070672_100023772 | 3300005543 | Bacteria | 4521 |
| 103 | Ga0070672_100063726 | 3300005543 | Bacteria | 2911 |
| 104 | Ga0070672_100111119 | 3300005543 | Bacteria | 2234 |
| 105 | Ga0070686_100053929 | 3300005544 | Bacteria | 2570 |
| 106 | Ga0070695_100000708 | 3300005545 | Bacteria | 17797 |
| 107 | Ga0070695_100002446 | 3300005545 | Bacteria | 10679 |
| 108 | Ga0070695_100002490 | 3300005545 | Bacteria | 10601 |
| 109 | Ga0070695_100011920 | 3300005545 | Bacteria | 5204 |
| 110 | Ga0070695_100040537 | 3300005545 | Bacteria | 2948 |
| 111 | Ga0070695_100043206 | 3300005545 | Bacteria | 2865 |
| 112 | Ga0070695_100074795 | 3300005545 | Bacteria | 2226 |
| 113 | Ga0070695_100091101 | 3300005545 | Bacteria | 2036 |
| 114 | Ga0070695_100145384 | 3300005545 | Bacteria | 1649 |
| 115 | Ga0070696_100001655 | 3300005546 | Bacteria | 14605 |
| 116 | Ga0070696_100007194 | 3300005546 | Bacteria | 7433 |
| 117 | Ga0070696_100007549 | 3300005546 | Bacteria | 7275 |
| 118 | Ga0070696_100018458 | 3300005546 | Bacteria | 4714 |
| 119 | Ga0070696_100063764 | 3300005546 | Bacteria | 2582 |
| 120 | Ga0070696_100137147 | 3300005546 | Bacteria | 1784 |
| 121 | Ga0070696_100190806 | 3300005546 | Bacteria | 1525 |
| 122 | Ga0070696_100229105 | 3300005546 | Bacteria | 1397 |
| 123 | Ga0070693_100060056 | 3300005547 | Bacteria | 2206 |
| 124 | Ga0070704_100006456 | 3300005549 | Bacteria | 6911 |
| 125 | Ga0070704_100007402 | 3300005549 | Bacteria | 6534 |
| 126 | Ga0070704_100011139 | 3300005549 | Bacteria | 5498 |
| 127 | Ga0070704_100026415 | 3300005549 | Bacteria | 3836 |
| 128 | Ga0070704_100031354 | 3300005549 | Bacteria | 3574 |
| 129 | Ga0070704_100043891 | 3300005549 | Bacteria | 3102 |
| 130 | Ga0070704_100100528 | 3300005549 | Bacteria | 2177 |
| 131 | Ga0070704_100162347 | 3300005549 | Bacteria | 1768 |
| 132 | Ga0070704_100162822 | 3300005549 | Bacteria | 1766 |
| 133 | Ga0070704_100200113 | 3300005549 | Bacteria | 1612 |
| 134 | Ga0070664_100107382 | 3300005564 | Bacteria | 2433 |
| 135 | Ga0068857_100006227 | 3300005577 | Bacteria | 10201 |
| 136 | Ga0068854_100000444 | 3300005578 | Bacteria | 25595 |
| 137 | Ga0070702_100100541 | 3300005615 | Bacteria | 1773 |
| 138 | Ga0068859_100132746 | 3300005617 | Bacteria | 2562 |
| 139 | Ga0068864_100005272 | 3300005618 | Bacteria | 10592 |
| 140 | Ga0068864_100045691 | 3300005618 | Bacteria | 3757 |
| 141 | Ga0068866_10000625 | 3300005718 | Bacteria | 16073 |
| 142 | Ga0068861_100018407 | 3300005719 | Bacteria | 4977 |
| 143 | Ga0068861_100135129 | 3300005719 | Bacteria | 2006 |
| 144 | Ga0068861_100582865 | 3300005719 | Bacteria | 1024 |
| 145 | Ga0068870_10010421 | 3300005840 | Bacteria | 4271 |
| 146 | Ga0068863_100116437 | 3300005841 | Bacteria | 2547 |
| 147 | Ga0068863_100495095 | 3300005841 | Bacteria | 1203 |
| 148 | Ga0068858_100056283 | 3300005842 | Bacteria | 3635 |
| 149 | Ga0068860_100041878 | 3300005843 | Bacteria | 4375 |
| 150 | Ga0068862_100043478 | 3300005844 | Bacteria | 3830 |
| 151 | Ga0070716_100049621 | 3300006173 | Bacteria | 2379 |
| 152 | Ga0097621_100171709 | 3300006237 | Bacteria | 1869 |
| 153 | Ga0068871_100057216 | 3300006358 | Bacteria | 3172 |
| 154 | Ga0075428_100024257 | 3300006844 | Bacteria | 6709 |
| 155 | Ga0075428_100074322 | 3300006844 | Bacteria | 3712 |
| 156 | Ga0075431_100004690 | 3300006847 | Bacteria | 13429 |
| 157 | Ga0075431_100113593 | 3300006847 | Bacteria | 2796 |
| 158 | Ga0075431_100121386 | 3300006847 | Unclassified | 2696 |
| 159 | Ga0075433_10019487 | 3300006852 | Bacteria | 5654 |
| 160 | Ga0075433_10035328 | 3300006852 | Bacteria | 4297 |
| 161 | Ga0075433_10139413 | 3300006852 | Bacteria | 2156 |
| 162 | Ga0075433_10267606 | 3300006852 | Bacteria | 1515 |
| 163 | Ga0075433_10283632 | 3300006852 | Bacteria | 1467 |
| 164 | Ga0075433_10421723 | 3300006852 | Bacteria | 1177 |
| 165 | Ga0075434_100001309 | 3300006871 | Bacteria | 20777 |
| 166 | Ga0075434_100013195 | 3300006871 | Bacteria | 7851 |
| 167 | Ga0075434_100035536 | 3300006871 | Bacteria | 4926 |
| 168 | Ga0075434_100082939 | 3300006871 | Bacteria | 3203 |
| 169 | Ga0075434_100219146 | 3300006871 | Bacteria | 1922 |
| 170 | Ga0075434_100246424 | 3300006871 | Bacteria | 1806 |
| 171 | Ga0075434_100368938 | 3300006871 | Bacteria | 1456 |
| 172 | Ga0075429_100006438 | 3300006880 | Bacteria | 10170 |
| 173 | Ga0075429_100014606 | 3300006880 | Bacteria | 6806 |
| 174 | Ga0075429_100141586 | 3300006880 | Bacteria | 2105 |
| 175 | Ga0075436_100016067 | 3300006914 | Bacteria | 5125 |
| 176 | Ga0075436_100017112 | 3300006914 | Bacteria | 4962 |
| 177 | Ga0075436_100076859 | 3300006914 | Bacteria | 2312 |
| 178 | Ga0097620_100132752 | 3300006931 | Bacteria | 2562 |
| 179 | Ga0075435_100008387 | 3300007076 | Bacteria | 7411 |
| 180 | Ga0075435_100057282 | 3300007076 | Bacteria | 3152 |
| 181 | Ga0075435_100210642 | 3300007076 | Bacteria | 1649 |
| 182 | Ga0099794_10000157 | 3300007265 | Bacteria | 25131 |
| 183 | Ga0099794_10008565 | 3300007265 | Bacteria | 4257 |
| 184 | Ga0099794_10015189 | 3300007265 | Bacteria | 3393 |
| 185 | Ga0111539_10112436 | 3300009094 | Bacteria | 3195 |
| 186 | Ga0111539_10313436 | 3300009094 | Bacteria | 1826 |
| 187 | Ga0111539_10390150 | 3300009094 | Bacteria | 1621 |
| 188 | Ga0111539_10729194 | 3300009094 | Bacteria | 1154 |
| 189 | Ga0114129_10002536 | 3300009147 | Bacteria | 25352 |
| 190 | Ga0114129_10008126 | 3300009147 | Bacteria | 14956 |
| 191 | Ga0114129_10074564 | 3300009147 | Bacteria | 4727 |
| 192 | Ga0114129_10095879 | 3300009147 | Bacteria | 4108 |
| 193 | Ga0114129_10097744 | 3300009147 | Bacteria | 4064 |
| 194 | Ga0114129_10108059 | 3300009147 | Bacteria | 3841 |
| 195 | Ga0114129_10215057 | 3300009147 | Bacteria | 2596 |
| 196 | Ga0114129_10284320 | 3300009147 | Bacteria | 2209 |
| 197 | Ga0114129_10715013 | 3300009147 | Bacteria | 1286 |
| 198 | Ga0105243_10090432 | 3300009148 | Bacteria | 2519 |
| 199 | Ga0105241_10002264 | 3300009174 | Bacteria | 14463 |
| 200 | Ga0105241_10592482 | 3300009174 | Bacteria | 1000 |
| 201 | Ga0105242_10000898 | 3300009176 | Bacteria | 23106 |
| 202 | Ga0105248_10000553 | 3300009177 | Bacteria | 42444 |
| 203 | Ga0105239_10029421 | 3300010375 | Bacteria | 6039 |
| 204 | Ga0105239_10062386 | 3300010375 | Bacteria | 4091 |
| 205 | Ga0105246_10111427 | 3300011119 | Bacteria | 2011 |
| 206 | Ga0105246_10201409 | 3300011119 | Bacteria | 1548 |
| 207 | Ga0157378_10007725 | 3300013297 | Bacteria | 9386 |
| 208 | Ga0163162_10050140 | 3300013306 | Bacteria | 4186 |
| 209 | Ga0157375_10045014 | 3300013308 | Bacteria | 4293 |
| 210 | Ga0163163_10056096 | 3300014325 | Bacteria | 3894 |
| 211 | Ga0163163_10120904 | 3300014325 | Bacteria | 2653 |
| 212 | Ga0163163_10835971 | 3300014325 | Bacteria | 984 |
| 213 | Ga0157380_10038531 | 3300014326 | Bacteria | 3712 |
| 214 | Ga0157380_10491628 | 3300014326 | Bacteria | 1189 |
| 215 | Ga0157376_10094164 | 3300014969 | Bacteria | 2602 |
| 216 | Ga0163161_10016863 | 3300017792 | Bacteria | 5106 |
| 217 | Ga0207653_10000147 | 3300025885 | Bacteria | 49999 |
| 218 | Ga0207653_10006845 | 3300025885 | Bacteria | 3559 |
| 219 | Ga0207653_10022887 | 3300025885 | Bacteria | 1988 |
| 220 | Ga0207682_10020954 | 3300025893 | Bacteria | 2570 |
| 221 | Ga0207682_10062885 | 3300025893 | Bacteria | 1557 |
| 222 | Ga0207642_10091372 | 3300025899 | Bacteria | 1504 |
| 223 | Ga0207680_10187639 | 3300025903 | Bacteria | 1402 |
| 224 | Ga0207699_10004264 | 3300025906 | Bacteria | 6837 |
| 225 | Ga0207699_10037630 | 3300025906 | Bacteria | 2768 |
| 226 | Ga0207643_10035975 | 3300025908 | Bacteria | 2777 |
| 227 | Ga0207684_10092582 | 3300025910 | Bacteria | 2576 |
| 228 | Ga0207684_10102901 | 3300025910 | Bacteria | 2442 |
| 229 | Ga0207684_10143626 | 3300025910 | Bacteria | 2053 |
| 230 | Ga0207654_10277035 | 3300025911 | Bacteria | 1133 |
| 231 | Ga0207663_10000058 | 3300025916 | Bacteria | 58536 |
| 232 | Ga0207660_10002654 | 3300025917 | Bacteria | 11729 |
| 233 | Ga0207662_10039333 | 3300025918 | Bacteria | 2774 |
| 234 | Ga0207646_10001572 | 3300025922 | Bacteria | 27945 |
| 235 | Ga0207646_10004802 | 3300025922 | Bacteria | 14506 |
| 236 | Ga0207646_10005813 | 3300025922 | Bacteria | 12913 |
| 237 | Ga0207646_10014960 | 3300025922 | Bacteria | 7347 |
| 238 | Ga0207646_10031745 | 3300025922 | Bacteria | 4781 |
| 239 | Ga0207646_10204155 | 3300025922 | Bacteria | 1785 |
| 240 | Ga0207646_10396553 | 3300025922 | Bacteria | 1246 |
| 241 | Ga0207681_10411773 | 3300025923 | Bacteria | 1094 |
| 242 | Ga0207650_10265353 | 3300025925 | Bacteria | 1394 |
| 243 | Ga0207687_10523742 | 3300025927 | Bacteria | 992 |
| 244 | Ga0207700_10282204 | 3300025928 | Bacteria | 1429 |
| 245 | Ga0207644_10213042 | 3300025931 | Bacteria | 1528 |
| 246 | Ga0207690_10426900 | 3300025932 | Bacteria | 1061 |
| 247 | Ga0207706_10000025 | 3300025933 | Bacteria | 150958 |
| 248 | Ga0207686_10001115 | 3300025934 | Bacteria | 15582 |
| 249 | Ga0207709_10004187 | 3300025935 | Bacteria | 8374 |
| 250 | Ga0207669_10000638 | 3300025937 | Bacteria | 15128 |
| 251 | Ga0207704_10002325 | 3300025938 | Bacteria | 8541 |
| 252 | Ga0207665_10008082 | 3300025939 | Bacteria | 6943 |
