F466012

General Info

Members Datasets Scaffolds Average Seq Length
580 270 1160 181

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0831982|Ga0501080_0831982_159_707
Length 174
Sequence MNALTPGGRIDESRPMTPVRIAVLTISDTRDEESDTSGHLLAERVKAAIVRDHIMEIREKVEAWAASGFIDVIVTTGGTGITGRDVTPEAVRPLLDKEIDGFSVVFHLVSYQSVGLSTLQSRALAGIVKGCFVFCLPGSNGAVKDGWDKVIAAQLDSRHNPCNMVELMPRLNEV

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0
Rhizoplane 7.07
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0831982 3300049742 Bacteria 808
2 rootH2_10013005 3300003320 Bacteria 23234
3 JGI25404J52841_10050461 3300003659 Bacteria 875
4 Ga0055531_10022698 3300003794 Bacteria 2380
5 JGI25405J52794_10006880 3300003911 Bacteria 2084
6 Ga0070676_10226533 3300005328 Bacteria 1237
7 Ga0068869_100040402 3300005334 Bacteria 3336
8 Ga0068869_100056211 3300005334 Bacteria 2870
9 Ga0070680_100033782 3300005336 Bacteria 4125
10 Ga0070680_100093765 3300005336 Bacteria 2488
11 Ga0070682_100003346 3300005337 Bacteria 8887
12 Ga0068868_100730303 3300005338 Bacteria 888
13 Ga0070689_100249280 3300005340 Bacteria 1465
14 Ga0070691_10113472 3300005341 Bacteria 1358
15 Ga0070691_10140242 3300005341 Bacteria 1231
16 Ga0070661_100000867 3300005344 Bacteria 21748
17 Ga0070661_100054238 3300005344 Bacteria 2936
18 Ga0070661_100644128 3300005344 Bacteria 860
19 Ga0070668_100026764 3300005347 Bacteria 4378
20 Ga0070668_100362070 3300005347 Bacteria 1230
21 Ga0070668_100585077 3300005347 Bacteria 975
22 Ga0070668_100857143 3300005347 Bacteria 810
23 Ga0070673_100067202 3300005364 Bacteria 2866
24 Ga0070659_100066489 3300005366 Bacteria 2856
25 Ga0070667_100029732 3300005367 Bacteria 4555
26 Ga0070703_10003804 3300005406 Bacteria 4273
27 Ga0070714_100014988 3300005435 Bacteria 6232
28 Ga0070711_100224078 3300005439 Bacteria 1463
29 Ga0070705_100000224 3300005440 Bacteria 33535
30 Ga0070705_100142218 3300005440 Bacteria 1580
31 Ga0070700_100028366 3300005441 Bacteria 3329
32 Ga0070700_100140994 3300005441 Bacteria 1638
33 Ga0070700_100280368 3300005441 Bacteria 1208
34 Ga0070700_100455133 3300005441 Bacteria 975
35 Ga0070694_100002020 3300005444 Bacteria 12041
36 Ga0070694_100060998 3300005444 Bacteria 2573
37 Ga0070708_100050926 3300005445 Bacteria 3668
38 Ga0070663_100001638 3300005455 Bacteria 12359
39 Ga0070663_100526406 3300005455 Bacteria 985
40 Ga0070678_100282190 3300005456 Bacteria 1405
41 Ga0070678_100618910 3300005456 Bacteria 968
42 Ga0070662_100533192 3300005457 Bacteria 982
43 Ga0070681_10000010 3300005458 Bacteria 140126
44 Ga0070681_10012018 3300005458 Bacteria 8585
45 Ga0070681_10037186 3300005458 Bacteria 4886
46 Ga0070699_100001391 3300005518 Bacteria 22232
47 Ga0070679_100000279 3300005530 Bacteria 43122
48 Ga0070679_100148894 3300005530 Bacteria 2318
49 Ga0070697_100024491 3300005536 Bacteria 4804
50 Ga0070697_100435716 3300005536 Bacteria 1140
51 Ga0068853_100001493 3300005539 Bacteria 16998
52 Ga0068853_100024396 3300005539 Bacteria 5070
53 Ga0070686_100295461 3300005544 Bacteria 1200
54 Ga0070695_100003674 3300005545 Bacteria 8936
55 Ga0070695_100010639 3300005545 Bacteria 5499
56 Ga0070695_100030800 3300005545 Bacteria 3341
57 Ga0070696_100006986 3300005546 Bacteria 7533
58 Ga0070696_100066200 3300005546 Bacteria 2533
59 Ga0070696_100396223 3300005546 Bacteria 1079
60 Ga0070693_100019257 3300005547 Bacteria 3575
61 Ga0070693_100832190 3300005547 Bacteria 686
62 Ga0070665_100066440 3300005548 Bacteria 3618
63 Ga0070704_100000778 3300005549 Bacteria 15756
64 Ga0070704_100041161 3300005549 Bacteria 3187
65 Ga0070704_100120638 3300005549 Bacteria 2014
66 Ga0070704_100501576 3300005549 Bacteria 1053
67 Ga0068855_100000075 3300005563 Bacteria 119094
68 Ga0068855_100076679 3300005563 Bacteria 3879
69 Ga0068857_100032147 3300005577 Bacteria 4639
70 Ga0068857_100072359 3300005577 Bacteria 3072
71 Ga0068854_100280072 3300005578 Bacteria 1342
72 Ga0068854_100406299 3300005578 Bacteria 1128
73 Ga0068856_100114666 3300005614 Bacteria 2694
74 Ga0070702_100062235 3300005615 Bacteria 2175
75 Ga0068852_100015955 3300005616 Bacteria 5846
76 Ga0068852_100162369 3300005616 Bacteria 2087
77 Ga0068852_100234695 3300005616 Bacteria 1750
78 Ga0068859_100004561 3300005617 Bacteria 14129
79 Ga0068859_100214924 3300005617 Bacteria 2010
80 Ga0068864_100062024 3300005618 Bacteria 3239
81 Ga0068864_100299829 3300005618 Bacteria 1504
82 Ga0068861_100138385 3300005719 Bacteria 1984
83 Ga0068861_100497295 3300005719 Bacteria 1102
84 Ga0068870_10026645 3300005840 Bacteria 2883
85 Ga0068863_100154042 3300005841 Bacteria 2200
86 Ga0068858_100053944 3300005842 Bacteria 3718
87 Ga0068860_100009733 3300005843 Bacteria 9545
88 Ga0068860_100898180 3300005843 Bacteria 902
89 Ga0068862_100005310 3300005844 Bacteria 10791
90 Ga0068862_100037459 3300005844 Bacteria 4111
91 Ga0081455_10000042 3300005937 Bacteria 133329
92 Ga0081540_1000024 3300005983 Bacteria 158868
93 Ga0081539_10081764 3300005985 Bacteria 1695
94 Ga0075365_10002494 3300006038 Bacteria 9054
95 Ga0075365_10210941 3300006038 Bacteria 1361
96 Ga0075365_10254139 3300006038 Bacteria 1235
97 Ga0075365_10468603 3300006038 Bacteria 890
98 Ga0075365_10500515 3300006038 Bacteria 859
99 Ga0075368_10001381 3300006042 Bacteria 7738
100 Ga0075368_10007661 3300006042 Bacteria 3817
101 Ga0075368_10019918 3300006042 Bacteria 2536
102 Ga0075363_100012041 3300006048 Bacteria 4158