| 253 | Ga0207665_10069730 | 3300025939 | Bacteria | 2398 |
| 254 | Ga0207691_10132311 | 3300025940 | Bacteria | 2202 |
| 255 | Ga0207711_10007282 | 3300025941 | Bacteria | 9270 |
| 256 | Ga0207689_10002028 | 3300025942 | Bacteria | 19145 |
| 257 | Ga0207689_10123583 | 3300025942 | Bacteria | 2129 |
| 258 | Ga0207651_10153211 | 3300025960 | Bacteria | 1797 |
| 259 | Ga0207712_10001387 | 3300025961 | Bacteria | 16586 |
| 260 | Ga0207712_10047043 | 3300025961 | Bacteria | 2993 |
| 261 | Ga0207640_10001530 | 3300025981 | Bacteria | 12469 |
| 262 | Ga0207658_10044377 | 3300025986 | Bacteria | 3237 |
| 263 | Ga0207703_10018133 | 3300026035 | Bacteria | 5497 |
| 264 | Ga0207678_10287056 | 3300026067 | Bacteria | 1413 |
| 265 | Ga0207708_10011972 | 3300026075 | Bacteria | 6462 |
| 266 | Ga0207708_10043509 | 3300026075 | Bacteria | 3422 |
| 267 | Ga0207641_10660137 | 3300026088 | Bacteria | 1028 |
| 268 | Ga0207641_10757059 | 3300026088 | Unclassified | 959 |
| 269 | Ga0207648_10000138 | 3300026089 | Bacteria | 72558 |
| 270 | Ga0207648_10148064 | 3300026089 | Bacteria | 2071 |
| 271 | Ga0207676_10061708 | 3300026095 | Bacteria | 2969 |
| 272 | Ga0207676_10132837 | 3300026095 | Bacteria | 2119 |
| 273 | Ga0207674_10057059 | 3300026116 | Bacteria | 3960 |
| 274 | Ga0207675_100007008 | 3300026118 | Bacteria | 10659 |
| 275 | Ga0207675_100072751 | 3300026118 | Bacteria | 3216 |
| 276 | Ga0207683_10006886 | 3300026121 | Bacteria | 9733 |
| 277 | Ga0209588_1000118 | 3300027671 | Bacteria | 23354 |
| 278 | Ga0209588_1002257 | 3300027671 | Bacteria | 5212 |
| 279 | Ga0268264_10461980 | 3300028381 | Bacteria | 1232 |
| 280 | Ga0307408_100024162 | 3300031548 | Bacteria | 4147 |
| 281 | Ga0316575_10007541 | 3300031665 | Bacteria | 3940 |
| 282 | Ga0307405_10082860 | 3300031731 | Bacteria | 2101 |
| 283 | Ga0307413_10008669 | 3300031824 | Bacteria | 4818 |
| 284 | Ga0307413_10023385 | 3300031824 | Bacteria | 3349 |
| 285 | Ga0307413_10035744 | 3300031824 | Bacteria | 2853 |
| 286 | Ga0307413_10213219 | 3300031824 | Bacteria | 1404 |
| 287 | Ga0307410_10002797 | 3300031852 | Bacteria | 8549 |
| 288 | Ga0307410_10011250 | 3300031852 | Bacteria | 5108 |
| 289 | Ga0307410_10017270 | 3300031852 | Bacteria | 4328 |
| 290 | Ga0307410_10044948 | 3300031852 | Bacteria | 2937 |
| 291 | Ga0307410_10071046 | 3300031852 | Bacteria | 2413 |
| 292 | Ga0307410_10156219 | 3300031852 | Bacteria | 1704 |
| 293 | Ga0307406_10121626 | 3300031901 | Bacteria | 1816 |
| 294 | Ga0307406_10258292 | 3300031901 | Bacteria | 1316 |
| 295 | Ga0307407_10002696 | 3300031903 | Bacteria | 7041 |
| 296 | Ga0307407_10054882 | 3300031903 | Bacteria | 2300 |
| 297 | Ga0307407_10476287 | 3300031903 | Bacteria | 911 |
| 298 | Ga0307412_10253504 | 3300031911 | Bacteria | 1368 |
| 299 | Ga0307409_100000501 | 3300031995 | Bacteria | 16895 |
| 300 | Ga0307409_100009842 | 3300031995 | Bacteria | 5898 |
| 301 | Ga0307409_100013494 | 3300031995 | Bacteria | 5262 |
| 302 | Ga0307409_100065582 | 3300031995 | Bacteria | 2858 |
| 303 | Ga0307409_100072311 | 3300031995 | Bacteria | 2746 |
| 304 | Ga0307409_100175416 | 3300031995 | Bacteria | 1891 |
| 305 | Ga0307409_100495024 | 3300031995 | Bacteria | 1189 |
| 306 | Ga0307409_100682052 | 3300031995 | Bacteria | 1025 |
| 307 | Ga0307416_100003220 | 3300032002 | Bacteria | 9563 |
| 308 | Ga0307416_100013407 | 3300032002 | Bacteria | 5570 |
| 309 | Ga0307416_100083848 | 3300032002 | Bacteria | 2706 |
| 310 | Ga0307416_100340168 | 3300032002 | Bacteria | 1513 |
| 311 | Ga0307416_100386225 | 3300032002 | Bacteria | 1432 |
| 312 | Ga0307416_100601895 | 3300032002 | Bacteria | 1179 |
| 313 | Ga0307414_10002427 | 3300032004 | Bacteria | 9745 |
| 314 | Ga0307414_10023155 | 3300032004 | Bacteria | 3934 |
| 315 | Ga0307414_10058397 | 3300032004 | Bacteria | 2718 |
| 316 | Ga0307414_10171058 | 3300032004 | Bacteria | 1737 |
| 317 | Ga0307414_10215425 | 3300032004 | Bacteria | 1573 |
| 318 | Ga0307414_10222334 | 3300032004 | Bacteria | 1551 |
| 319 | Ga0307414_10736328 | 3300032004 | Bacteria | 895 |
| 320 | Ga0307411_10000568 | 3300032005 | Bacteria | 13149 |
| 321 | Ga0307411_10001075 | 3300032005 | Bacteria | 10594 |
| 322 | Ga0307411_10002193 | 3300032005 | Bacteria | 8487 |
| 323 | Ga0307411_10037682 | 3300032005 | Bacteria | 3043 |
| 324 | Ga0307411_10199814 | 3300032005 | Bacteria | 1534 |
| 325 | Ga0307411_10211703 | 3300032005 | Bacteria | 1497 |
| 326 | Ga0307415_100004330 | 3300032126 | Bacteria | 7351 |
| 327 | Ga0307415_100052304 | 3300032126 | Bacteria | 2777 |
| 328 | Ga0307415_100059867 | 3300032126 | Bacteria | 2629 |
| 329 | Ga0307415_100305980 | 3300032126 | Bacteria | 1319 |
| 330 | Ga0373929_0065014 | 3300035085 | Bacteria | 862 |
| 331 | Ga0373932_0036424 | 3300035112 | Bacteria | 1397 |
| 332 | Ga0373939_0059898 | 3300035114 | Bacteria | 1209 |
| 333 | Ga0316574_0046692 | 3300035398 | Bacteria | 2686 |
| 334 | Ga0373931_0011551 | 3300035691 | Bacteria | 4266 |
| 335 | Ga0373931_0099991 | 3300035691 | Bacteria | 1630 |
| 336 | Ga0373931_0120866 | 3300035691 | Bacteria | 1497 |
| 337 | Ga0373927_0480747 | 3300035695 | Bacteria | 821 |
| 338 | Ga0373937_0266127 | 3300036401 | Bacteria | 1617 |
| 339 | Ga0316584_0042400 | 3300036712 | Bacteria | 3394 |
| 340 | Ga0395905_0193004 | 3300037471 | Bacteria | 1910 |
| 341 | Ga0395905_0269065 | 3300037471 | Bacteria | 1590 |
| 342 | Ga0316581_0010755 | 3300037588 | Bacteria | 2544 |
| 343 | Ga0242420_015095 | 3300038996 | Bacteria | 1333 |
| 344 | Ga0439446_0036952 | 3300042156 | Bacteria | 1429 |
| 345 | Ga0439446_0039794 | 3300042156 | Bacteria | 1382 |
| 346 | Ga0451577_0027119 | 3300042876 | Bacteria | 5185 |
| 347 | Ga0451577_0219675 | 3300042876 | Bacteria | 1718 |
| 348 | Ga0451577_0353228 | 3300042876 | Bacteria | 1334 |
| 349 | Ga0451577_0555488 | 3300042876 | Bacteria | 1042 |
| 350 | Ga0453683_0010893 | 3300044673 | Bacteria | 6012 |
| 351 | Ga0453684_1318957 | 3300044712 | Bacteria | 752 |
| 352 | Ga0451576_0015443 | 3300045051 | Bacteria | 8457 |
| 353 | Ga0451576_0016252 | 3300045051 | Bacteria | 8219 |
| 354 | Ga0451576_0064582 | 3300045051 | Bacteria | 3812 |
| 355 | Ga0451576_0156383 | 3300045051 | Bacteria | 2378 |
| 356 | Ga0451576_0187739 | 3300045051 | Bacteria | 2158 |
| 357 | Ga0451576_0296689 | 3300045051 | Bacteria | 1690 |
| 358 | Ga0451576_0481455 | 3300045051 | Bacteria | 1303 |
| 359 | Ga0466967_1029168 | 3300045976 | Bacteria | 820 |
| 360 | Ga0495603_0057154 | 3300046455 | Bacteria | 2309 |
| 361 | Ga0495580_0335669 | 3300046472 | Bacteria | 1026 |
| 362 | Ga0495582_0026518 | 3300046473 | Bacteria | 3176 |
| 363 | Ga0495639_0024118 | 3300046475 | Bacteria | 2676 |
| 364 | Ga0495662_0012116 | 3300046476 | Bacteria | 4214 |
| 365 | Ga0495664_0004041 | 3300046477 | Bacteria | 8003 |
| 366 | Ga0495594_0179991 | 3300046499 | Bacteria | 1203 |
| 367 | Ga0495618_0017017 | 3300046514 | Bacteria | 4455 |
| 368 | Ga0495630_0003672 | 3300046517 | Bacteria | 10702 |
| 369 | Ga0495666_0009308 | 3300046526 | Bacteria | 4912 |
| 370 | Ga0495665_0099100 | 3300046531 | Bacteria | 1530 |
| 371 | Ga0495640_0008996 | 3300046533 | Bacteria | 7798 |
| 372 | Ga0495586_0018411 | 3300046535 | Bacteria | 3718 |
| 373 | Ga0495609_0182178 | 3300046538 | Bacteria | 884 |
| 374 | Ga0495621_0112915 | 3300046539 | Bacteria | 1043 |
| 375 | Ga0495622_0038429 | 3300046557 | Bacteria | 2229 |
| 376 | Ga0495634_0001123 | 3300046642 | Bacteria | 24774 |
| 377 | Ga0495611_0096488 | 3300046648 | Bacteria | 1369 |
| 378 | Ga0495635_0441738 | 3300046663 | Bacteria | 861 |
| 379 | Ga0495647_0164216 | 3300046681 | Bacteria | 958 |
| 380 | Ga0495658_0003647 | 3300046683 | Bacteria | 7620 |
| 381 | Ga0495613_0214588 | 3300046689 | Bacteria | 1352 |
| 382 | Ga0495670_0307056 | 3300046691 | Bacteria | 851 |
| 383 | Ga0495636_0015671 | 3300047318 | Bacteria | 3022 |
| 384 | Ga0495674_0006511 | 3300047319 | Bacteria | 11206 |
| 385 | Ga0495680_0438824 | 3300047322 | Bacteria | 895 |
| 386 | Ga0495684_0138581 | 3300047471 | Bacteria | 1825 |
| 387 | Ga0496101_0066105 | 3300048904 | Bacteria | 2637 |
| 388 | Ga0496101_0086544 | 3300048904 | Bacteria | 2324 |
| 389 | Ga0496101_0227174 | 3300048904 | Bacteria | 1450 |
| 390 | Ga0496101_0314979 | 3300048904 | Bacteria | 1227 |
| 391 | Ga0496102_0002335 | 3300048905 | Bacteria | 16187 |
| 392 | Ga0496102_0117502 | 3300048905 | Bacteria | 2482 |
| 393 | Ga0496102_0129252 | 3300048905 | Bacteria | 2363 |
| 394 | Ga0496102_0434624 | 3300048905 | Bacteria | 1232 |
| 395 | Ga0496103_0040224 | 3300048906 | Bacteria | 2873 |
| 396 | Ga0496103_0099184 | 3300048906 | Bacteria | 1843 |
| 397 | Ga0496104_0003370 | 3300048907 | Bacteria | 13806 |
| 398 | Ga0496104_0004916 | 3300048907 | Bacteria | 11658 |
| 399 | Ga0496104_0017568 | 3300048907 | Bacteria | 6518 |
| 400 | Ga0496104_0061427 | 3300048907 | Bacteria | 3563 |
| 401 | Ga0496105_0133899 | 3300048908 | Bacteria | 2042 |
| 402 | Ga0496106_0006627 | 3300048909 | Bacteria | 8573 |
| 403 | Ga0496106_0012863 | 3300048909 | Bacteria | 6177 |
| 404 | Ga0496106_0040184 | 3300048909 | Bacteria | 3503 |
| 405 | Ga0496106_0179104 | 3300048909 | Bacteria | 1682 |
| 406 | Ga0496106_0215436 | 3300048909 | Bacteria | 1530 |
| 407 | Ga0496106_0251024 | 3300048909 | Bacteria | 1414 |
| 408 | Ga0496106_0276937 | 3300048909 | Bacteria | 1344 |
| 409 | Ga0496106_0336107 | 3300048909 | Bacteria | 1213 |
| 410 | Ga0496107_0025969 | 3300048910 | Bacteria | 4151 |
| 411 | Ga0496107_0192918 | 3300048910 | Bacteria | 1514 |
| 412 | Ga0496108_0013301 | 3300048911 | Bacteria | 6709 |
| 413 | Ga0496108_0015304 | 3300048911 | Bacteria | 6258 |
| 414 | Ga0496109_0000716 | 3300048912 | Bacteria | 27631 |
| 415 | Ga0496109_0002383 | 3300048912 | Bacteria | 15709 |
| 416 | Ga0496109_0011098 | 3300048912 | Bacteria | 7725 |
| 417 | Ga0496109_0041379 | 3300048912 | Bacteria | 4174 |
| 418 | Ga0496110_0005386 | 3300048913 | Bacteria | 10029 |
| 419 | Ga0496110_0027348 | 3300048913 | Bacteria | 4889 |
| 420 | Ga0496110_0038740 | 3300048913 | Bacteria | 4149 |
| 421 | Ga0496110_0039608 | 3300048913 | Bacteria | 4104 |
| 422 | Ga0496111_0001415 | 3300048914 | Bacteria | 13651 |
| 423 | Ga0496111_0021474 | 3300048914 | Bacteria | 4509 |
| 424 | Ga0496111_0086701 | 3300048914 | Bacteria | 2291 |
| 425 | Ga0496112_0005776 | 3300048915 | Bacteria | 10762 |
| 426 | Ga0496112_0031663 | 3300048915 | Bacteria | 5131 |
| 427 | Ga0496112_0118411 | 3300048915 | Bacteria | 2618 |
| 428 | Ga0496112_0256053 | 3300048915 | Bacteria | 1701 |
| 429 | Ga0496113_0001258 | 3300048916 | Bacteria | 13982 |
| 430 | Ga0496113_0017483 | 3300048916 | Bacteria | 4978 |
| 431 | Ga0496114_0031673 | 3300048917 | Bacteria | 4350 |
| 432 | Ga0496114_0432309 | 3300048917 | Bacteria | 1166 |
| 433 | Ga0496114_0611754 | 3300048917 | Bacteria | 960 |
| 434 | Ga0496115_0223163 | 3300048918 | Bacteria | 1555 |
| 435 | Ga0501031_0059743 | 3300049568 | Bacteria | 2484 |
| 436 | Ga0501031_0299120 | 3300049568 | Bacteria | 1043 |
| 437 | Ga0501031_0387596 | 3300049568 | Bacteria | 904 |
| 438 | Ga0501032_0168027 | 3300049569 | Bacteria | 1439 |
| 439 | Ga0501033_0101660 | 3300049570 | Bacteria | 2097 |
| 440 | Ga0501034_0008138 | 3300049571 | Bacteria | 11119 |
| 441 | Ga0501036_0276418 | 3300049572 | Bacteria | 1406 |
| 442 | Ga0501038_0139438 | 3300049574 | Bacteria | 1985 |
| 443 | Ga0501038_0344309 | 3300049574 | Bacteria | 1162 |
| 444 | Ga0501040_0038105 | 3300049576 | Bacteria | 3268 |
| 445 | Ga0501040_0042871 | 3300049576 | Bacteria | 3083 |
| 446 | Ga0501040_0133964 | 3300049576 | Bacteria | 1743 |
| 447 | Ga0501041_0005915 | 3300049577 | Bacteria | 7152 |
| 448 | Ga0501041_0130025 | 3300049577 | Bacteria | 1568 |
| 449 | Ga0501041_0411238 | 3300049577 | Bacteria | 857 |
| 450 | Ga0501043_0513502 | 3300049579 | Bacteria | 894 |
| 451 | Ga0501046_0031036 | 3300049580 | Bacteria | 4335 |
| 452 | Ga0501046_0107152 | 3300049580 | Bacteria | 2138 |
| 453 | Ga0501046_0149895 | 3300049580 | Bacteria | 1760 |
| 454 | Ga0501046_0175840 | 3300049580 | Bacteria | 1604 |
| 455 | Ga0501048_0044063 | 3300049582 | Bacteria | 3192 |
| 456 | Ga0501067_0028450 | 3300049583 | Bacteria | 3096 |
| 457 | Ga0501067_0076986 | 3300049583 | Bacteria | 1848 |
| 458 | Ga0501067_0172676 | 3300049583 | Bacteria | 1204 |
| 459 | Ga0501068_0000074 | 3300049584 | Bacteria | 39863 |
| 460 | Ga0501068_0005867 | 3300049584 | Bacteria | 6740 |
| 461 | Ga0501069_0002254 | 3300049585 | Bacteria | 9728 |
| 462 | Ga0501069_0004361 | 3300049585 | Bacteria | 7302 |
| 463 | Ga0501069_0013137 | 3300049585 | Bacteria | 4414 |
| 464 | Ga0501070_0011246 | 3300049586 | Bacteria | 7558 |
| 465 | Ga0501070_0086505 | 3300049586 | Bacteria | 2595 |
| 466 | Ga0501070_0359505 | 3300049586 | Bacteria | 1181 |
| 467 | Ga0501071_0012717 | 3300049587 | Bacteria | 5721 |
| 468 | Ga0501071_0014765 | 3300049587 | Bacteria | 5346 |
| 469 | Ga0501071_0039065 | 3300049587 | Bacteria | 3394 |
| 470 | Ga0501071_0041914 | 3300049587 | Bacteria | 3278 |
| 471 | Ga0501071_0368070 | 3300049587 | Bacteria | 1095 |
| 472 | Ga0501072_0001150 | 3300049588 | Bacteria | 19668 |
| 473 | Ga0501072_0009461 | 3300049588 | Bacteria | 7411 |
| 474 | Ga0501072_0045433 | 3300049588 | Bacteria | 3454 |
| 475 | Ga0501072_0063513 | 3300049588 | Bacteria | 2913 |
| 476 | Ga0501073_0088822 | 3300049589 | Bacteria | 2148 |
| 477 | Ga0501073_0103945 | 3300049589 | Bacteria | 1971 |
| 478 | Ga0501074_0005104 | 3300049590 | Bacteria | 9431 |
| 479 | Ga0501074_0013526 | 3300049590 | Bacteria | 5931 |
| 480 | Ga0501074_0028966 | 3300049590 | Bacteria | 4012 |
| 481 | Ga0501074_0087048 | 3300049590 | Bacteria | 2238 |
| 482 | Ga0501074_0358761 | 3300049590 | Bacteria | 1034 |
| 483 | Ga0501075_0030791 | 3300049591 | Bacteria | 3977 |
| 484 | Ga0501075_0053825 | 3300049591 | Bacteria | 3026 |
| 485 | Ga0501075_0085367 | 3300049591 | Bacteria | 2392 |
| 486 | Ga0501075_0504197 | 3300049591 | Bacteria | 923 |
| 487 | Ga0501076_0006957 | 3300049592 | Bacteria | 8222 |
| 488 | Ga0501076_0018259 | 3300049592 | Bacteria | 5344 |
| 489 | Ga0501076_0093530 | 3300049592 | Bacteria | 2419 |
| 490 | Ga0501076_0278966 | 3300049592 | Bacteria | 1369 |
| 491 | Ga0501076_0711143 | 3300049592 | Bacteria | 829 |
| 492 | Ga0501077_0004692 | 3300049593 | Bacteria | 8308 |
| 493 | Ga0501077_0021490 | 3300049593 | Bacteria | 4083 |
| 494 | Ga0501077_0277655 | 3300049593 | Bacteria | 1066 |
| 495 | Ga0501225_0086682 | 3300049705 | Bacteria | 904 |
| 496 | Ga0501079_0008496 | 3300049741 | Bacteria | 7787 |
| 497 | Ga0501079_0095858 | 3300049741 | Bacteria | 2299 |
| 498 | Ga0501079_0183121 | 3300049741 | Bacteria | 1635 |
| 499 | Ga0501079_0184104 | 3300049741 | Bacteria | 1630 |
| 500 | Ga0501079_0216668 | 3300049741 | Bacteria | 1495 |
| 501 | Ga0501080_0017337 | 3300049742 | Bacteria | 6658 |
| 502 | Ga0501080_0053401 | 3300049742 | Bacteria | 3762 |
| 503 | Ga0501080_0059282 | 3300049742 | Bacteria | 3562 |
| 504 | Ga0501081_0018953 | 3300049743 | Bacteria | 4575 |
| 505 | Ga0501081_0051957 | 3300049743 | Bacteria | 2827 |
| 506 | Ga0501081_0131341 | 3300049743 | Bacteria | 1789 |
| 507 | Ga0501081_0312882 | 3300049743 | Bacteria | 1153 |
| 508 | Ga0501081_0351571 | 3300049743 | Bacteria | 1086 |
| 509 | Ga0501083_0013805 | 3300049744 | Bacteria | 5648 |
| 510 | Ga0501083_0098320 | 3300049744 | Bacteria | 1930 |
| 511 | Ga0501083_0336031 | 3300049744 | Bacteria | 982 |
| 512 | Ga0501083_0361268 | 3300049744 | Bacteria | 944 |
| 513 | Ga0501044_0441680 | 3300049823 | Bacteria | 1209 |
| 514 | Ga0501044_0551044 | 3300049823 | Bacteria | 1050 |
| 515 | Ga0501045_0033270 | 3300049824 | Bacteria | 3738 |
| 516 | Ga0501045_0053219 | 3300049824 | Bacteria | 2958 |
| 517 | Ga0501045_0087153 | 3300049824 | Bacteria | 2305 |
| 518 | Ga0501045_0095019 | 3300049824 | Bacteria | 2205 |
| 519 | nmdc:mga05p37_164956_c1 | 3300050507 | Bacteria | 2704 |
| 520 | nmdc:mga05p37_1880_c1 | 3300050507 | Bacteria | 24467 |
| 521 | nmdc:mga05p37_28175_c1 | 3300050507 | Bacteria | 6848 |
| 522 | nmdc:mga05p37_447704_c1 | 3300050507 | Bacteria | 1496 |
| 523 | nmdc:mga05p37_550137_c1 | 3300050507 | Bacteria | 1314 |
| 524 | nmdc:mga05p37_733008_c1 | 3300050507 | Bacteria | 1092 |
| 525 | nmdc:mga05p37_832844_c1 | 3300050507 | Unclassified | 1004 |
| 526 | nmdc:mga05p37_99343_c1 | 3300050507 | Bacteria | 3585 |
| 527 | nmdc:mga09592_160873_c1 | 3300050508 | Bacteria | 1939 |
| 528 | nmdc:mga09592_1960_c1 | 3300050508 | Bacteria | 16589 |
| 529 | nmdc:mga09592_5396_c1 | 3300050508 | Bacteria | 10399 |
| 530 | nmdc:mga09592_69229_c1 | 3300050508 | Bacteria | 2993 |
| 531 | nmdc:mga0qj67_197117_c1 | 3300050509 | Bacteria | 1636 |
| 532 | nmdc:mga0qj67_31067_c1 | 3300050509 | Bacteria | 4159 |
| 533 | nmdc:mga06r32_148498_c1 | 3300050510 | Bacteria | 2322 |
| 534 | nmdc:mga06r32_6157_c1 | 3300050510 | Bacteria | 10771 |
| 535 | nmdc:mga08y16_99058_c1 | 3300050511 | Bacteria | 3035 |
| 536 | nmdc:mga0n895_1677_c1 | 3300050512 | Bacteria | 16725 |
| 537 | nmdc:mga0n895_26066_c1 | 3300050512 | Bacteria | 5530 |
| 538 | nmdc:mga0n895_31878_c1 | 3300050512 | Bacteria | 5053 |
| 539 | nmdc:mga0n895_436728_c1 | 3300050512 | Bacteria | 1323 |
| 540 | nmdc:mga0n895_57617_c1 | 3300050512 | Bacteria | 3830 |
| 541 | nmdc:mga0n895_78649_c1 | 3300050512 | Bacteria | 3283 |
| 542 | nmdc:mga0n895_9435_c1 | 3300050512 | Bacteria | 6055 |
| 543 | nmdc:mga0rr50_171814_c1 | 3300050513 | Bacteria | 1767 |
| 544 | nmdc:mga0rr50_18124_c1 | 3300050513 | Bacteria | 4721 |
| 545 | nmdc:mga0rr50_44095_c1 | 3300050513 | Bacteria | 3269 |
| 546 | nmdc:mga08x19_169658_c1 | 3300050514 | Bacteria | 1486 |
| 547 | nmdc:mga08x19_216214_c1 | 3300050514 | Bacteria | 1316 |
| 548 | nmdc:mga08x19_22629_c1 | 3300050514 | Bacteria | 3892 |
| 549 | nmdc:mga08x19_22843_c1 | 3300050514 | Bacteria | 3877 |
| 550 | nmdc:mga08x19_48739_c1 | 3300050514 | Bacteria | 2715 |
| 551 | nmdc:mga08x19_67948_c1 | 3300050514 | Bacteria | 2319 |
| 552 | nmdc:mga08x19_74331_c1 | 3300050514 | Bacteria | 2220 |
| 553 | nmdc:mga08x19_9469_c1 | 3300050514 | Bacteria | 2154 |
| 554 | nmdc:mga0a205_105201_c1 | 3300050515 | Bacteria | 2721 |
| 555 | nmdc:mga0a205_114875_c2 | 3300050515 | Bacteria | 887 |
| 556 | nmdc:mga0a205_169520_c1 | 3300050515 | Bacteria | 2079 |