103 Ga0075363_100076800 3300006048 Bacteria 1822
104 Ga0075364_10000951 3300006051 Bacteria 15276
105 Ga0070712_100561129 3300006175 Bacteria 963
106 Ga0070712_100661445 3300006175 Unclassified 888
107 Ga0075367_10004628 3300006178 Bacteria 6740
108 Ga0075367_10024644 3300006178 Bacteria 3394
109 Ga0097621_100343628 3300006237 Bacteria 1325
110 Ga0097621_100576229 3300006237 Bacteria 1027
111 Ga0075428_100045313 3300006844 Bacteria 4832
112 Ga0075428_100127919 3300006844 Bacteria 2764
113 Ga0075428_100161394 3300006844 Bacteria 2433
114 Ga0075430_100001848 3300006846 Bacteria 17313
115 Ga0075430_100077240 3300006846 Bacteria 2791
116 Ga0075430_100103287 3300006846 Bacteria 2379
117 Ga0075431_100004837 3300006847 Bacteria 13260
118 Ga0075431_100045202 3300006847 Bacteria 4540
119 Ga0075431_100054890 3300006847 Bacteria 4109
120 Ga0075431_100076125 3300006847 Bacteria 3463
121 Ga0075431_100335727 3300006847 Bacteria 1521
122 Ga0075431_100402140 3300006847 Bacteria 1370
123 Ga0075433_10008904 3300006852 Bacteria 8011
124 Ga0075433_10292063 3300006852 Bacteria 1444
125 Ga0075434_100003527 3300006871 Bacteria 13964
126 Ga0075434_100065641 3300006871 Bacteria 3615
127 Ga0075434_100452709 3300006871 Bacteria 1305
128 Ga0075429_100050149 3300006880 Bacteria 3632
129 Ga0068865_100216498 3300006881 Bacteria 1495
130 Ga0097620_100004561 3300006931 Bacteria 14129
131 Ga0097620_100214914 3300006931 Bacteria 2010
132 Ga0097620_100446631 3300006931 Bacteria 1389
133 Ga0075435_100008727 3300007076 Bacteria 7293
134 Ga0075435_100027119 3300007076 Bacteria 4477
135 Ga0075435_100172927 3300007076 Bacteria 1823
136 Ga0105240_10011593 3300009093 Bacteria 12268
137 Ga0111539_10020913 3300009094 Bacteria 8057
138 Ga0111539_10143584 3300009094 Bacteria 2794
139 Ga0111539_10160863 3300009094 Bacteria 2626
140 Ga0111539_10182734 3300009094 Bacteria 2449
141 Ga0111539_10676881 3300009094 Bacteria 1201
142 Ga0111539_11784833 3300009094 Bacteria 713
143 Ga0111539_11895893 3300009094 Bacteria 691
144 Ga0105245_10013710 3300009098 Bacteria 7061
145 Ga0114129_10021665 3300009147 Bacteria 9121
146 Ga0114129_10096148 3300009147 Bacteria 4101
147 Ga0114129_10134680 3300009147 Bacteria 3390
148 Ga0114129_10164597 3300009147 Bacteria 3028
149 Ga0114129_10282165 3300009147 Bacteria 2219
150 Ga0114129_10371970 3300009147 Bacteria 1889
151 Ga0114129_11372946 3300009147 Bacteria 873
152 Ga0105243_10131171 3300009148 Bacteria 2126
153 Ga0105243_10323557 3300009148 Bacteria 1406
154 Ga0105241_10057665 3300009174 Bacteria 2980
155 Ga0105241_10185684 3300009174 Bacteria 1728
156 Ga0105241_10376745 3300009174 Unclassified 1239
157 Ga0105248_10022013 3300009177 Bacteria 7063
158 Ga0105248_10324528 3300009177 Bacteria 1734
159 Ga0105248_10449511 3300009177 Bacteria 1452
160 Ga0105237_10033725 3300009545 Bacteria 5186
161 Ga0105237_10047575 3300009545 Bacteria 4312
162 Ga0105237_11108703 3300009545 Bacteria 798
163 Ga0105238_10026347 3300009551 Bacteria 5926
164 Ga0105238_10030338 3300009551 Bacteria 5503
165 Ga0105238_10605111 3300009551 Bacteria 1104
166 Ga0105249_10012282 3300009553 Bacteria 7546
167 Ga0105249_10188323 3300009553 Bacteria 2012
168 Ga0105249_10693084 3300009553 Bacteria 1078
169 Ga0099796_10173480 3300010159 Bacteria 862
170 Ga0105239_10003298 3300010375 Bacteria 19880
171 Ga0105239_10004412 3300010375 Bacteria 16840
172 Ga0105239_10216856 3300010375 Bacteria 2145
173 Ga0105246_10060137 3300011119 Bacteria 2639
174 Ga0105246_10985724 3300011119 Bacteria 762
175 Ga0157371_10304018 3300013102 Bacteria 1155
176 Ga0157370_10450312 3300013104 Bacteria 1183
177 Ga0157369_10188954 3300013105 Unclassified 2165
178 Ga0157369_10218565 3300013105 Bacteria 1995
179 Ga0157369_10590693 3300013105 Bacteria 1147
180 Ga0157374_10534044 3300013296 Bacteria 1180
181 Ga0157378_10097622 3300013297 Bacteria 2678
182 Ga0157378_10441758 3300013297 Bacteria 1290
183 Ga0157378_10588499 3300013297 Bacteria 1122
184 Ga0163162_10392262 3300013306 Bacteria 1521
185 Ga0163162_10432244 3300013306 Bacteria 1449
186 Ga0163162_11268762 3300013306 Bacteria 837
187 Ga0157375_10137493 3300013308 Bacteria 2568
188 Ga0163163_10096578 3300014325 Bacteria 2975
189 Ga0157380_10195520 3300014326 Bacteria 1790
190 Ga0157380_12079829 3300014326 Bacteria 630
191 Ga0157377_10628236 3300014745 Bacteria 770
192 Ga0157379_10041861 3300014968 Bacteria 4089
193 Ga0213876_10001080 3300021384 Bacteria 17502
194 Ga0209050_1013996 3300025298 Bacteria 3504
195 Ga0209257_1000507 3300025304 Bacteria 68362
196 Ga0207653_10004121 3300025885 Bacteria 4570
197 Ga0207647_10028820 3300025904 Bacteria 3601
198 Ga0207647_10371272 3300025904 Bacteria 808
199 Ga0207645_10527641 3300025907 Bacteria 800
200 Ga0207643_10061083 3300025908 Bacteria 2152
201 Ga0207654_10060940 3300025911 Bacteria 2206
202 Ga0207707_10000005 3300025912 Bacteria 382024
203 Ga0207707_10209296 3300025912 Bacteria 1699
204 Ga0207695_10000018 3300025913 Bacteria 766611
205 Ga0207695_10107394 3300025913 Bacteria 2776
206 Ga0207671_10052212 3300025914 Bacteria 3029
207 Ga0207671_10473866 3300025914 Bacteria 998
208 Ga0207660_10001258 3300025917 Bacteria 16992
209 Ga0207660_10024868 3300025917 Bacteria 4058
210 Ga0207660_10360432 3300025917 Bacteria 1166
211 Ga0207649_10000140 3300025920 Bacteria 60523
212 Ga0207649_10048858 3300025920 Bacteria 2610
213 Ga0207649_10529039 3300025920 Bacteria 900
214 Ga0207652_10000068 3300025921 Bacteria 110287