| 557 | nmdc:mga0a205_20540_c1 | 3300050515 | Bacteria | 6233 |
| 558 | nmdc:mga0a205_37980_c2 | 3300050515 | Bacteria | 2677 |
| 559 | nmdc:mga0a205_67853_c1 | 3300050515 | Bacteria | 2792 |
| 560 | Ga0501084_0019923 | 3300054114 | Bacteria | 5591 |
| 561 | Ga0501084_0062580 | 3300054114 | Bacteria | 3115 |
| 562 | Ga0501084_0127328 | 3300054114 | Bacteria | 2143 |
| 563 | Ga0501084_0180391 | 3300054114 | Bacteria | 1782 |
| 564 | Ga0501084_0186501 | 3300054114 | Bacteria | 1750 |
| 565 | Ga0501084_0392109 | 3300054114 | Bacteria | 1173 |
| 566 | Ga0590071_001007 | 3300059421 | Bacteria | 7690 |
| 567 | Ga0590071_002282 | 3300059421 | Bacteria | 4852 |
| 568 | Ga0590071_004274 | 3300059421 | Bacteria | 3474 |
| 569 | Ga0590075_017982 | 3300059424 | Bacteria | 1746 |
| 570 | Ga0590077_022214 | 3300059426 | Bacteria | 1353 |
| 571 | Ga0501082_0018050 | 3300060353 | Bacteria | 6076 |
| 572 | Ga0501082_0037358 | 3300060353 | Bacteria | 4186 |
| 573 | Ga0501082_0049443 | 3300060353 | Bacteria | 3626 |
| 574 | Ga0501082_0051060 | 3300060353 | Bacteria | 3564 |
| 575 | Ga0501082_0052999 | 3300060353 | Bacteria | 3497 |
| 576 | Ga0501082_0161650 | 3300060353 | Bacteria | 1946 |
| 577 | Ga0501082_0219164 | 3300060353 | Bacteria | 1656 |
| 578 | Ga0501082_0445516 | 3300060353 | Bacteria | 1131 |
| 579 | Ga0530510_0109229 | 3300061734 | Bacteria | 2025 |
| 580 | Ga0530510_0342836 | 3300061734 | Bacteria | 1122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0172676 | Ga0501067_0172676_13_660 | 194 |
| 2 | 3300050514 | nmdc:mga08x19_22843_c1 | nmdc:mga08x19_22843_c1_18_680 | 220 |
| 3 | 3300044712 | Ga0453684_1318957 | Ga0453684_1318957_56_727 | 223 |
| 4 | 3300050512 | nmdc:mga0n895_57617_c1 | nmdc:mga0n895_57617_c1_3140_3817 | 223 |
| 5 | 3300035695 | Ga0373927_0480747 | Ga0373927_0480747_134_808 | 224 |
| 6 | 3300049744 | Ga0501083_0361268 | Ga0501083_0361268_26_700 | 224 |
| 7 | 3300049823 | Ga0501044_0441680 | Ga0501044_0441680_10_687 | 224 |
| 8 | 3300014325 | Ga0163163_10056096 | Ga0163163_100560963 | 225 |
| 9 | 3300005618 | Ga0068864_100045691 | Ga0068864_1000456913 | 227 |
| 10 | 3300005841 | Ga0068863_100116437 | Ga0068863_1001164373 | 227 |
| 11 | 3300026095 | Ga0207676_10132837 | Ga0207676_101328371 | 227 |
| 12 | 3300049585 | Ga0501069_0013137 | Ga0501069_0013137_3629_4378 | 228 |
| 13 | 3300049586 | Ga0501070_0359505 | Ga0501070_0359505_270_1019 | 228 |
| 14 | 3300026088 | Ga0207641_10757059 | Ga0207641_107570591 | 230 |
| 15 | 3300045051 | Ga0451576_0187739 | Ga0451576_0187739_677_1438 | 232 |
| 16 | 3300042876 | Ga0451577_0555488 | Ga0451577_0555488_300_1019 | 237 |
| 17 | 3300046681 | Ga0495647_0164216 | Ga0495647_0164216_235_948 | 237 |
| 18 | 3300047322 | Ga0495680_0438824 | Ga0495680_0438824_126_839 | 237 |
| 19 | 3300005336 | Ga0070680_100022439 | Ga0070680_1000224392 | 238 |
| 20 | 3300005366 | Ga0070659_100168209 | Ga0070659_1001682092 | 238 |
| 21 | 3300005438 | Ga0070701_10000503 | Ga0070701_1000050320 | 238 |
| 22 | 3300005440 | Ga0070705_100024075 | Ga0070705_1000240754 | 238 |
| 23 | 3300005444 | Ga0070694_100081661 | Ga0070694_1000816613 | 238 |
| 24 | 3300005544 | Ga0070686_100053929 | Ga0070686_1000539293 | 238 |
| 25 | 3300005564 | Ga0070664_100107382 | Ga0070664_1001073823 | 238 |
| 26 | 3300005719 | Ga0068861_100582865 | Ga0068861_1005828652 | 238 |
| 27 | 3300006852 | Ga0075433_10139413 | Ga0075433_101394133 | 238 |
| 28 | 3300025932 | Ga0207690_10426900 | Ga0207690_104269002 | 238 |
| 29 | 3300031901 | Ga0307406_10258292 | Ga0307406_102582922 | 238 |
| 30 | 3300045976 | Ga0466967_1029168 | Ga0466967_1029168_87_806 | 238 |
| 31 | 3300046539 | Ga0495621_0112915 | Ga0495621_0112915_304_1026 | 238 |
| 32 | 3300048906 | Ga0496103_0040224 | Ga0496103_0040224_11_727 | 238 |
| 33 | 3300048909 | Ga0496106_0276937 | Ga0496106_0276937_20_736 | 238 |
| 34 | 3300049587 | Ga0501071_0368070 | Ga0501071_0368070_117_854 | 238 |
| 35 | 3300049705 | Ga0501225_0086682 | Ga0501225_0086682_163_879 | 238 |
| 36 | 3300060353 | Ga0501082_0445516 | Ga0501082_0445516_345_1082 | 238 |
| 37 | 3300014325 | Ga0163163_10835971 | Ga0163163_108359711 | 239 |
| 38 | 3300035112 | Ga0373932_0036424 | Ga0373932_0036424_369_1121 | 239 |
| 39 | 3300035691 | Ga0373931_0120866 | Ga0373931_0120866_164_916 | 239 |
| 40 | 3300048907 | Ga0496104_0004916 | Ga0496104_0004916_10256_11008 | 239 |
| 41 | 3300048908 | Ga0496105_0133899 | Ga0496105_0133899_637_1389 | 239 |
| 42 | 3300048909 | Ga0496106_0215436 | Ga0496106_0215436_198_950 | 239 |
| 43 | 3300048912 | Ga0496109_0000716 | Ga0496109_0000716_653_1405 | 239 |
| 44 | 3300048913 | Ga0496110_0039608 | Ga0496110_0039608_605_1357 | 239 |
| 45 | 3300048914 | Ga0496111_0086701 | Ga0496111_0086701_497_1249 | 239 |
| 46 | 3300048915 | Ga0496112_0118411 | Ga0496112_0118411_680_1432 | 239 |
| 47 | 3300048916 | Ga0496113_0017483 | Ga0496113_0017483_3525_4277 | 239 |
| 48 | 3300035691 | Ga0373931_0099991 | Ga0373931_0099991_628_1365 | 245 |
| 49 | 3300005444 | Ga0070694_100103285 | Ga0070694_1001032853 | 248 |
| 50 | 3300005518 | Ga0070699_100185919 | Ga0070699_1001859192 | 248 |
| 51 | 3300005545 | Ga0070695_100145384 | Ga0070695_1001453842 | 248 |
| 52 | 3300049742 | Ga0501080_0017337 | Ga0501080_0017337_5646_6392 | 248 |
| 53 | 3300005330 | Ga0070690_100173623 | Ga0070690_1001736232 | 249 |
| 54 | 3300005333 | Ga0070677_10018546 | Ga0070677_100185462 | 249 |
| 55 | 3300005334 | Ga0068869_100031575 | Ga0068869_1000315753 | 249 |
| 56 | 3300005335 | Ga0070666_10088375 | Ga0070666_100883752 | 249 |
| 57 | 3300005341 | Ga0070691_10028357 | Ga0070691_100283573 | 249 |
| 58 | 3300005353 | Ga0070669_100031531 | Ga0070669_1000315314 | 249 |
| 59 | 3300005354 | Ga0070675_100057312 | Ga0070675_1000573124 | 249 |
| 60 | 3300005354 | Ga0070675_100118286 | Ga0070675_1001182863 | 249 |
| 61 | 3300005355 | Ga0070671_100101892 | Ga0070671_1001018921 | 249 |
| 62 | 3300005356 | Ga0070674_100000221 | Ga0070674_10000022113 | 249 |
| 63 | 3300005367 | Ga0070667_100017617 | Ga0070667_1000176173 | 249 |
| 64 | 3300005440 | Ga0070705_100009725 | Ga0070705_1000097253 | 249 |
| 65 | 3300005445 | Ga0070708_100073679 | Ga0070708_1000736792 | 249 |
| 66 | 3300005456 | Ga0070678_100002764 | Ga0070678_1000027643 | 249 |
| 67 | 3300005457 | Ga0070662_100000495 | Ga0070662_10000049514 | 249 |
| 68 | 3300005459 | Ga0068867_100005437 | Ga0068867_10000543713 | 249 |
| 69 | 3300005536 | Ga0070697_100243663 | Ga0070697_1002436632 | 249 |
| 70 | 3300005543 | Ga0070672_100111119 | Ga0070672_1001111192 | 249 |
| 71 | 3300005545 | Ga0070695_100011920 | Ga0070695_1000119205 | 249 |
| 72 | 3300005547 | Ga0070693_100060056 | Ga0070693_1000600564 | 249 |
| 73 | 3300005549 | Ga0070704_100200113 | Ga0070704_1002001132 | 249 |
| 74 | 3300005577 | Ga0068857_100006227 | Ga0068857_10000622716 | 249 |
| 75 | 3300005578 | Ga0068854_100000444 | Ga0068854_10000044425 | 249 |
| 76 | 3300005618 | Ga0068864_100005272 | Ga0068864_10000527217 | 249 |
| 77 | 3300005718 | Ga0068866_10000625 | Ga0068866_100006252 | 249 |
| 78 | 3300005719 | Ga0068861_100018407 | Ga0068861_1000184075 | 249 |
| 79 | 3300005840 | Ga0068870_10010421 | Ga0068870_100104214 | 249 |
| 80 | 3300005841 | Ga0068863_100495095 | Ga0068863_1004950952 | 249 |
| 81 | 3300005842 | Ga0068858_100056283 | Ga0068858_1000562833 | 249 |
| 82 | 3300005843 | Ga0068860_100041878 | Ga0068860_1000418783 | 249 |
| 83 | 3300005844 | Ga0068862_100043478 | Ga0068862_1000434784 | 249 |
| 84 | 3300006237 | Ga0097621_100171709 | Ga0097621_1001717091 | 249 |
| 85 | 3300006358 | Ga0068871_100057216 | Ga0068871_1000572162 | 249 |
| 86 | 3300006847 | Ga0075431_100004690 | Ga0075431_1000046902 | 249 |
| 87 | 3300006871 | Ga0075434_100001309 | Ga0075434_10000130913 | 249 |
| 88 | 3300006880 | Ga0075429_100014606 | Ga0075429_1000146065 | 249 |
| 89 | 3300006914 | Ga0075436_100076859 | Ga0075436_1000768592 | 249 |
| 90 | 3300007076 | Ga0075435_100210642 | Ga0075435_1002106422 | 249 |
| 91 | 3300009147 | Ga0114129_10284320 | Ga0114129_102843202 | 249 |
| 92 | 3300009148 | Ga0105243_10090432 | Ga0105243_100904322 | 249 |
| 93 | 3300009174 | Ga0105241_10002264 | Ga0105241_100022649 | 249 |
| 94 | 3300009176 | Ga0105242_10000898 | Ga0105242_1000089812 | 249 |
| 95 | 3300009177 | Ga0105248_10000553 | Ga0105248_1000055339 | 249 |
| 96 | 3300010375 | Ga0105239_10062386 | Ga0105239_100623866 | 249 |
| 97 | 3300011119 | Ga0105246_10111427 | Ga0105246_101114272 | 249 |
| 98 | 3300013297 | Ga0157378_10007725 | Ga0157378_100077257 | 249 |
| 99 | 3300013306 | Ga0163162_10050140 | Ga0163162_100501403 | 249 |
| 100 | 3300014325 | Ga0163163_10120904 | Ga0163163_101209043 | 249 |
| 101 | 3300014326 | Ga0157380_10038531 | Ga0157380_100385313 | 249 |
| 102 | 3300017792 | Ga0163161_10016863 | Ga0163161_100168636 | 249 |
| 103 | 3300025893 | Ga0207682_10062885 | Ga0207682_100628851 | 249 |
| 104 | 3300025899 | Ga0207642_10091372 | Ga0207642_100913722 | 249 |
| 105 | 3300025903 | Ga0207680_10187639 | Ga0207680_101876392 | 249 |
| 106 | 3300025908 | Ga0207643_10035975 | Ga0207643_100359751 | 249 |
| 107 | 3300025911 | Ga0207654_10277035 | Ga0207654_102770352 | 249 |