215 Ga0207652_10101551 3300025921 Bacteria 2541
216 Ga0207652_10192654 3300025921 Bacteria 1834
217 Ga0207694_10000018 3300025924 Bacteria 331281
218 Ga0207694_10488995 3300025924 Bacteria 1030
219 Ga0207664_10008518 3300025929 Bacteria 7160
220 Ga0207690_10376593 3300025932 Bacteria 1127
221 Ga0207706_10628767 3300025933 Bacteria 921
222 Ga0207706_11268283 3300025933 Bacteria 610
223 Ga0207686_10024850 3300025934 Bacteria 3477
224 Ga0207709_10177552 3300025935 Bacteria 1501
225 Ga0207711_10000002 3300025941 Bacteria 1228676
226 Ga0207711_10082949 3300025941 Bacteria 2803
227 Ga0207689_10203104 3300025942 Bacteria 1636
228 Ga0207661_10547527 3300025944 Bacteria 1060
229 Ga0207667_10000052 3300025949 Bacteria 232415
230 Ga0207712_10025917 3300025961 Bacteria 3900
231 Ga0207712_10578098 3300025961 Bacteria 969
232 Ga0207712_11231463 3300025961 Bacteria 668
233 Ga0207668_10184489 3300025972 Bacteria 1648
234 Ga0207668_10683028 3300025972 Bacteria 901
235 Ga0207668_11058568 3300025972 Bacteria 726
236 Ga0207640_10147401 3300025981 Bacteria 1724
237 Ga0207658_10059612 3300025986 Bacteria 2845
238 Ga0207658_10150462 3300025986 Bacteria 1896
239 Ga0207677_11117662 3300026023 Bacteria 719
240 Ga0207703_10128724 3300026035 Bacteria 2183
241 Ga0207639_10001596 3300026041 Bacteria 15237
242 Ga0207639_10005640 3300026041 Bacteria 8470
243 Ga0207678_10000049 3300026067 Bacteria 90312
244 Ga0207678_10550299 3300026067 Bacteria 1009
245 Ga0207678_10973729 3300026067 Bacteria 751
246 Ga0207708_10005027 3300026075 Bacteria 9751
247 Ga0207708_10083641 3300026075 Bacteria 2453
248 Ga0207708_10252820 3300026075 Bacteria 1421
249 Ga0207708_10636449 3300026075 Bacteria 907
250 Ga0207702_10310097 3300026078 Bacteria 1500
251 Ga0207676_10042370 3300026095 Bacteria 3501
252 Ga0207674_10004362 3300026116 Bacteria 17059
253 Ga0207674_10089260 3300026116 Bacteria 3075
254 Ga0207675_100077506 3300026118 Bacteria 3114
255 Ga0207675_100176845 3300026118 Bacteria 2042
256 Ga0207698_10176157 3300026142 Bacteria 1889
257 Ga0207698_10342408 3300026142 Bacteria 1409
258 Ga0209813_10000632 3300027866 Bacteria 8162
259 Ga0209813_10008774 3300027866 Bacteria 2564
260 Ga0209813_10011224 3300027866 Bacteria 2337
261 Ga0209813_10055441 3300027866 Bacteria 1252
262 Ga0207428_10053823 3300027907 Bacteria 3208
263 Ga0207428_10337161 3300027907 Bacteria 1111
264 Ga0207428_10397171 3300027907 Bacteria 1010
265 Ga0268265_10002496 3300028380 Bacteria 13801
266 Ga0268265_10043707 3300028380 Bacteria 3332
267 Ga0268264_10002241 3300028381 Bacteria 17148
268 Ga0268264_10239806 3300028381 Bacteria 1679
269 Ga0268264_10489284 3300028381 Bacteria 1198
270 Ga0268264_10954521 3300028381 Bacteria 863
271 Ga0265319_1218362 3300028563 Bacteria 583
272 Ga0265318_10000080 3300028577 Bacteria 86276
273 Ga0265338_10000005 3300028800 Bacteria 571137
274 Ga0265338_10020148 3300028800 Bacteria 7031
275 Ga0265338_10039736 3300028800 Bacteria 4433
276 Ga0265332_10252524 3300031238 Bacteria 729
277 Ga0265320_10001529 3300031240 Bacteria 16781
278 Ga0265320_10096873 3300031240 Bacteria 1362
279 Ga0265320_10290723 3300031240 Bacteria 723
280 Ga0265325_10000010 3300031241 Bacteria 172391
281 Ga0265325_10012372 3300031241 Bacteria 4881
282 Ga0265325_10026319 3300031241 Bacteria 3151
283 Ga0265340_10075575 3300031247 Bacteria 1592
284 Ga0265340_10260283 3300031247 Bacteria 772
285 Ga0265339_10001636 3300031249 Bacteria 16530
286 Ga0265339_10008299 3300031249 Bacteria 6616
287 Ga0265339_10021899 3300031249 Bacteria 3709
288 Ga0265339_10274548 3300031249 Bacteria 810
289 Ga0265331_10000106 3300031250 Bacteria 113406
290 Ga0265331_10004552 3300031250 Bacteria 8640
291 Ga0265327_10000176 3300031251 Bacteria 137002
292 Ga0265316_10040300 3300031344 Bacteria 3745
293 Ga0307513_10033926 3300031456 Bacteria 5732
294 Ga0307513_10497952 3300031456 Bacteria 936
295 Ga0265313_10008129 3300031595 Bacteria 7018
296 Ga0265313_10030393 3300031595 Bacteria 2782
297 Ga0265313_10110922 3300031595 Bacteria 1206
298 Ga0265314_10009987 3300031711 Bacteria 7963
299 Ga0265314_10020888 3300031711 Bacteria 5047
300 Ga0265314_10042864 3300031711 Bacteria 3223
301 Ga0265314_10054762 3300031711 Bacteria 2759
302 Ga0265314_10096203 3300031711 Bacteria 1916
303 Ga0265342_10082338 3300031712 Bacteria 1857
304 Ga0316576_10631785 3300031727 Bacteria 780
305 Ga0307516_10066046 3300031730 Bacteria 3491
306 Ga0307516_10324422 3300031730 Bacteria 1210
307 Ga0307413_10597366 3300031824 Bacteria 903
308 Ga0307409_100107817 3300031995 Bacteria 2328
309 Ga0307510_10183592 3300033180 Bacteria 1651
310 Ga0373930_0032877 3300034816 Bacteria 1074
311 Ga0373950_0016357 3300034818 Bacteria 1268
312 Ga0373958_0004869 3300034819 Bacteria 2010
313 Ga0373938_0039189 3300034957 Bacteria 1047
314 Ga0373949_0091729 3300035090 Bacteria 822
315 Ga0373952_0137463 3300035092 Bacteria 676
316 Ga0373952_0159938 3300035092 Bacteria 637
317 Ga0373932_0007189 3300035112 Bacteria 2646
318 Ga0373936_0033840 3300035113 Bacteria 2028
319 Ga0373939_0023358 3300035114 Bacteria 1712
320 Ga0373941_0009288 3300035115 Bacteria 2471
321 Ga0373941_0075871 3300035115 Bacteria 1126
322 Ga0373941_0330314 3300035115 Bacteria 615
323 Ga0373945_0025213 3300035116 Bacteria 2065
324 Ga0373945_0333798 3300035116 Bacteria 655
325 Ga0373960_0025893 3300035121 Bacteria 1598
326 Ga0373943_0055616 3300035170 Bacteria 1961