| 108 | 3300025927 | Ga0207687_10523742 | Ga0207687_105237422 | 249 |
| 109 | 3300025931 | Ga0207644_10213042 | Ga0207644_102130422 | 249 |
| 110 | 3300025933 | Ga0207706_10000025 | Ga0207706_1000002556 | 249 |
| 111 | 3300025934 | Ga0207686_10001115 | Ga0207686_1000111526 | 249 |
| 112 | 3300025935 | Ga0207709_10004187 | Ga0207709_100041873 | 249 |
| 113 | 3300025937 | Ga0207669_10000638 | Ga0207669_1000063826 | 249 |
| 114 | 3300025938 | Ga0207704_10002325 | Ga0207704_100023255 | 249 |
| 115 | 3300025940 | Ga0207691_10132311 | Ga0207691_101323111 | 249 |
| 116 | 3300025941 | Ga0207711_10007282 | Ga0207711_100072826 | 249 |
| 117 | 3300025942 | Ga0207689_10002028 | Ga0207689_1000202810 | 249 |
| 118 | 3300025961 | Ga0207712_10001387 | Ga0207712_1000138715 | 249 |
| 119 | 3300025961 | Ga0207712_10047043 | Ga0207712_100470433 | 249 |
| 120 | 3300025981 | Ga0207640_10001530 | Ga0207640_1000153011 | 249 |
| 121 | 3300025986 | Ga0207658_10044377 | Ga0207658_100443773 | 249 |
| 122 | 3300026035 | Ga0207703_10018133 | Ga0207703_100181334 | 249 |
| 123 | 3300026067 | Ga0207678_10287056 | Ga0207678_102870562 | 249 |
| 124 | 3300026075 | Ga0207708_10011972 | Ga0207708_100119726 | 249 |
| 125 | 3300026088 | Ga0207641_10660137 | Ga0207641_106601372 | 249 |
| 126 | 3300026089 | Ga0207648_10000138 | Ga0207648_1000013852 | 249 |
| 127 | 3300026095 | Ga0207676_10061708 | Ga0207676_100617083 | 249 |
| 128 | 3300026116 | Ga0207674_10057059 | Ga0207674_100570593 | 249 |
| 129 | 3300026118 | Ga0207675_100007008 | Ga0207675_10000700814 | 249 |
| 130 | 3300026121 | Ga0207683_10006886 | Ga0207683_1000688610 | 249 |
| 131 | 3300028381 | Ga0268264_10461980 | Ga0268264_104619801 | 249 |
| 132 | 3300031665 | Ga0316575_10007541 | Ga0316575_100075416 | 249 |
| 133 | 3300035398 | Ga0316574_0046692 | Ga0316574_0046692_1895_2647 | 249 |
| 134 | 3300036401 | Ga0373937_0266127 | Ga0373937_0266127_818_1567 | 249 |
| 135 | 3300036712 | Ga0316584_0042400 | Ga0316584_0042400_385_1137 | 249 |
| 136 | 3300037588 | Ga0316581_0010755 | Ga0316581_0010755_1357_2109 | 249 |
| 137 | 3300042876 | Ga0451577_0027119 | Ga0451577_0027119_4157_4981 | 249 |
| 138 | 3300045051 | Ga0451576_0064582 | Ga0451576_0064582_695_1450 | 249 |
| 139 | 3300045051 | Ga0451576_0481455 | Ga0451576_0481455_405_1160 | 249 |
| 140 | 3300046455 | Ga0495603_0057154 | Ga0495603_0057154_461_1210 | 249 |
| 141 | 3300046472 | Ga0495580_0335669 | Ga0495580_0335669_127_882 | 249 |
| 142 | 3300046473 | Ga0495582_0026518 | Ga0495582_0026518_2409_3158 | 249 |
| 143 | 3300046475 | Ga0495639_0024118 | Ga0495639_0024118_178_927 | 249 |
| 144 | 3300046476 | Ga0495662_0012116 | Ga0495662_0012116_3414_4163 | 249 |
| 145 | 3300046477 | Ga0495664_0004041 | Ga0495664_0004041_1929_2678 | 249 |
| 146 | 3300046499 | Ga0495594_0179991 | Ga0495594_0179991_390_1139 | 249 |
| 147 | 3300046514 | Ga0495618_0017017 | Ga0495618_0017017_3563_4312 | 249 |
| 148 | 3300046517 | Ga0495630_0003672 | Ga0495630_0003672_6683_7432 | 249 |
| 149 | 3300046526 | Ga0495666_0009308 | Ga0495666_0009308_4142_4891 | 249 |
| 150 | 3300046531 | Ga0495665_0099100 | Ga0495665_0099100_717_1466 | 249 |
| 151 | 3300046533 | Ga0495640_0008996 | Ga0495640_0008996_2520_3269 | 249 |
| 152 | 3300046535 | Ga0495586_0018411 | Ga0495586_0018411_1473_2222 | 249 |
| 153 | 3300046557 | Ga0495622_0038429 | Ga0495622_0038429_1385_2134 | 249 |
| 154 | 3300046642 | Ga0495634_0001123 | Ga0495634_0001123_11887_12636 | 249 |
| 155 | 3300046648 | Ga0495611_0096488 | Ga0495611_0096488_262_1011 | 249 |
| 156 | 3300046663 | Ga0495635_0441738 | Ga0495635_0441738_28_777 | 249 |
| 157 | 3300046683 | Ga0495658_0003647 | Ga0495658_0003647_4203_4952 | 249 |
| 158 | 3300046689 | Ga0495613_0214588 | Ga0495613_0214588_515_1264 | 249 |
| 159 | 3300046691 | Ga0495670_0307056 | Ga0495670_0307056_31_780 | 249 |
| 160 | 3300047318 | Ga0495636_0015671 | Ga0495636_0015671_2244_2993 | 249 |
| 161 | 3300047319 | Ga0495674_0006511 | Ga0495674_0006511_6224_6973 | 249 |
| 162 | 3300047471 | Ga0495684_0138581 | Ga0495684_0138581_1049_1798 | 249 |
| 163 | 3300048904 | Ga0496101_0086544 | Ga0496101_0086544_1324_2073 | 249 |
| 164 | 3300048904 | Ga0496101_0227174 | Ga0496101_0227174_96_920 | 249 |
| 165 | 3300048907 | Ga0496104_0061427 | Ga0496104_0061427_1217_1966 | 249 |
| 166 | 3300048909 | Ga0496106_0012863 | Ga0496106_0012863_3533_4282 | 249 |
| 167 | 3300048909 | Ga0496106_0179104 | Ga0496106_0179104_478_1302 | 249 |
| 168 | 3300048912 | Ga0496109_0011098 | Ga0496109_0011098_5470_6219 | 249 |
| 169 | 3300048913 | Ga0496110_0027348 | Ga0496110_0027348_2499_3248 | 249 |
| 170 | 3300048914 | Ga0496111_0001415 | Ga0496111_0001415_983_1732 | 249 |
| 171 | 3300048915 | Ga0496112_0031663 | Ga0496112_0031663_2485_3234 | 249 |
| 172 | 3300048917 | Ga0496114_0031673 | Ga0496114_0031673_2757_3581 | 249 |
| 173 | 3300049743 | Ga0501081_0312882 | Ga0501081_0312882_229_993 | 249 |
| 174 | 3300050507 | nmdc:mga05p37_99343_c1 | nmdc:mga05p37_99343_c1_307_1062 | 249 |
| 175 | 3300050508 | nmdc:mga09592_1960_c1 | nmdc:mga09592_1960_c1_13167_13922 | 249 |
| 176 | 3300050510 | nmdc:mga06r32_6157_c1 | nmdc:mga06r32_6157_c1_709_1464 | 249 |
| 177 | 3300050512 | nmdc:mga0n895_9435_c1 | nmdc:mga0n895_9435_c1_938_1693 | 249 |
| 178 | 3300050514 | nmdc:mga08x19_67948_c1 | nmdc:mga08x19_67948_c1_1395_2150 | 249 |
| 179 | 3300050515 | nmdc:mga0a205_37980_c2 | nmdc:mga0a205_37980_c2_1599_2354 | 249 |
| 180 | 3300005293 | Ga0065715_10172036 | Ga0065715_101720362 | 250 |
| 181 | 3300005330 | Ga0070690_100153621 | Ga0070690_1001536212 | 250 |
| 182 | 3300005333 | Ga0070677_10089284 | Ga0070677_100892842 | 250 |
| 183 | 3300005334 | Ga0068869_100107191 | Ga0068869_1001071912 | 250 |
| 184 | 3300005336 | Ga0070680_100012482 | Ga0070680_1000124824 | 250 |
| 185 | 3300005336 | Ga0070680_100740609 | Ga0070680_1007406091 | 250 |
| 186 | 3300005341 | Ga0070691_10080743 | Ga0070691_100807432 | 250 |
| 187 | 3300005353 | Ga0070669_100314702 | Ga0070669_1003147022 | 250 |
| 188 | 3300005355 | Ga0070671_100015791 | Ga0070671_1000157914 | 250 |
| 189 | 3300005406 | Ga0070703_10000400 | Ga0070703_1000040011 | 250 |
| 190 | 3300005406 | Ga0070703_10004333 | Ga0070703_100043333 | 250 |
| 191 | 3300005406 | Ga0070703_10023034 | Ga0070703_100230343 | 250 |
| 192 | 3300005406 | Ga0070703_10036825 | Ga0070703_100368252 | 250 |
| 193 | 3300005434 | Ga0070709_10017281 | Ga0070709_100172814 | 250 |
| 194 | 3300005436 | Ga0070713_100351713 | Ga0070713_1003517132 | 250 |
| 195 | 3300005438 | Ga0070701_10027625 | Ga0070701_100276253 | 250 |
| 196 | 3300005439 | Ga0070711_100000073 | Ga0070711_1000000736 | 250 |
| 197 | 3300005440 | Ga0070705_100031246 | Ga0070705_1000312462 | 250 |
| 198 | 3300005440 | Ga0070705_100046042 | Ga0070705_1000460421 | 250 |
| 199 | 3300005440 | Ga0070705_100078760 | Ga0070705_1000787603 | 250 |
| 200 | 3300005440 | Ga0070705_100141344 | Ga0070705_1001413442 | 250 |
| 201 | 3300005440 | Ga0070705_100513412 | Ga0070705_1005134121 | 250 |
| 202 | 3300005441 | Ga0070700_100298494 | Ga0070700_1002984942 | 250 |
| 203 | 3300005444 | Ga0070694_100002864 | Ga0070694_1000028646 | 250 |
| 204 | 3300005444 | Ga0070694_100004972 | Ga0070694_1000049726 | 250 |
| 205 | 3300005444 | Ga0070694_100030788 | Ga0070694_1000307883 | 250 |
| 206 | 3300005444 | Ga0070694_100243966 | Ga0070694_1002439662 | 250 |
| 207 | 3300005444 | Ga0070694_100602971 | Ga0070694_1006029711 | 250 |
| 208 | 3300005445 | Ga0070708_100002955 | Ga0070708_10000295511 | 250 |
| 209 | 3300005445 | Ga0070708_100003800 | Ga0070708_10000380020 | 250 |
| 210 | 3300005445 | Ga0070708_100012155 | Ga0070708_1000121556 | 250 |
| 211 | 3300005445 | Ga0070708_100022575 | Ga0070708_1000225753 | 250 |
| 212 | 3300005445 | Ga0070708_100030082 | Ga0070708_1000300822 | 250 |
| 213 | 3300005445 | Ga0070708_100075367 | Ga0070708_1000753671 | 250 |
| 214 | 3300005445 | Ga0070708_100121780 | Ga0070708_1001217803 | 250 |
| 215 | 3300005445 | Ga0070708_100143211 | Ga0070708_1001432112 | 250 |
| 216 | 3300005445 | Ga0070708_100213598 | Ga0070708_1002135981 | 250 |
| 217 | 3300005445 | Ga0070708_100793220 | Ga0070708_1007932201 | 250 |
| 218 | 3300005459 | Ga0068867_100077973 | Ga0068867_1000779732 | 250 |
| 219 | 3300005467 | Ga0070706_100013278 | Ga0070706_1000132783 | 250 |
| 220 | 3300005467 | Ga0070706_100027105 | Ga0070706_1000271054 | 250 |
| 221 | 3300005467 | Ga0070706_100058698 | Ga0070706_1000586983 | 250 |
| 222 | 3300005467 | Ga0070706_100064520 | Ga0070706_1000645203 | 250 |
| 223 | 3300005467 | Ga0070706_100103033 | Ga0070706_1001030332 | 250 |
| 224 | 3300005467 | Ga0070706_100198197 | Ga0070706_1001981973 | 250 |
| 225 | 3300005467 | Ga0070706_100269523 | Ga0070706_1002695232 | 250 |
| 226 | 3300005467 | Ga0070706_100492088 | Ga0070706_1004920882 | 250 |
| 227 | 3300005468 | Ga0070707_100004355 | Ga0070707_1000043554 | 250 |
| 228 | 3300005468 | Ga0070707_100019858 | Ga0070707_1000198582 | 250 |
| 229 | 3300005468 | Ga0070707_100022307 | Ga0070707_1000223072 | 250 |
| 230 | 3300005468 | Ga0070707_100102938 | Ga0070707_1001029383 | 250 |
| 231 | 3300005468 | Ga0070707_100130438 | Ga0070707_1001304383 | 250 |