327 Ga0373943_0630376 3300035170 Bacteria 633
328 Ga0373942_0037672 3300035207 Bacteria 1308
329 Ga0373942_0095377 3300035207 Bacteria 902
330 Ga0373962_0013526 3300035242 Bacteria 2069
331 Ga0316574_0066654 3300035398 Bacteria 2269
332 Ga0316574_0396225 3300035398 Bacteria 870
333 Ga0373931_0004237 3300035691 Bacteria 6525
334 Ga0373931_0006463 3300035691 Bacteria 5479
335 Ga0373931_0865494 3300035691 Bacteria 606
336 Ga0373935_0007063 3300035692 Bacteria 6704
337 Ga0373927_0299398 3300035695 Bacteria 1058
338 Ga0373947_0022735 3300035725 Bacteria 3639
339 Ga0373947_0708624 3300035725 Bacteria 687
340 Ga0373937_0088979 3300036401 Bacteria 2859
341 Ga0373937_0313597 3300036401 Bacteria 1484
342 Ga0373937_0324549 3300036401 Bacteria 1457
343 Ga0373937_0972318 3300036401 Bacteria 798
344 Ga0373925_0068710 3300037068 Bacteria 2675
345 Ga0395900_0032223 3300037418 Bacteria 5388
346 Ga0395900_0254571 3300037418 Bacteria 1756
347 Ga0395898_0508863 3300037466 Bacteria 1145
348 Ga0395905_0365966 3300037471 Bacteria 1335
349 Ga0436365_1338454 3300039437 Bacteria 115168
350 Ga0436365_1687382 3300039437 Bacteria 1082
351 Ga0436363_1665465 3300039450 Bacteria 3212
352 Ga0439448_0262118 3300042005 Unclassified 611
353 Ga0495629_0365178 3300046459 Bacteria 983
354 Ga0495629_0661645 3300046459 Bacteria 695
355 Ga0495638_0355434 3300046460 Bacteria 772
356 Ga0495580_0003737 3300046472 Bacteria 12895
357 Ga0495582_0034226 3300046473 Bacteria 2793
358 Ga0495584_0022078 3300046491 Bacteria 3230
359 Ga0495628_0763090 3300046516 Bacteria 679
360 Ga0495652_0063797 3300046529 Bacteria 3101
361 Ga0495652_0646093 3300046529 Bacteria 717
362 Ga0495665_0137667 3300046531 Bacteria 1277
363 Ga0495625_0079964 3300046660 Bacteria 2278
364 Ga0495658_0001801 3300046683 Bacteria 11009
365 Ga0495613_0119180 3300046689 Bacteria 1896
366 Ga0495600_0490782 3300046809 Bacteria 756
367 Ga0495675_0012967 3300047444 Bacteria 5255
368 Ga0495686_0012151 3300047472 Bacteria 6039
369 Ga0496100_0090940 3300048903 Bacteria 2082
370 Ga0496100_0094580 3300048903 Bacteria 2047
371 Ga0496102_0012878 3300048905 Bacteria 7240
372 Ga0496102_0073736 3300048905 Bacteria 3136
373 Ga0496102_0354578 3300048905 Bacteria 1381
374 Ga0496102_0454271 3300048905 Bacteria 1202
375 Ga0496102_1288232 3300048905 Bacteria 650
376 Ga0496102_1487497 3300048905 Bacteria 596
377 Ga0496103_0063770 3300048906 Bacteria 2296
378 Ga0496103_0164736 3300048906 Bacteria 1422
379 Ga0496104_0000986 3300048907 Bacteria 24328
380 Ga0496104_0237194 3300048907 Bacteria 1736
381 Ga0496104_0989417 3300048907 Bacteria 745
382 Ga0496105_0001992 3300048908 Bacteria 14727
383 Ga0496105_0134394 3300048908 Bacteria 2038
384 Ga0496105_0542417 3300048908 Bacteria 909
385 Ga0496106_0007199 3300048909 Bacteria 8220
386 Ga0496106_0008109 3300048909 Bacteria 7759
387 Ga0496106_0028593 3300048909 Bacteria 4153
388 Ga0496106_1067009 3300048909 Bacteria 634
389 Ga0496107_0000948 3300048910 Bacteria 17175
390 Ga0496107_0008842 3300048910 Bacteria 6978
391 Ga0496107_0268684 3300048910 Bacteria 1269
392 Ga0496107_0658105 3300048910 Bacteria 772
393 Ga0496108_0000580 3300048911 Bacteria 28602
394 Ga0496109_0021409 3300048912 Bacteria 5716
395 Ga0496109_0056583 3300048912 Bacteria 3579
396 Ga0496109_0197360 3300048912 Bacteria 1892
397 Ga0496109_0253030 3300048912 Bacteria 1659
398 Ga0496109_0877232 3300048912 Bacteria 835
399 Ga0496110_0034958 3300048913 Bacteria 4356
400 Ga0496111_0031282 3300048914 Bacteria 3791
401 Ga0496112_0009704 3300048915 Bacteria 8690
402 Ga0496112_0098450 3300048915 Bacteria 2894
403 Ga0496113_0114617 3300048916 Bacteria 2102
404 Ga0496113_0119609 3300048916 Bacteria 2058
405 Ga0496113_0367972 3300048916 Bacteria 1154
406 Ga0496114_0908084 3300048917 Bacteria 762
407 Ga0496115_0009742 3300048918 Bacteria 7155
408 Ga0496115_0354660 3300048918 Bacteria 1196
409 Ga0496115_0537622 3300048918 Bacteria 935
410 Ga0496126_0007829 3300048929 Bacteria 11645
411 Ga0495682_0001327 3300049460 Bacteria 13727
412 Ga0501031_0034746 3300049568 Bacteria 3290
413 Ga0501031_0277004 3300049568 Bacteria 1089
414 Ga0501031_0528594 3300049568 Bacteria 760
415 Ga0501033_0004839 3300049570 Bacteria 10735
416 Ga0501033_0247151 3300049570 Bacteria 1265
417 Ga0501033_0579997 3300049570 Bacteria 770
418 Ga0501034_0000014 3300049571 Bacteria 297798
419 Ga0501034_0015363 3300049571 Bacteria 7868
420 Ga0501034_0022841 3300049571 Bacteria 6372
421 Ga0501034_0031273 3300049571 Bacteria 5407
422 Ga0501034_0069668 3300049571 Bacteria 3528
423 Ga0501036_0018691 3300049572 Bacteria 5812
424 Ga0501036_0035431 3300049572 Bacteria 4224
425 Ga0501036_0129297 3300049572 Bacteria 2133
426 Ga0501036_0314036 3300049572 Bacteria 1310
427 Ga0501036_0418114 3300049572 Bacteria 1118
428 Ga0501037_0001233 3300049573 Bacteria 18867
429 Ga0501037_0065157 3300049573 Bacteria 2655
430 Ga0501037_0078461 3300049573 Bacteria 2396
431 Ga0501038_0003150 3300049574 Bacteria 15402
432 Ga0501038_0357202 3300049574 Bacteria 1137
433 Ga0501039_0000946 3300049575 Bacteria 21119
434 Ga0501039_0097012 3300049575 Bacteria 2299
435 Ga0501039_0108290 3300049575 Bacteria 2172
436 Ga0501039_0194101 3300049575 Bacteria 1596
437 Ga0501039_0194620 3300049575 Bacteria 1594
438 Ga0501039_0634059 3300049575 Bacteria 837
439 Ga0501040_0070034 3300049576 Bacteria 2420
440 Ga0501040_0146426 3300049576 Bacteria 1665
441 Ga0501040_0282384 3300049576 Bacteria 1186