| 232 | 3300005468 | Ga0070707_100151021 | Ga0070707_1001510212 | 250 |
| 233 | 3300005468 | Ga0070707_100165154 | Ga0070707_1001651542 | 250 |
| 234 | 3300005471 | Ga0070698_100001849 | Ga0070698_10000184922 | 250 |
| 235 | 3300005471 | Ga0070698_100005769 | Ga0070698_1000057694 | 250 |
| 236 | 3300005471 | Ga0070698_100059762 | Ga0070698_1000597622 | 250 |
| 237 | 3300005471 | Ga0070698_100143327 | Ga0070698_1001433272 | 250 |
| 238 | 3300005518 | Ga0070699_100003912 | Ga0070699_1000039124 | 250 |
| 239 | 3300005518 | Ga0070699_100007097 | Ga0070699_1000070975 | 250 |
| 240 | 3300005518 | Ga0070699_100014358 | Ga0070699_1000143587 | 250 |
| 241 | 3300005518 | Ga0070699_100033605 | Ga0070699_1000336052 | 250 |
| 242 | 3300005518 | Ga0070699_100036013 | Ga0070699_1000360135 | 250 |
| 243 | 3300005518 | Ga0070699_100047106 | Ga0070699_1000471063 | 250 |
| 244 | 3300005518 | Ga0070699_100050458 | Ga0070699_1000504582 | 250 |
| 245 | 3300005518 | Ga0070699_100055580 | Ga0070699_1000555803 | 250 |
| 246 | 3300005518 | Ga0070699_100068165 | Ga0070699_1000681653 | 250 |
| 247 | 3300005518 | Ga0070699_100198299 | Ga0070699_1001982992 | 250 |
| 248 | 3300005518 | Ga0070699_100209320 | Ga0070699_1002093202 | 250 |
| 249 | 3300005530 | Ga0070679_100574612 | Ga0070679_1005746121 | 250 |
| 250 | 3300005536 | Ga0070697_100002528 | Ga0070697_10000252811 | 250 |
| 251 | 3300005536 | Ga0070697_100011384 | Ga0070697_1000113847 | 250 |
| 252 | 3300005536 | Ga0070697_100013208 | Ga0070697_1000132084 | 250 |
| 253 | 3300005536 | Ga0070697_100027041 | Ga0070697_1000270412 | 250 |
| 254 | 3300005536 | Ga0070697_100103428 | Ga0070697_1001034282 | 250 |
| 255 | 3300005536 | Ga0070697_100166743 | Ga0070697_1001667432 | 250 |
| 256 | 3300005536 | Ga0070697_100337252 | Ga0070697_1003372521 | 250 |
| 257 | 3300005543 | Ga0070672_100023772 | Ga0070672_1000237723 | 250 |
| 258 | 3300005543 | Ga0070672_100063726 | Ga0070672_1000637263 | 250 |
| 259 | 3300005545 | Ga0070695_100000708 | Ga0070695_10000070810 | 250 |
| 260 | 3300005545 | Ga0070695_100002446 | Ga0070695_1000024462 | 250 |
| 261 | 3300005545 | Ga0070695_100002490 | Ga0070695_10000249010 | 250 |
| 262 | 3300005545 | Ga0070695_100040537 | Ga0070695_1000405373 | 250 |
| 263 | 3300005545 | Ga0070695_100043206 | Ga0070695_1000432063 | 250 |
| 264 | 3300005545 | Ga0070695_100074795 | Ga0070695_1000747953 | 250 |
| 265 | 3300005545 | Ga0070695_100091101 | Ga0070695_1000911013 | 250 |
| 266 | 3300005546 | Ga0070696_100001655 | Ga0070696_10000165523 | 250 |
| 267 | 3300005546 | Ga0070696_100007194 | Ga0070696_1000071947 | 250 |
| 268 | 3300005546 | Ga0070696_100007549 | Ga0070696_10000754913 | 250 |
| 269 | 3300005546 | Ga0070696_100018458 | Ga0070696_1000184582 | 250 |
| 270 | 3300005546 | Ga0070696_100063764 | Ga0070696_1000637643 | 250 |
| 271 | 3300005546 | Ga0070696_100137147 | Ga0070696_1001371472 | 250 |
| 272 | 3300005546 | Ga0070696_100190806 | Ga0070696_1001908062 | 250 |
| 273 | 3300005546 | Ga0070696_100229105 | Ga0070696_1002291052 | 250 |
| 274 | 3300005549 | Ga0070704_100006456 | Ga0070704_1000064569 | 250 |
| 275 | 3300005549 | Ga0070704_100007402 | Ga0070704_1000074024 | 250 |
| 276 | 3300005549 | Ga0070704_100011139 | Ga0070704_1000111392 | 250 |
| 277 | 3300005549 | Ga0070704_100026415 | Ga0070704_1000264152 | 250 |
| 278 | 3300005549 | Ga0070704_100031354 | Ga0070704_1000313543 | 250 |
| 279 | 3300005549 | Ga0070704_100043891 | Ga0070704_1000438912 | 250 |
| 280 | 3300005549 | Ga0070704_100100528 | Ga0070704_1001005282 | 250 |
| 281 | 3300005549 | Ga0070704_100162347 | Ga0070704_1001623472 | 250 |
| 282 | 3300005549 | Ga0070704_100162822 | Ga0070704_1001628222 | 250 |
| 283 | 3300005615 | Ga0070702_100100541 | Ga0070702_1001005412 | 250 |
| 284 | 3300005617 | Ga0068859_100132746 | Ga0068859_1001327463 | 250 |
| 285 | 3300005719 | Ga0068861_100135129 | Ga0068861_1001351292 | 250 |
| 286 | 3300006173 | Ga0070716_100049621 | Ga0070716_1000496213 | 250 |
| 287 | 3300006844 | Ga0075428_100024257 | Ga0075428_1000242572 | 250 |
| 288 | 3300006844 | Ga0075428_100074322 | Ga0075428_1000743223 | 250 |
| 289 | 3300006847 | Ga0075431_100113593 | Ga0075431_1001135933 | 250 |
| 290 | 3300006847 | Ga0075431_100121386 | Ga0075431_1001213863 | 250 |
| 291 | 3300006852 | Ga0075433_10019487 | Ga0075433_100194873 | 250 |
| 292 | 3300006852 | Ga0075433_10035328 | Ga0075433_100353283 | 250 |
| 293 | 3300006852 | Ga0075433_10267606 | Ga0075433_102676062 | 250 |
| 294 | 3300006852 | Ga0075433_10283632 | Ga0075433_102836322 | 250 |
| 295 | 3300006852 | Ga0075433_10421723 | Ga0075433_104217231 | 250 |
| 296 | 3300006871 | Ga0075434_100013195 | Ga0075434_1000131959 | 250 |
| 297 | 3300006871 | Ga0075434_100035536 | Ga0075434_1000355361 | 250 |
| 298 | 3300006871 | Ga0075434_100082939 | Ga0075434_1000829392 | 250 |
| 299 | 3300006871 | Ga0075434_100219146 | Ga0075434_1002191463 | 250 |
| 300 | 3300006871 | Ga0075434_100246424 | Ga0075434_1002464243 | 250 |
| 301 | 3300006871 | Ga0075434_100368938 | Ga0075434_1003689382 | 250 |
| 302 | 3300006880 | Ga0075429_100006438 | Ga0075429_1000064388 | 250 |
| 303 | 3300006880 | Ga0075429_100141586 | Ga0075429_1001415863 | 250 |
| 304 | 3300006914 | Ga0075436_100016067 | Ga0075436_1000160676 | 250 |
| 305 | 3300006914 | Ga0075436_100017112 | Ga0075436_1000171124 | 250 |
| 306 | 3300006931 | Ga0097620_100132752 | Ga0097620_1001327523 | 250 |
| 307 | 3300007076 | Ga0075435_100008387 | Ga0075435_1000083877 | 250 |
| 308 | 3300007076 | Ga0075435_100057282 | Ga0075435_1000572822 | 250 |
| 309 | 3300007265 | Ga0099794_10000157 | Ga0099794_1000015725 | 250 |
| 310 | 3300007265 | Ga0099794_10008565 | Ga0099794_100085652 | 250 |
| 311 | 3300007265 | Ga0099794_10015189 | Ga0099794_100151892 | 250 |
| 312 | 3300009094 | Ga0111539_10112436 | Ga0111539_101124363 | 250 |
| 313 | 3300009094 | Ga0111539_10313436 | Ga0111539_103134362 | 250 |
| 314 | 3300009094 | Ga0111539_10390150 | Ga0111539_103901502 | 250 |
| 315 | 3300009094 | Ga0111539_10729194 | Ga0111539_107291941 | 250 |
| 316 | 3300009147 | Ga0114129_10002536 | Ga0114129_1000253624 | 250 |
| 317 | 3300009147 | Ga0114129_10008126 | Ga0114129_1000812611 | 250 |
| 318 | 3300009147 | Ga0114129_10074564 | Ga0114129_100745644 | 250 |
| 319 | 3300009147 | Ga0114129_10095879 | Ga0114129_100958794 | 250 |
| 320 | 3300009147 | Ga0114129_10097744 | Ga0114129_100977443 | 250 |
| 321 | 3300009147 | Ga0114129_10108059 | Ga0114129_101080593 | 250 |
| 322 | 3300009147 | Ga0114129_10215057 | Ga0114129_102150572 | 250 |
| 323 | 3300009147 | Ga0114129_10715013 | Ga0114129_107150132 | 250 |
| 324 | 3300009174 | Ga0105241_10592482 | Ga0105241_105924822 | 250 |
| 325 | 3300010375 | Ga0105239_10029421 | Ga0105239_100294212 | 250 |
| 326 | 3300011119 | Ga0105246_10201409 | Ga0105246_102014092 | 250 |
| 327 | 3300013308 | Ga0157375_10045014 | Ga0157375_100450143 | 250 |
| 328 | 3300014326 | Ga0157380_10491628 | Ga0157380_104916282 | 250 |
| 329 | 3300014969 | Ga0157376_10094164 | Ga0157376_100941642 | 250 |
| 330 | 3300025885 | Ga0207653_10000147 | Ga0207653_1000014725 | 250 |
| 331 | 3300025885 | Ga0207653_10006845 | Ga0207653_100068454 | 250 |
| 332 | 3300025885 | Ga0207653_10022887 | Ga0207653_100228873 | 250 |
| 333 | 3300025893 | Ga0207682_10020954 | Ga0207682_100209543 | 250 |
| 334 | 3300025906 | Ga0207699_10004264 | Ga0207699_100042647 | 250 |
| 335 | 3300025906 | Ga0207699_10037630 | Ga0207699_100376303 | 250 |
| 336 | 3300025910 | Ga0207684_10092582 | Ga0207684_100925823 | 250 |
| 337 | 3300025910 | Ga0207684_10102901 | Ga0207684_101029012 | 250 |
| 338 | 3300025910 | Ga0207684_10143626 | Ga0207684_101436262 | 250 |
| 339 | 3300025916 | Ga0207663_10000058 | Ga0207663_1000005851 | 250 |
| 340 | 3300025917 | Ga0207660_10002654 | Ga0207660_100026549 | 250 |
| 341 | 3300025918 | Ga0207662_10039333 | Ga0207662_100393334 | 250 |
| 342 | 3300025922 | Ga0207646_10001572 | Ga0207646_1000157219 | 250 |
| 343 | 3300025922 | Ga0207646_10004802 | Ga0207646_100048022 | 250 |
| 344 | 3300025922 | Ga0207646_10005813 | Ga0207646_100058134 | 250 |
| 345 | 3300025922 | Ga0207646_10014960 | Ga0207646_100149606 | 250 |
| 346 | 3300025922 | Ga0207646_10031745 | Ga0207646_100317456 | 250 |
| 347 | 3300025922 | Ga0207646_10204155 | Ga0207646_102041552 | 250 |
| 348 | 3300025922 | Ga0207646_10396553 | Ga0207646_103965532 | 250 |
| 349 | 3300025923 | Ga0207681_10411773 | Ga0207681_104117732 | 250 |
| 350 | 3300025925 | Ga0207650_10265353 | Ga0207650_102653532 | 250 |
| 351 | 3300025928 | Ga0207700_10282204 | Ga0207700_102822042 | 250 |
| 352 | 3300025939 | Ga0207665_10008082 | Ga0207665_1000808212 | 250 |
| 353 | 3300025939 | Ga0207665_10069730 | Ga0207665_100697302 | 250 |
| 354 | 3300025942 | Ga0207689_10123583 | Ga0207689_101235832 | 250 |
| 355 | 3300025960 | Ga0207651_10153211 | Ga0207651_101532112 | 250 |
| 356 | 3300026075 | Ga0207708_10043509 | Ga0207708_100435095 | 250 |
| 357 | 3300026089 | Ga0207648_10148064 | Ga0207648_101480642 | 250 |
| 358 | 3300026118 | Ga0207675_100072751 | Ga0207675_1000727513 | 250 |
| 359 | 3300027671 | Ga0209588_1000118 | Ga0209588_100011822 | 250 |
| 360 | 3300027671 | Ga0209588_1002257 | Ga0209588_10022578 | 250 |
| 361 | 3300031548 | Ga0307408_100024162 | Ga0307408_1000241622 | 250 |
| 362 | 3300031731 | Ga0307405_10082860 | Ga0307405_100828602 | 250 |
| 363 | 3300031824 | Ga0307413_10008669 | Ga0307413_100086696 | 250 |
| 364 | 3300031824 | Ga0307413_10023385 | Ga0307413_100233853 | 250 |
| 365 | 3300031824 | Ga0307413_10035744 | Ga0307413_100357443 | 250 |
| 366 | 3300031824 | Ga0307413_10213219 | Ga0307413_102132191 | 250 |
| 367 | 3300031852 | Ga0307410_10002797 | Ga0307410_100027978 | 250 |
| 368 | 3300031852 | Ga0307410_10011250 | Ga0307410_100112506 | 250 |
| 369 | 3300031852 | Ga0307410_10017270 | Ga0307410_100172704 | 250 |
| 370 | 3300031852 | Ga0307410_10044948 | Ga0307410_100449483 | 250 |
| 371 | 3300031852 | Ga0307410_10071046 | Ga0307410_100710462 | 250 |
| 372 | 3300031852 | Ga0307410_10156219 | Ga0307410_101562192 | 250 |
| 373 | 3300031901 | Ga0307406_10121626 | Ga0307406_101216262 | 250 |
| 374 | 3300031903 | Ga0307407_10002696 | Ga0307407_100026965 | 250 |
| 375 | 3300031903 | Ga0307407_10054882 | Ga0307407_100548821 | 250 |
| 376 | 3300031903 | Ga0307407_10476287 | Ga0307407_104762872 | 250 |
| 377 | 3300031911 | Ga0307412_10253504 | Ga0307412_102535042 | 250 |
| 378 | 3300031995 | Ga0307409_100000501 | Ga0307409_1000005016 | 250 |
| 379 | 3300031995 | Ga0307409_100009842 | Ga0307409_1000098425 | 250 |
| 380 | 3300031995 | Ga0307409_100013494 | Ga0307409_1000134946 | 250 |
| 381 | 3300031995 | Ga0307409_100065582 | Ga0307409_1000655823 | 250 |
| 382 | 3300031995 | Ga0307409_100072311 | Ga0307409_1000723114 | 250 |
| 383 | 3300031995 | Ga0307409_100175416 | Ga0307409_1001754162 | 250 |
| 384 | 3300031995 | Ga0307409_100495024 | Ga0307409_1004950241 | 250 |
| 385 | 3300031995 | Ga0307409_100682052 | Ga0307409_1006820521 | 250 |
| 386 | 3300032002 | Ga0307416_100003220 | Ga0307416_10000322012 | 250 |
| 387 | 3300032002 | Ga0307416_100013407 | Ga0307416_1000134076 | 250 |
| 388 | 3300032002 | Ga0307416_100083848 | Ga0307416_1000838483 | 250 |
| 389 | 3300032002 | Ga0307416_100340168 | Ga0307416_1003401682 | 250 |
| 390 | 3300032002 | Ga0307416_100386225 | Ga0307416_1003862252 | 250 |
| 391 | 3300032002 | Ga0307416_100601895 | Ga0307416_1006018952 | 250 |
| 392 | 3300032004 | Ga0307414_10002427 | Ga0307414_100024272 | 250 |
| 393 | 3300032004 | Ga0307414_10023155 | Ga0307414_100231554 | 250 |
| 394 | 3300032004 | Ga0307414_10058397 | Ga0307414_100583972 | 250 |
| 395 | 3300032004 | Ga0307414_10171058 | Ga0307414_101710583 | 250 |
| 396 | 3300032004 | Ga0307414_10215425 | Ga0307414_102154252 | 250 |
| 397 | 3300032004 | Ga0307414_10222334 | Ga0307414_102223342 | 250 |
| 398 | 3300032004 | Ga0307414_10736328 | Ga0307414_107363282 | 250 |
| 399 | 3300032005 | Ga0307411_10000568 | Ga0307411_100005685 | 250 |
| 400 | 3300032005 | Ga0307411_10001075 | Ga0307411_1000107520 | 250 |
| 401 | 3300032005 | Ga0307411_10002193 | Ga0307411_100021935 | 250 |
| 402 | 3300032005 | Ga0307411_10037682 | Ga0307411_100376823 | 250 |
| 403 | 3300032005 | Ga0307411_10199814 | Ga0307411_101998142 | 250 |
| 404 | 3300032005 | Ga0307411_10211703 | Ga0307411_102117032 | 250 |
| 405 | 3300032126 | Ga0307415_100004330 | Ga0307415_1000043302 | 250 |
| 406 | 3300032126 | Ga0307415_100052304 | Ga0307415_1000523043 | 250 |
| 407 | 3300032126 | Ga0307415_100059867 | Ga0307415_1000598673 | 250 |
| 408 | 3300032126 | Ga0307415_100305980 | Ga0307415_1003059801 | 250 |
| 409 | 3300035085 | Ga0373929_0065014 | Ga0373929_0065014_77_829 | 250 |
| 410 | 3300035114 | Ga0373939_0059898 | Ga0373939_0059898_260_1012 | 250 |
| 411 | 3300035691 | Ga0373931_0011551 | Ga0373931_0011551_3097_3849 | 250 |
| 412 | 3300037471 | Ga0395905_0193004 | Ga0395905_0193004_597_1349 | 250 |
| 413 | 3300037471 | Ga0395905_0269065 | Ga0395905_0269065_166_918 | 250 |
| 414 | 3300038996 | Ga0242420_015095 | Ga0242420_015095_414_1166 | 250 |
| 415 | 3300042156 | Ga0439446_0036952 | Ga0439446_0036952_102_854 | 250 |
| 416 | 3300042156 | Ga0439446_0039794 | Ga0439446_0039794_15_767 | 250 |
| 417 | 3300042876 | Ga0451577_0219675 | Ga0451577_0219675_230_982 | 250 |
| 418 | 3300042876 | Ga0451577_0353228 | Ga0451577_0353228_394_1221 | 250 |
| 419 | 3300044673 | Ga0453683_0010893 | Ga0453683_0010893_133_885 | 250 |
| 420 | 3300045051 | Ga0451576_0015443 | Ga0451576_0015443_5772_6524 | 250 |
| 421 | 3300045051 | Ga0451576_0016252 | Ga0451576_0016252_3299_4051 | 250 |
| 422 | 3300045051 | Ga0451576_0156383 | Ga0451576_0156383_471_1229 | 250 |
| 423 | 3300045051 | Ga0451576_0296689 | Ga0451576_0296689_47_808 | 250 |
| 424 | 3300046538 | Ga0495609_0182178 | Ga0495609_0182178_65_817 | 250 |
| 425 | 3300048904 | Ga0496101_0066105 | Ga0496101_0066105_1095_1847 | 250 |
| 426 | 3300048904 | Ga0496101_0314979 | Ga0496101_0314979_178_930 | 250 |
| 427 | 3300048905 | Ga0496102_0002335 | Ga0496102_0002335_8047_8799 | 250 |
| 428 | 3300048905 | Ga0496102_0117502 | Ga0496102_0117502_356_1108 | 250 |
| 429 | 3300048905 | Ga0496102_0129252 | Ga0496102_0129252_1046_1798 | 250 |
| 430 | 3300048905 | Ga0496102_0434624 | Ga0496102_0434624_185_937 | 250 |
| 431 | 3300048906 | Ga0496103_0099184 | Ga0496103_0099184_406_1158 | 250 |
| 432 | 3300048907 | Ga0496104_0003370 | Ga0496104_0003370_11390_12142 | 250 |
| 433 | 3300048907 | Ga0496104_0017568 | Ga0496104_0017568_678_1430 | 250 |
| 434 | 3300048909 | Ga0496106_0006627 | Ga0496106_0006627_7643_8395 | 250 |
| 435 | 3300048909 | Ga0496106_0040184 | Ga0496106_0040184_2665_3417 | 250 |
| 436 | 3300048909 | Ga0496106_0251024 | Ga0496106_0251024_228_980 | 250 |
| 437 | 3300048909 | Ga0496106_0336107 | Ga0496106_0336107_287_1039 | 250 |
| 438 | 3300048910 | Ga0496107_0025969 | Ga0496107_0025969_52_804 | 250 |
| 439 | 3300048910 | Ga0496107_0192918 | Ga0496107_0192918_581_1333 | 250 |
| 440 | 3300048911 | Ga0496108_0013301 | Ga0496108_0013301_5151_5903 | 250 |
| 441 | 3300048911 | Ga0496108_0015304 | Ga0496108_0015304_688_1440 | 250 |
| 442 | 3300048912 | Ga0496109_0002383 | Ga0496109_0002383_3430_4182 | 250 |
| 443 | 3300048912 | Ga0496109_0041379 | Ga0496109_0041379_2779_3531 | 250 |
| 444 | 3300048913 | Ga0496110_0005386 | Ga0496110_0005386_8152_8904 | 250 |
| 445 | 3300048913 | Ga0496110_0038740 | Ga0496110_0038740_2758_3510 | 250 |
| 446 | 3300048914 | Ga0496111_0021474 | Ga0496111_0021474_1749_2501 | 250 |
| 447 | 3300048915 | Ga0496112_0005776 | Ga0496112_0005776_6518_7270 | 250 |
| 448 | 3300048915 | Ga0496112_0256053 | Ga0496112_0256053_659_1411 | 250 |
| 449 | 3300048916 | Ga0496113_0001258 | Ga0496113_0001258_8619_9371 | 250 |
| 450 | 3300048917 | Ga0496114_0432309 | Ga0496114_0432309_299_1051 | 250 |
| 451 | 3300048917 | Ga0496114_0611754 | Ga0496114_0611754_116_868 | 250 |
| 452 | 3300048918 | Ga0496115_0223163 | Ga0496115_0223163_319_1071 | 250 |
| 453 | 3300049568 | Ga0501031_0059743 | Ga0501031_0059743_1284_2048 | 250 |
| 454 | 3300049568 | Ga0501031_0299120 | Ga0501031_0299120_38_790 | 250 |
| 455 | 3300049568 | Ga0501031_0387596 | Ga0501031_0387596_60_830 | 250 |
| 456 | 3300049569 | Ga0501032_0168027 | Ga0501032_0168027_545_1297 | 250 |
| 457 | 3300049570 | Ga0501033_0101660 | Ga0501033_0101660_1231_1995 | 250 |
| 458 | 3300049571 | Ga0501034_0008138 | Ga0501034_0008138_7889_8647 | 250 |
| 459 | 3300049572 | Ga0501036_0276418 | Ga0501036_0276418_154_906 | 250 |
| 460 | 3300049574 | Ga0501038_0139438 | Ga0501038_0139438_950_1714 | 250 |
| 461 | 3300049574 | Ga0501038_0344309 | Ga0501038_0344309_29_781 | 250 |
| 462 | 3300049576 | Ga0501040_0038105 | Ga0501040_0038105_2014_2766 | 250 |
| 463 | 3300049576 | Ga0501040_0042871 | Ga0501040_0042871_1365_2117 | 250 |
| 464 | 3300049576 | Ga0501040_0133964 | Ga0501040_0133964_888_1640 | 250 |
| 465 | 3300049577 | Ga0501041_0005915 | Ga0501041_0005915_6094_6858 | 250 |
| 466 | 3300049577 | Ga0501041_0130025 | Ga0501041_0130025_184_936 | 250 |
| 467 | 3300049577 | Ga0501041_0411238 | Ga0501041_0411238_16_768 | 250 |
| 468 | 3300049579 | Ga0501043_0513502 | Ga0501043_0513502_121_873 | 250 |
| 469 | 3300049580 | Ga0501046_0031036 | Ga0501046_0031036_1770_2534 | 250 |
| 470 | 3300049580 | Ga0501046_0107152 | Ga0501046_0107152_1282_2034 | 250 |
| 471 | 3300049580 | Ga0501046_0149895 | Ga0501046_0149895_63_815 | 250 |
| 472 | 3300049580 | Ga0501046_0175840 | Ga0501046_0175840_166_918 | 250 |
| 473 | 3300049582 | Ga0501048_0044063 | Ga0501048_0044063_1621_2385 | 250 |
| 474 | 3300049583 | Ga0501067_0028450 | Ga0501067_0028450_2140_2898 | 250 |
| 475 | 3300049583 | Ga0501067_0076986 | Ga0501067_0076986_542_1294 | 250 |
| 476 | 3300049584 | Ga0501068_0000074 | Ga0501068_0000074_35302_36057 | 250 |
| 477 | 3300049584 | Ga0501068_0005867 | Ga0501068_0005867_3997_4755 | 250 |
| 478 | 3300049585 | Ga0501069_0002254 | Ga0501069_0002254_878_1654 | 250 |
| 479 | 3300049585 | Ga0501069_0004361 | Ga0501069_0004361_6091_6849 | 250 |
| 480 | 3300049586 | Ga0501070_0011246 | Ga0501070_0011246_2948_3706 | 250 |
| 481 | 3300049586 | Ga0501070_0086505 | Ga0501070_0086505_644_1408 | 250 |
| 482 | 3300049587 | Ga0501071_0012717 | Ga0501071_0012717_3853_4611 | 250 |
| 483 | 3300049587 | Ga0501071_0014765 | Ga0501071_0014765_2756_3511 | 250 |