442 Ga0501040_0323635 3300049576 Bacteria 1103
443 Ga0501040_0388874 3300049576 Bacteria 1001
444 Ga0501040_0647225 3300049576 Bacteria 764
445 Ga0501041_0089810 3300049577 Bacteria 1897
446 Ga0501041_0333695 3300049577 Bacteria 957
447 Ga0501041_0333901 3300049577 Bacteria 957
448 Ga0501042_0403831 3300049578 Bacteria 990
449 Ga0501042_0775031 3300049578 Bacteria 698
450 Ga0501043_0046933 3300049579 Bacteria 3396
451 Ga0501043_0052766 3300049579 Bacteria 3193
452 Ga0501046_0000010 3300049580 Bacteria 331082
453 Ga0501046_0003648 3300049580 Bacteria 14106
454 Ga0501046_0077216 3300049580 Bacteria 2579
455 Ga0501046_0860878 3300049580 Bacteria 633
456 Ga0501047_0000291 3300049581 Bacteria 57615
457 Ga0501047_0002698 3300049581 Bacteria 16892
458 Ga0501047_0029747 3300049581 Bacteria 5265
459 Ga0501047_0078257 3300049581 Bacteria 3180
460 Ga0501047_0116941 3300049581 Bacteria 2547
461 Ga0501047_0121458 3300049581 Bacteria 2494
462 Ga0501047_0509851 3300049581 Bacteria 1029
463 Ga0501048_0000161 3300049582 Bacteria 41736
464 Ga0501048_0116146 3300049582 Bacteria 1891
465 Ga0501048_0198410 3300049582 Bacteria 1422
466 Ga0501067_0004178 3300049583 Bacteria 7969
467 Ga0501067_0015793 3300049583 Bacteria 4177
468 Ga0501067_0028573 3300049583 Bacteria 3090
469 Ga0501067_0052911 3300049583 Bacteria 2250
470 Ga0501067_0194275 3300049583 Bacteria 1131
471 Ga0501068_0133367 3300049584 Bacteria 1554
472 Ga0501069_0038732 3300049585 Bacteria 2632
473 Ga0501070_0010673 3300049586 Bacteria 7768
474 Ga0501070_0057347 3300049586 Bacteria 3228
475 Ga0501070_0176684 3300049586 Unclassified 1758
476 Ga0501070_0400439 3300049586 Bacteria 1110
477 Ga0501071_0710760 3300049587 Bacteria 774
478 Ga0501072_0014375 3300049588 Bacteria 6068
479 Ga0501073_0007729 3300049589 Bacteria 7979
480 Ga0501073_0044286 3300049589 Bacteria 3136
481 Ga0501073_0063508 3300049589 Bacteria 2576
482 Ga0501073_0064017 3300049589 Bacteria 2564
483 Ga0501073_0137207 3300049589 Bacteria 1695
484 Ga0501073_0351616 3300049589 Unclassified 1017
485 Ga0501074_0015765 3300049590 Bacteria 5494
486 Ga0501074_0395589 3300049590 Bacteria 980
487 Ga0501075_0173789 3300049591 Bacteria 1644
488 Ga0501075_1004865 3300049591 Bacteria 634
489 Ga0501076_0011005 3300049592 Bacteria 6727
490 Ga0501076_0215874 3300049592 Bacteria 1568
491 Ga0501077_0005197 3300049593 Bacteria 7908
492 Ga0501077_0096240 3300049593 Bacteria 1876
493 Ga0501077_0214569 3300049593 Bacteria 1223
494 Ga0501077_0473630 3300049593 Bacteria 802
495 Ga0501079_0003853 3300049741 Bacteria 11068
496 Ga0501079_0022166 3300049741 Bacteria 4868
497 Ga0501079_0090579 3300049741 Bacteria 2369
498 Ga0501080_0000258 3300049742 Bacteria 40073
499 Ga0501080_0007235 3300049742 Bacteria 10019
500 Ga0501080_0045369 3300049742 Bacteria 4091
501 Ga0501080_0084580 3300049742 Bacteria 2947
502 Ga0501081_0053464 3300049743 Bacteria 2788
503 Ga0501081_0066097 3300049743 Bacteria 2514
504 Ga0501081_0144762 3300049743 Bacteria 1705
505 Ga0501081_0424368 3300049743 Bacteria 986
506 Ga0501083_0207489 3300049744 Bacteria 1278
507 Ga0501083_0275790 3300049744 Bacteria 1094
508 Ga0501083_0728190 3300049744 Bacteria 645
509 Ga0501035_0000034 3300049822 Bacteria 174589
510 Ga0501035_0019140 3300049822 Bacteria 6303
511 Ga0501044_0000039 3300049823 Bacteria 158218
512 Ga0501044_0003224 3300049823 Bacteria 18378
513 Ga0501044_0052524 3300049823 Bacteria 4199
514 Ga0501044_0103855 3300049823 Bacteria 2856
515 Ga0501044_0128848 3300049823 Bacteria 2525
516 Ga0501044_0353550 3300049823 Bacteria 1388
517 Ga0501044_0446589 3300049823 Bacteria 1200
518 Ga0501044_0778766 3300049823 Bacteria 837
519 Ga0501044_1165929 3300049823 Bacteria 639
520 nmdc:mga03n38_148343_c1 3300050490 Bacteria 1178
521 nmdc:mga03n38_25411_c1 3300050490 Bacteria 2432
522 nmdc:mga03n38_262271_c1 3300050490 Bacteria 916
523 nmdc:mga03n38_5042_c1 3300050490 Bacteria 4453
524 nmdc:mga00v17_8849_c1 3300050491 Bacteria 5428
525 nmdc:mga0yw44_160490_c1 3300050492 Bacteria 1471
526 nmdc:mga0yw44_431255_c1 3300050492 Bacteria 893
527 nmdc:mga0yw44_6243_c1 3300050492 Bacteria 5736
528 nmdc:mga06z11_2338_c1 3300050494 Bacteria 7222
529 nmdc:mga06z11_402816_c1 3300050494 Bacteria 824
530 nmdc:mga06z11_838_c1 3300050494 Bacteria 11265
531 nmdc:mga06z11_9935_c1 3300050494 Bacteria 4032
532 nmdc:mga04h51_144589_c1 3300050495 Bacteria 905
533 nmdc:mga04h51_1817_c1 3300050495 Bacteria 4994
534 nmdc:mga04h51_4013_c1 3300050495 Bacteria 3624
535 nmdc:mga05p37_22355_c2 3300050507 Bacteria 6953
536 nmdc:mga05p37_338823_c1 3300050507 Bacteria 1774
537 nmdc:mga09592_139149_c1 3300050508 Bacteria 2092
538 nmdc:mga0qj67_120523_c1 3300050509 Bacteria 2122
539 nmdc:mga06r32_1393_c1 3300050510 Bacteria 21841
540 nmdc:mga06r32_1442977_c1 3300050510 Bacteria 629
541 nmdc:mga06r32_1470696_c1 3300050510 Bacteria 622
542 nmdc:mga06r32_50527_c1 3300050510 Bacteria 3978
543 nmdc:mga06r32_7638_c1 3300050510 Bacteria 9724
544 nmdc:mga08y16_1072323_c1 3300050511 Bacteria 782
545 nmdc:mga08y16_293577_c1 3300050511 Bacteria 1676
546 nmdc:mga08y16_611431_c1 3300050511 Bacteria 1098
547 nmdc:mga08y16_658898_c1 3300050511 Bacteria 1050
548 nmdc:mga08y16_65973_c1 3300050511 Bacteria 3778
549 nmdc:mga08y16_71382_c1 3300050511 Bacteria 3619
550 nmdc:mga0n895_101051_c1 3300050512 Bacteria 2893
551 nmdc:mga0n895_1528874_c1 3300050512 Bacteria 633
552 nmdc:mga0n895_64926_c1 3300050512 Bacteria 3612
553 nmdc:mga0n895_76726_c1 3300050512 Bacteria 3323
554 nmdc:mga0rr50_20438_c1 3300050513 Bacteria 4497
555 nmdc:mga0rr50_27985_c1 3300050513 Bacteria 3956
556 nmdc:mga0rr50_95476_c1 3300050513 Bacteria 2324
557 nmdc:mga0a205_153027_c1 3300050515 Bacteria 2205
558 Ga0500641_0331732 3300053096 Bacteria 616
559 Ga0500556_0000878 3300053104 Bacteria 16909
560 Ga0500562_011122 3300053108 Bacteria 2284
561 Ga0500655_007717 3300053133 Bacteria 1937
562 Ga0500655_056379 3300053133 Bacteria 787
563 Ga0500616_0004900 3300053153 Bacteria 9315
564 Ga0500616_0012504 3300053153 Bacteria 4966
565 Ga0500616_0018403 3300053153 Bacteria 3950
566 Ga0500619_000679 3300053154 Bacteria 5801
567 Ga0500622_0025800 3300053156 Bacteria 3103
568 Ga0501084_0000016 3300054114 Bacteria 155919
569 Ga0501084_0002887 3300054114 Bacteria 13897
570 Ga0501084_0104190 3300054114 Bacteria 2383
571 Ga0501084_0267249 3300054114 Bacteria 1444
572 Ga0501082_0026126 3300060353 Bacteria 5033
573 Ga0501082_0174328 3300060353 Bacteria 1870
574 Ga0501082_0223604 3300060353 Bacteria 1638
575 Ga0501082_0296276 3300060353 Bacteria 1408
576 Ga0501082_0380798 3300060353 Bacteria 1231
577 Ga0530510_0073901 3300061734 Bacteria 2475
578 Ga0530510_0527760 3300061734 Bacteria 896
579 Ga0530510_0903600 3300061734 Bacteria 675
580 2898796865 2898795034 Bacteria 4294459
581 Ga0501080_0831982
582 rootH2_10013005
583 JGI25404J52841_10050461
584 Ga0055531_10022698
585 JGI25405J52794_10006880
586 Ga0070676_10226533
587 Ga0068869_100040402
588 Ga0068869_100056211
589 Ga0070680_100033782
590 Ga0070680_100093765
591 Ga0070682_100003346
592 Ga0068868_100730303
593 Ga0070689_100249280
594 Ga0070691_10113472
595 Ga0070691_10140242
596 Ga0070661_100000867
597 Ga0070661_100054238
598 Ga0070661_100644128
599 Ga0070668_100026764
600 Ga0070668_100362070
601 Ga0070668_100585077
602 Ga0070668_100857143
603 Ga0070673_100067202
604 Ga0070659_100066489
605 Ga0070667_100029732
606 Ga0070703_10003804
607 Ga0070714_100014988
608 Ga0070711_100224078
609 Ga0070705_100000224
610 Ga0070705_100142218
611 Ga0070700_100028366
612 Ga0070700_100140994
613 Ga0070700_100280368
614 Ga0070700_100455133
615 Ga0070694_100002020
616 Ga0070694_100060998
617 Ga0070708_100050926
618 Ga0070663_100001638
619 Ga0070663_100526406
620 Ga0070678_100282190
621 Ga0070678_100618910
622 Ga0070662_100533192
623 Ga0070681_10000010
624 Ga0070681_10012018
625 Ga0070681_10037186
626 Ga0070699_100001391
627 Ga0070679_100000279
628 Ga0070679_100148894
629 Ga0070697_100024491
630 Ga0070697_100435716
631 Ga0068853_100001493
632 Ga0068853_100024396
633 Ga0070686_100295461
634 Ga0070695_100003674
635 Ga0070695_100010639
636 Ga0070695_100030800
637 Ga0070696_100006986
638 Ga0070696_100066200
639 Ga0070696_100396223
640 Ga0070693_100019257
641 Ga0070693_100832190
642 Ga0070665_100066440
643 Ga0070704_100000778
644 Ga0070704_100041161
645 Ga0070704_100120638
646 Ga0070704_100501576
647 Ga0068855_100000075
648 Ga0068855_100076679
649 Ga0068857_100032147
650 Ga0068857_100072359
651 Ga0068854_100280072
652 Ga0068854_100406299
653 Ga0068856_100114666
654 Ga0070702_100062235
655 Ga0068852_100015955
656 Ga0068852_100162369
657 Ga0068852_100234695
658 Ga0068859_100004561
659 Ga0068859_100214924
660 Ga0068864_100062024
661 Ga0068864_100299829
662 Ga0068861_100138385
663 Ga0068861_100497295
664 Ga0068870_10026645
665 Ga0068863_100154042
666 Ga0068858_100053944
667 Ga0068860_100009733
668 Ga0068860_100898180
669 Ga0068862_100005310
670 Ga0068862_100037459
671 Ga0081455_10000042
672 Ga0081540_1000024
673 Ga0081539_10081764
674 Ga0075365_10002494
675 Ga0075365_10210941
676 Ga0075365_10254139
677 Ga0075365_10468603
678 Ga0075365_10500515
679 Ga0075368_10001381
680 Ga0075368_10007661
681 Ga0075368_10019918
682 Ga0075363_100012041
683 Ga0075363_100076800
684 Ga0075364_10000951
685 Ga0070712_100561129
686 Ga0070712_100661445
687 Ga0075367_10004628
688 Ga0075367_10024644
689 Ga0097621_100343628
690 Ga0097621_100576229
691 Ga0075428_100045313
692 Ga0075428_100127919
693 Ga0075428_100161394
694 Ga0075430_100001848
695 Ga0075430_100077240
696 Ga0075430_100103287
697 Ga0075431_100004837
698 Ga0075431_100045202
699 Ga0075431_100054890
700 Ga0075431_100076125
701 Ga0075431_100335727
702 Ga0075431_100402140
703 Ga0075433_10008904
704 Ga0075433_10292063
705 Ga0075434_100003527
706 Ga0075434_100065641
707 Ga0075434_100452709
708 Ga0075429_100050149
709 Ga0068865_100216498
710 Ga0097620_100004561
711 Ga0097620_100214914
712 Ga0097620_100446631
713 Ga0075435_100008727
714 Ga0075435_100027119
715 Ga0075435_100172927
716 Ga0105240_10011593
717 Ga0111539_10020913
718 Ga0111539_10143584
719 Ga0111539_10160863
720 Ga0111539_10182734
721 Ga0111539_10676881
722 Ga0111539_11784833
723 Ga0111539_11895893
724 Ga0105245_10013710
725 Ga0114129_10021665
726 Ga0114129_10096148
727 Ga0114129_10134680
728 Ga0114129_10164597
729 Ga0114129_10282165
730 Ga0114129_10371970
731 Ga0114129_11372946
732 Ga0105243_10131171
733 Ga0105243_10323557
734 Ga0105241_10057665
735 Ga0105241_10185684
736 Ga0105241_10376745
737 Ga0105248_10022013
738 Ga0105248_10324528
739 Ga0105248_10449511
740 Ga0105237_10033725
741 Ga0105237_10047575
742 Ga0105237_11108703
743 Ga0105238_10026347
744 Ga0105238_10030338
745 Ga0105238_10605111
746 Ga0105249_10012282
747 Ga0105249_10188323
748 Ga0105249_10693084
749 Ga0099796_10173480
750 Ga0105239_10003298
751 Ga0105239_10004412
752 Ga0105239_10216856
753 Ga0105246_10060137
754 Ga0105246_10985724
755 Ga0157371_10304018
756 Ga0157370_10450312
757 Ga0157369_10188954
758 Ga0157369_10218565
759 Ga0157369_10590693
760 Ga0157374_10534044
761 Ga0157378_10097622
762 Ga0157378_10441758
763 Ga0157378_10588499
764 Ga0163162_10392262
765 Ga0163162_10432244
766 Ga0163162_11268762
767 Ga0157375_10137493
768 Ga0163163_10096578
769 Ga0157380_10195520
770 Ga0157380_12079829
771 Ga0157377_10628236
772 Ga0157379_10041861
773 Ga0213876_10001080
774 Ga0209050_1013996
775 Ga0209257_1000507
776 Ga0207653_10004121
777 Ga0207647_10028820
778 Ga0207647_10371272
779 Ga0207645_10527641
780 Ga0207643_10061083
781 Ga0207654_10060940
782 Ga0207707_10000005
783 Ga0207707_10209296
784 Ga0207695_10000018
785 Ga0207695_10107394
786 Ga0207671_10052212
787 Ga0207671_10473866
788 Ga0207660_10001258
789 Ga0207660_10024868
790 Ga0207660_10360432
791 Ga0207649_10000140
792 Ga0207649_10048858
793 Ga0207649_10529039
794 Ga0207652_10000068
795 Ga0207652_10101551
796 Ga0207652_10192654
797 Ga0207694_10000018
798 Ga0207694_10488995
799 Ga0207664_10008518
800 Ga0207690_10376593
801 Ga0207706_10628767
802 Ga0207706_11268283
803 Ga0207686_10024850
804 Ga0207709_10177552
805 Ga0207711_10000002
806 Ga0207711_10082949
807 Ga0207689_10203104
808 Ga0207661_10547527
809 Ga0207667_10000052
810 Ga0207712_10025917
811 Ga0207712_10578098
812 Ga0207712_11231463
813 Ga0207668_10184489
814 Ga0207668_10683028
815 Ga0207668_11058568
816 Ga0207640_10147401
817 Ga0207658_10059612
818 Ga0207658_10150462
819 Ga0207677_11117662
820 Ga0207703_10128724
821 Ga0207639_10001596
822 Ga0207639_10005640
823 Ga0207678_10000049
824 Ga0207678_10550299
825 Ga0207678_10973729
826 Ga0207708_10005027
827 Ga0207708_10083641
828 Ga0207708_10252820
829 Ga0207708_10636449
830 Ga0207702_10310097
831 Ga0207676_10042370
832 Ga0207674_10004362
833 Ga0207674_10089260
834 Ga0207675_100077506
835 Ga0207675_100176845
836 Ga0207698_10176157
837 Ga0207698_10342408
838 Ga0209813_10000632
839 Ga0209813_10008774
840 Ga0209813_10011224
841 Ga0209813_10055441
842 Ga0207428_10053823
843 Ga0207428_10337161
844 Ga0207428_10397171
845 Ga0268265_10002496
846 Ga0268265_10043707
847 Ga0268264_10002241
848 Ga0268264_10239806
849 Ga0268264_10489284
850 Ga0268264_10954521
851 Ga0265319_1218362
852 Ga0265318_10000080
853 Ga0265338_10000005
854 Ga0265338_10020148
855 Ga0265338_10039736
856 Ga0265332_10252524
857 Ga0265320_10001529
858 Ga0265320_10096873
859 Ga0265320_10290723
860 Ga0265325_10000010
861 Ga0265325_10012372
862 Ga0265325_10026319
863 Ga0265340_10075575
864 Ga0265340_10260283
865 Ga0265339_10001636
866 Ga0265339_10008299
867 Ga0265339_10021899
868 Ga0265339_10274548
869 Ga0265331_10000106
870 Ga0265331_10004552
871 Ga0265327_10000176
872 Ga0265316_10040300
873 Ga0307513_10033926
874 Ga0307513_10497952
875 Ga0265313_10008129
876 Ga0265313_10030393
877 Ga0265313_10110922
878 Ga0265314_10009987
879 Ga0265314_10020888
880 Ga0265314_10042864
881 Ga0265314_10054762
882 Ga0265314_10096203
883 Ga0265342_10082338
884 Ga0316576_10631785
885 Ga0307516_10066046
886 Ga0307516_10324422
887 Ga0307413_10597366
888 Ga0307409_100107817
889 Ga0307510_10183592
890 Ga0373930_0032877
891 Ga0373950_0016357
892 Ga0373958_0004869
893 Ga0373938_0039189
894 Ga0373949_0091729
895 Ga0373952_0137463
896 Ga0373952_0159938
897 Ga0373932_0007189
898 Ga0373936_0033840
899 Ga0373939_0023358
900 Ga0373941_0009288
901 Ga0373941_0075871
902 Ga0373941_0330314
903 Ga0373945_0025213
904 Ga0373945_0333798
905 Ga0373960_0025893
906 Ga0373943_0055616
907 Ga0373943_0630376
908 Ga0373942_0037672
909 Ga0373942_0095377
910 Ga0373962_0013526
911 Ga0316574_0066654
912 Ga0316574_0396225
913 Ga0373931_0004237
914 Ga0373931_0006463
915 Ga0373931_0865494
916 Ga0373935_0007063
917 Ga0373927_0299398
918 Ga0373947_0022735
919 Ga0373947_0708624
920 Ga0373937_0088979
921 Ga0373937_0313597
922 Ga0373937_0324549
923 Ga0373937_0972318
924 Ga0373925_0068710
925 Ga0395900_0032223
926 Ga0395900_0254571
927 Ga0395898_0508863
928 Ga0395905_0365966
929 Ga0436365_1338454
930 Ga0436365_1687382
931 Ga0436363_1665465
932 Ga0439448_0262118
933 Ga0495629_0365178
934 Ga0495629_0661645
935 Ga0495638_0355434
936 Ga0495580_0003737
937 Ga0495582_0034226
938 Ga0495584_0022078
939 Ga0495628_0763090
940 Ga0495652_0063797
941 Ga0495652_0646093
942 Ga0495665_0137667
943 Ga0495625_0079964
944 Ga0495658_0001801
945 Ga0495613_0119180
946 Ga0495600_0490782
947 Ga0495675_0012967
948 Ga0495686_0012151
949 Ga0496100_0090940
950 Ga0496100_0094580
951 Ga0496102_0012878
952 Ga0496102_0073736
953 Ga0496102_0354578
954 Ga0496102_0454271
955 Ga0496102_1288232
956 Ga0496102_1487497
957 Ga0496103_0063770
958 Ga0496103_0164736
959 Ga0496104_0000986
960 Ga0496104_0237194
961 Ga0496104_0989417
962 Ga0496105_0001992
963 Ga0496105_0134394
964 Ga0496105_0542417
965 Ga0496106_0007199
966 Ga0496106_0008109
967 Ga0496106_0028593
968 Ga0496106_1067009
969 Ga0496107_0000948
970 Ga0496107_0008842
971 Ga0496107_0268684
972 Ga0496107_0658105
973 Ga0496108_0000580
974 Ga0496109_0021409
975 Ga0496109_0056583
976 Ga0496109_0197360
977 Ga0496109_0253030
978 Ga0496109_0877232
979 Ga0496110_0034958
980 Ga0496111_0031282
981 Ga0496112_0009704
982 Ga0496112_0098450
983 Ga0496113_0114617
984 Ga0496113_0119609
985 Ga0496113_0367972
986 Ga0496114_0908084
987 Ga0496115_0009742
988 Ga0496115_0354660
989 Ga0496115_0537622
990 Ga0496126_0007829
991 Ga0495682_0001327
992 Ga0501031_0034746
993 Ga0501031_0277004
994 Ga0501031_0528594
995 Ga0501033_0004839
996 Ga0501033_0247151
997 Ga0501033_0579997
998 Ga0501034_0000014
999 Ga0501034_0015363
1000 Ga0501034_0022841
1001 Ga0501034_0031273
1002 Ga0501034_0069668
1003 Ga0501036_0018691
1004 Ga0501036_0035431
1005 Ga0501036_0129297
1006 Ga0501036_0314036
1007 Ga0501036_0418114
1008 Ga0501037_0001233
1009 Ga0501037_0065157
1010 Ga0501037_0078461
1011 Ga0501038_0003150
1012 Ga0501038_0357202
1013 Ga0501039_0000946
1014 Ga0501039_0097012
1015 Ga0501039_0108290
1016 Ga0501039_0194101
1017 Ga0501039_0194620
1018 Ga0501039_0634059
1019 Ga0501040_0070034
1020 Ga0501040_0146426
1021 Ga0501040_0282384
1022 Ga0501040_0323635
1023 Ga0501040_0388874
1024 Ga0501040_0647225
1025 Ga0501041_0089810
1026 Ga0501041_0333695
1027 Ga0501041_0333901
1028 Ga0501042_0403831
1029 Ga0501042_0775031
1030 Ga0501043_0046933
1031 Ga0501043_0052766
1032 Ga0501046_0000010
1033 Ga0501046_0003648
1034 Ga0501046_0077216
1035 Ga0501046_0860878
1036 Ga0501047_0000291
1037 Ga0501047_0002698
1038 Ga0501047_0029747
1039 Ga0501047_0078257
1040 Ga0501047_0116941
1041 Ga0501047_0121458
1042 Ga0501047_0509851
1043 Ga0501048_0000161
1044 Ga0501048_0116146
1045 Ga0501048_0198410
1046 Ga0501067_0004178
1047 Ga0501067_0015793
1048 Ga0501067_0028573
1049 Ga0501067_0052911
1050 Ga0501067_0194275
1051 Ga0501068_0133367
1052 Ga0501069_0038732
1053 Ga0501070_0010673
1054 Ga0501070_0057347
1055 Ga0501070_0176684
1056 Ga0501070_0400439
1057 Ga0501071_0710760
1058 Ga0501072_0014375
1059 Ga0501073_0007729
1060 Ga0501073_0044286
1061 Ga0501073_0063508
1062 Ga0501073_0064017
1063 Ga0501073_0137207
1064 Ga0501073_0351616
1065 Ga0501074_0015765
1066 Ga0501074_0395589
1067 Ga0501075_0173789
1068 Ga0501075_1004865
1069 Ga0501076_0011005
1070 Ga0501076_0215874
1071 Ga0501077_0005197
1072 Ga0501077_0096240
1073 Ga0501077_0214569
1074 Ga0501077_0473630
1075 Ga0501079_0003853
1076 Ga0501079_0022166
1077 Ga0501079_0090579
1078 Ga0501080_0000258
1079 Ga0501080_0007235
1080 Ga0501080_0045369
1081 Ga0501080_0084580
1082 Ga0501081_0053464
1083 Ga0501081_0066097
1084 Ga0501081_0144762
1085 Ga0501081_0424368
1086 Ga0501083_0207489
1087 Ga0501083_0275790
1088 Ga0501083_0728190
1089 Ga0501035_0000034
1090 Ga0501035_0019140
1091 Ga0501044_0000039
1092 Ga0501044_0003224
1093 Ga0501044_0052524
1094 Ga0501044_0103855
1095 Ga0501044_0128848
1096 Ga0501044_0353550
1097 Ga0501044_0446589
1098 Ga0501044_0778766
1099 Ga0501044_1165929
1100 nmdc:mga03n38_148343_c1
1101 nmdc:mga03n38_25411_c1
1102 nmdc:mga03n38_262271_c1
1103 nmdc:mga03n38_5042_c1
1104 nmdc:mga00v17_8849_c1
1105 nmdc:mga0yw44_160490_c1
1106 nmdc:mga0yw44_431255_c1
1107 nmdc:mga0yw44_6243_c1
1108 nmdc:mga06z11_2338_c1
1109 nmdc:mga06z11_402816_c1
1110 nmdc:mga06z11_838_c1
1111 nmdc:mga06z11_9935_c1
1112 nmdc:mga04h51_144589_c1
1113 nmdc:mga04h51_1817_c1
1114 nmdc:mga04h51_4013_c1
1115 nmdc:mga05p37_22355_c2
1116 nmdc:mga05p37_338823_c1
1117 nmdc:mga09592_139149_c1
1118 nmdc:mga0qj67_120523_c1
1119 nmdc:mga06r32_1393_c1
1120 nmdc:mga06r32_1442977_c1
1121 nmdc:mga06r32_1470696_c1
1122 nmdc:mga06r32_50527_c1
1123 nmdc:mga06r32_7638_c1
1124 nmdc:mga08y16_1072323_c1
1125 nmdc:mga08y16_293577_c1
1126 nmdc:mga08y16_611431_c1
1127 nmdc:mga08y16_658898_c1
1128 nmdc:mga08y16_65973_c1
1129 nmdc:mga08y16_71382_c1
1130 nmdc:mga0n895_101051_c1
1131 nmdc:mga0n895_1528874_c1
1132 nmdc:mga0n895_64926_c1
1133 nmdc:mga0n895_76726_c1
1134 nmdc:mga0rr50_20438_c1
1135 nmdc:mga0rr50_27985_c1
1136 nmdc:mga0rr50_95476_c1
1137 nmdc:mga0a205_153027_c1
1138 Ga0500641_0331732
1139 Ga0500556_0000878
1140 Ga0500562_011122
1141 Ga0500655_007717
1142 Ga0500655_056379
1143 Ga0500616_0004900
1144 Ga0500616_0012504
1145 Ga0500616_0018403
1146 Ga0500619_000679
1147 Ga0500622_0025800
1148 Ga0501084_0000016
1149 Ga0501084_0002887
1150 Ga0501084_0104190
1151 Ga0501084_0267249
1152 Ga0501082_0026126
1153 Ga0501082_0174328
1154 Ga0501082_0223604
1155 Ga0501082_0296276
1156 Ga0501082_0380798
1157 Ga0530510_0073901
1158 Ga0530510_0527760
1159 Ga0530510_0903600
1160 2898796865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

22

157

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9763 3 168
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9737 3 168
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9451 3 168
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9409 11 178
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9367 3 168
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9729 3 168 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9551 11 173 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.944 3 168 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9196 11 173 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9169 12 157 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0S8L444-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.998 8 173 GO:0005829
GO:0006777
AF-A0A661DIQ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9978 8 166 GO:0005829
GO:0006777
AF-A0A5C8C9V3-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9972 8 174 GO:0005829
GO:0006777
AF-A0A391NH38-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9968 9 168 GO:0005829
GO:0006777
AF-A0A2P1PTI1-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9967 11 172 GO:0005829
GO:0006777

Map