| 484 | 3300049587 | Ga0501071_0039065 | Ga0501071_0039065_1712_2464 | 250 |
| 485 | 3300049587 | Ga0501071_0041914 | Ga0501071_0041914_1176_1940 | 250 |
| 486 | 3300049588 | Ga0501072_0001150 | Ga0501072_0001150_16583_17341 | 250 |
| 487 | 3300049588 | Ga0501072_0009461 | Ga0501072_0009461_4416_5180 | 250 |
| 488 | 3300049588 | Ga0501072_0045433 | Ga0501072_0045433_1650_2402 | 250 |
| 489 | 3300049588 | Ga0501072_0063513 | Ga0501072_0063513_2039_2791 | 250 |
| 490 | 3300049589 | Ga0501073_0088822 | Ga0501073_0088822_1376_2131 | 250 |
| 491 | 3300049589 | Ga0501073_0103945 | Ga0501073_0103945_256_1014 | 250 |
| 492 | 3300049590 | Ga0501074_0005104 | Ga0501074_0005104_1507_2265 | 250 |
| 493 | 3300049590 | Ga0501074_0013526 | Ga0501074_0013526_3819_4595 | 250 |
| 494 | 3300049590 | Ga0501074_0028966 | Ga0501074_0028966_50_814 | 250 |
| 495 | 3300049590 | Ga0501074_0087048 | Ga0501074_0087048_485_1237 | 250 |
| 496 | 3300049590 | Ga0501074_0358761 | Ga0501074_0358761_209_961 | 250 |
| 497 | 3300049591 | Ga0501075_0030791 | Ga0501075_0030791_1075_1827 | 250 |
| 498 | 3300049591 | Ga0501075_0053825 | Ga0501075_0053825_1621_2385 | 250 |
| 499 | 3300049591 | Ga0501075_0085367 | Ga0501075_0085367_754_1506 | 250 |
| 500 | 3300049591 | Ga0501075_0504197 | Ga0501075_0504197_91_852 | 250 |
| 501 | 3300049592 | Ga0501076_0006957 | Ga0501076_0006957_1755_2507 | 250 |
| 502 | 3300049592 | Ga0501076_0018259 | Ga0501076_0018259_3566_4318 | 250 |
| 503 | 3300049592 | Ga0501076_0093530 | Ga0501076_0093530_589_1353 | 250 |
| 504 | 3300049592 | Ga0501076_0278966 | Ga0501076_0278966_49_810 | 250 |
| 505 | 3300049592 | Ga0501076_0711143 | Ga0501076_0711143_52_807 | 250 |
| 506 | 3300049593 | Ga0501077_0004692 | Ga0501077_0004692_173_925 | 250 |
| 507 | 3300049593 | Ga0501077_0021490 | Ga0501077_0021490_2536_3288 | 250 |
| 508 | 3300049593 | Ga0501077_0277655 | Ga0501077_0277655_113_865 | 250 |
| 509 | 3300049741 | Ga0501079_0008496 | Ga0501079_0008496_1653_2417 | 250 |
| 510 | 3300049741 | Ga0501079_0095858 | Ga0501079_0095858_212_964 | 250 |
| 511 | 3300049741 | Ga0501079_0183121 | Ga0501079_0183121_104_859 | 250 |
| 512 | 3300049741 | Ga0501079_0184104 | Ga0501079_0184104_193_945 | 250 |
| 513 | 3300049741 | Ga0501079_0216668 | Ga0501079_0216668_140_901 | 250 |
| 514 | 3300049742 | Ga0501080_0053401 | Ga0501080_0053401_2941_3705 | 250 |
| 515 | 3300049742 | Ga0501080_0059282 | Ga0501080_0059282_1837_2592 | 250 |
| 516 | 3300049743 | Ga0501081_0018953 | Ga0501081_0018953_1805_2557 | 250 |
| 517 | 3300049743 | Ga0501081_0051957 | Ga0501081_0051957_1233_1985 | 250 |
| 518 | 3300049743 | Ga0501081_0131341 | Ga0501081_0131341_19_780 | 250 |
| 519 | 3300049743 | Ga0501081_0351571 | Ga0501081_0351571_295_1053 | 250 |
| 520 | 3300049744 | Ga0501083_0013805 | Ga0501083_0013805_2216_2974 | 250 |
| 521 | 3300049744 | Ga0501083_0098320 | Ga0501083_0098320_571_1347 | 250 |
| 522 | 3300049744 | Ga0501083_0336031 | Ga0501083_0336031_98_862 | 250 |
| 523 | 3300049823 | Ga0501044_0551044 | Ga0501044_0551044_261_1037 | 250 |
| 524 | 3300049824 | Ga0501045_0033270 | Ga0501045_0033270_1621_2385 | 250 |
| 525 | 3300049824 | Ga0501045_0053219 | Ga0501045_0053219_1165_1917 | 250 |
| 526 | 3300049824 | Ga0501045_0087153 | Ga0501045_0087153_386_1138 | 250 |
| 527 | 3300049824 | Ga0501045_0095019 | Ga0501045_0095019_869_1621 | 250 |
| 528 | 3300050507 | nmdc:mga05p37_164956_c1 | nmdc:mga05p37_164956_c1_1887_2639 | 250 |
| 529 | 3300050507 | nmdc:mga05p37_1880_c1 | nmdc:mga05p37_1880_c1_18206_18967 | 250 |
| 530 | 3300050507 | nmdc:mga05p37_28175_c1 | nmdc:mga05p37_28175_c1_5998_6750 | 250 |
| 531 | 3300050507 | nmdc:mga05p37_447704_c1 | nmdc:mga05p37_447704_c1_286_1062 | 250 |
| 532 | 3300050507 | nmdc:mga05p37_550137_c1 | nmdc:mga05p37_550137_c1_122_874 | 250 |
| 533 | 3300050507 | nmdc:mga05p37_733008_c1 | nmdc:mga05p37_733008_c1_33_785 | 250 |
| 534 | 3300050507 | nmdc:mga05p37_832844_c1 | nmdc:mga05p37_832844_c1_10_762 | 250 |
| 535 | 3300050508 | nmdc:mga09592_160873_c1 | nmdc:mga09592_160873_c1_20_793 | 250 |
| 536 | 3300050508 | nmdc:mga09592_5396_c1 | nmdc:mga09592_5396_c1_9174_9929 | 250 |
| 537 | 3300050508 | nmdc:mga09592_69229_c1 | nmdc:mga09592_69229_c1_309_1061 | 250 |
| 538 | 3300050509 | nmdc:mga0qj67_197117_c1 | nmdc:mga0qj67_197117_c1_382_1137 | 250 |
| 539 | 3300050509 | nmdc:mga0qj67_31067_c1 | nmdc:mga0qj67_31067_c1_3210_3965 | 250 |
| 540 | 3300050510 | nmdc:mga06r32_148498_c1 | nmdc:mga06r32_148498_c1_358_1119 | 250 |
| 541 | 3300050511 | nmdc:mga08y16_99058_c1 | nmdc:mga08y16_99058_c1_1620_2375 | 250 |
| 542 | 3300050512 | nmdc:mga0n895_1677_c1 | nmdc:mga0n895_1677_c1_11412_12173 | 250 |
| 543 | 3300050512 | nmdc:mga0n895_26066_c1 | nmdc:mga0n895_26066_c1_1864_2616 | 250 |
| 544 | 3300050512 | nmdc:mga0n895_31878_c1 | nmdc:mga0n895_31878_c1_2540_3316 | 250 |
| 545 | 3300050512 | nmdc:mga0n895_436728_c1 | nmdc:mga0n895_436728_c1_368_1126 | 250 |
| 546 | 3300050512 | nmdc:mga0n895_78649_c1 | nmdc:mga0n895_78649_c1_2306_3067 | 250 |
| 547 | 3300050513 | nmdc:mga0rr50_171814_c1 | nmdc:mga0rr50_171814_c1_240_998 | 250 |
| 548 | 3300050513 | nmdc:mga0rr50_18124_c1 | nmdc:mga0rr50_18124_c1_1290_2051 | 250 |
| 549 | 3300050513 | nmdc:mga0rr50_44095_c1 | nmdc:mga0rr50_44095_c1_1843_2619 | 250 |
| 550 | 3300050514 | nmdc:mga08x19_169658_c1 | nmdc:mga08x19_169658_c1_549_1310 | 250 |
| 551 | 3300050514 | nmdc:mga08x19_216214_c1 | nmdc:mga08x19_216214_c1_337_1089 | 250 |
| 552 | 3300050514 | nmdc:mga08x19_22629_c1 | nmdc:mga08x19_22629_c1_770_1528 | 250 |
| 553 | 3300050514 | nmdc:mga08x19_48739_c1 | nmdc:mga08x19_48739_c1_1483_2244 | 250 |
| 554 | 3300050514 | nmdc:mga08x19_74331_c1 | nmdc:mga08x19_74331_c1_280_1056 | 250 |
| 555 | 3300050514 | nmdc:mga08x19_9469_c1 | nmdc:mga08x19_9469_c1_865_1626 | 250 |
| 556 | 3300050515 | nmdc:mga0a205_105201_c1 | nmdc:mga0a205_105201_c1_1917_2669 | 250 |
| 557 | 3300050515 | nmdc:mga0a205_114875_c2 | nmdc:mga0a205_114875_c2_81_833 | 250 |
| 558 | 3300050515 | nmdc:mga0a205_169520_c1 | nmdc:mga0a205_169520_c1_749_1501 | 250 |
| 559 | 3300050515 | nmdc:mga0a205_20540_c1 | nmdc:mga0a205_20540_c1_2754_3506 | 250 |
| 560 | 3300050515 | nmdc:mga0a205_67853_c1 | nmdc:mga0a205_67853_c1_1829_2581 | 250 |
| 561 | 3300054114 | Ga0501084_0019923 | Ga0501084_0019923_4651_5409 | 250 |
| 562 | 3300054114 | Ga0501084_0062580 | Ga0501084_0062580_1287_2039 | 250 |
| 563 | 3300054114 | Ga0501084_0127328 | Ga0501084_0127328_961_1725 | 250 |
| 564 | 3300054114 | Ga0501084_0180391 | Ga0501084_0180391_203_955 | 250 |
| 565 | 3300054114 | Ga0501084_0186501 | Ga0501084_0186501_957_1733 | 250 |
| 566 | 3300054114 | Ga0501084_0392109 | Ga0501084_0392109_18_779 | 250 |
| 567 | 3300059421 | Ga0590071_001007 | Ga0590071_001007_2521_3273 | 250 |
| 568 | 3300059421 | Ga0590071_002282 | Ga0590071_002282_3402_4154 | 250 |
| 569 | 3300059421 | Ga0590071_004274 | Ga0590071_004274_2541_3293 | 250 |
| 570 | 3300059424 | Ga0590075_017982 | Ga0590075_017982_485_1237 | 250 |
| 571 | 3300059426 | Ga0590077_022214 | Ga0590077_022214_364_1116 | 250 |
| 572 | 3300060353 | Ga0501082_0018050 | Ga0501082_0018050_2737_3495 | 250 |
| 573 | 3300060353 | Ga0501082_0037358 | Ga0501082_0037358_731_1483 | 250 |
| 574 | 3300060353 | Ga0501082_0049443 | Ga0501082_0049443_2726_3478 | 250 |
| 575 | 3300060353 | Ga0501082_0051060 | Ga0501082_0051060_974_1729 | 250 |
| 576 | 3300060353 | Ga0501082_0052999 | Ga0501082_0052999_454_1218 | 250 |
| 577 | 3300060353 | Ga0501082_0161650 | Ga0501082_0161650_629_1381 | 250 |
| 578 | 3300060353 | Ga0501082_0219164 | Ga0501082_0219164_444_1196 | 250 |
| 579 | 3300061734 | Ga0530510_0109229 | Ga0530510_0109229_804_1556 | 250 |
| 580 | 3300061734 | Ga0530510_0342836 | Ga0530510_0342836_54_806 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tb5-assembly3.cif.gz_C | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.974 | 3 | 249 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9572 | 1 | 250 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9564 | 1 | 248 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9534 | 1 | 250 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9522 | 1 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tb5C00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.974 | 3 | 249 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9737 | 13 | 126 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9572 | 1 | 250 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9567 | 1 | 248 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9534 | 1 | 250 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4VXI4-F1-model_v4 | M24 family metallopeptidase | 0.9926 | 1 | 147 |
GO:0005829
GO:0070006 |
| AF-A0A7Y4VXI4-F1-model_v4 | M24 family metallopeptidase | 0.986 | 1 | 147 |
GO:0005829
GO:0070006 |
| AF-A0A7C4H0N2-F1-model_v4 | M24 family metallopeptidase | 0.9785 | 1 | 160 |
GO:0005829
GO:0070006 |
| AF-A0A5E4CC99-F1-model_v4 | Peptidase M24 domain-containing protein | 0.9774 | 1 | 159 |
GO:0070006
|
| AF-A0A7X6VPR9-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9767 | 1 | 135 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar