F466023

General Info

Members Datasets Scaffolds Average Seq Length
580 447 308 105

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874123672|2874124253
Length 122
Sequence SFSDLEKIIRERARSGDPDSWTAKLFARGMDKAAQKLGEEAVETVIAAVRSDKQALVSESADLIYHWLVVLGIAEVSLSDVLKELEGRTGRSGIAEKATRQDKLDREDKLARQDKATRQDRG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
16 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
17 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
18 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
19 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
20 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
21 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
22 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
23 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
24 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
25 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
26 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
27 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
28 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
29 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
30 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
31 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
32 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
33 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
34 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
35 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
36 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
37 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
38 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
39 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
40 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
41 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
42 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
43 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
44 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
45 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
46 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
47 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
48 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
49 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
50 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
51 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
52 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
53 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
54 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
55 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
56 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
57 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
58 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
59 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
60 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
61 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
62 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
63 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
64 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
65 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
66 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
67 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
68 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
69 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
70 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
71 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
72 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
73 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
74 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
75 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
76 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
77 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
78 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
79 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
80 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
81 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
82 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
83 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
84 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
85 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
86 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
87 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
88 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
89 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
90 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
91 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
92 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
93 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
94 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
95 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
96 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
97 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
98 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
99 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
100 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
101 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
102 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
103 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
104 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
105 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
106 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
107 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
108 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
109 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
110 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
111 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
112 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
113 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
114 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
115 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
116 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
117 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
118 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
119 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
120 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
121 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
122 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
123 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
124 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
125 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
126 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
127 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
128 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
129 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
130 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
131 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
132 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
133 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
134 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
135 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
136 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
137 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
138 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
139 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
140 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
141 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
142 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
143 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
144 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
145 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
146 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
147 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
148 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
149 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
150 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
151 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
152 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
153 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
154 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
155 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
156 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
157 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
158 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
159 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
160 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
161 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
162 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
163 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
164 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
165 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
166 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
167 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
168 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
169 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
170 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
171 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
172 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
173 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
174 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
175 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
176 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
177 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
178 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
179 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
180 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
181 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
182 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
183 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
184 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
185 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
186 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
187 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
188 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
189 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
190 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
191 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
192 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
193 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
194 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
195 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
196 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
197 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
198 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
199 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
200 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
201 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
202 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
203 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
204 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
205 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
206 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
207 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
208 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
209 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
210 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
211 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
212 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
213 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
214 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
215 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
216 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
217 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
218 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
219 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
220 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
221 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
222 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
223 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
224 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
225 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
226 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
227 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
228 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
229 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
230 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
231 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
232 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
233 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
234 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
235 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
236 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
237 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
238 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
239 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
240 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
241 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
242 3004167301 Mesorhizobium loti 582 Isolate Unclassified
243 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
244 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
245 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
246 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
247 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
248 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
249 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
250 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
251 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
252 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
253 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
254 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
255 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
256 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
257 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
258 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
259 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
260 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
261 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
262 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
263 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
264 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
265 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
266 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
267 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
268 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
269 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
270 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
271 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
272 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
273 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
274 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
275 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
276 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
277 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
278 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
279 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
280 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
281 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
282 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
283 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
284 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
285 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
286 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
287 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
288 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
291 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
292 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
293 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
294 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
295 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
296 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
297 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
298 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
299 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
300 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
301 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
302 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
303 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
304 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
305 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
306 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
307 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
308 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
309 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
310 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
311 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
312 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
313 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
314 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
315 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
317 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
318 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
320 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
346 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
348 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
349 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
350 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
351 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
352 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
353 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
354 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
355 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
356 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
357 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
358 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
359 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
360 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
361 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
362 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
363 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
364 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
373 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
374 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
380 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
381 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
382 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
421 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
422 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
423 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
424 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
429 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
432 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
433 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
434 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
435 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
436 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
437 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
438 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
439 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
440 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
441 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
442 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
443 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
444 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
445 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
446 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
447 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.76
Metatranscriptomes 0.34
Isolates 46.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.69
Nodule 41.55
Rhizoplane 2.93
Rhizosphere 36.55
Stem 0
Stem Tuber 0
Unclassified 8.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002208 3300001979 Bacteria 8895
2 JGI24739J22299_10011162 3300001989 Bacteria 3319
3 JGI24735J21928_10125741 3300002067 Bacteria 739
4 JGI25156J39149_1003248 3300002705 Bacteria 5410
5 JGI25157J39369_1001109 3300002741 Bacteria 11987
6 JGI25406J46586_10008175 3300003203 Bacteria 4750
7 JGI25165J46597_1000078 3300003214 Bacteria 179320
8 Ga0055542_1001659 3300003762 Bacteria 9937
9 Ga0055529_1006920 3300003763 Bacteria 1559
10 Ga0070658_10036715 3300005327 Bacteria 3949
11 Ga0070676_11612538 3300005328 Bacteria 502
12 Ga0070670_100639327 3300005331 Bacteria 954
13 Ga0070666_10207363 3300005335 Bacteria 1380
14 Ga0070674_101582937 3300005356 Bacteria 590
15 Ga0070659_100499604 3300005366 Bacteria 1037
16 Ga0070659_101364117 3300005366 Bacteria 630
17 Ga0070663_100324071 3300005455 Bacteria 1240
18 Ga0070663_100573506 3300005455 Bacteria 946
19 Ga0070663_100751437 3300005455 Bacteria 833
20 Ga0068867_100362510 3300005459 Bacteria 1213
21 Ga0068853_100013757 3300005539 Bacteria 6610
22 Ga0068853_100135177 3300005539 Bacteria 2209
23 Ga0068853_100623002 3300005539 Bacteria 1026
24 Ga0068853_100838000 3300005539 Bacteria 882
25 Ga0070665_100141205 3300005548 Bacteria 2411
26 Ga0070665_100310079 3300005548 Bacteria 1581
27 Ga0070665_100478701 3300005548 Bacteria 1256
28 Ga0070665_102304011 3300005548 Bacteria 541
29 Ga0068855_100563068 3300005563 Bacteria 1233
30 Ga0068857_100453955 3300005577 Bacteria 1198
31 Ga0068854_100798222 3300005578 Bacteria 823
32 Ga0068856_100239043 3300005614 Bacteria 1831
33 Ga0068856_100442313 3300005614 Bacteria 1321
34 Ga0068852_100134478 3300005616 Bacteria 2282
35 Ga0068852_100242084 3300005616 Bacteria 1725
36 Ga0068852_100565232 3300005616 Bacteria 1139
37 Ga0068866_10927410 3300005718 Bacteria 614
38 Ga0081539_10000690 3300005985 Bacteria 67656
39 Ga0075365_10016702 3300006038 Bacteria 4472
40 Ga0075365_10021497 3300006038 Bacteria 4027
41 Ga0075365_10042272 3300006038 Bacteria 2979
42 Ga0075365_10079739 3300006038 Bacteria 2215
43 Ga0075365_10118596 3300006038 Bacteria 1824
44 Ga0075368_10040625 3300006042 Bacteria 1826
45 Ga0075368_10044930 3300006042 Bacteria 1744
46 Ga0075368_10167776 3300006042 Bacteria 922
47 Ga0075363_100018781 3300006048 Bacteria 3448
48 Ga0075363_100056337 3300006048 Bacteria 2107
49 Ga0075364_10303748 3300006051 Bacteria 1086
50 Ga0075362_10030637 3300006177 Bacteria 2323
51 Ga0075362_10119215 3300006177 Bacteria 1248
52 Ga0075367_10105893 3300006178 Bacteria 1723
53 Ga0075367_10128663 3300006178 Bacteria 1564
54 Ga0075367_10815115 3300006178 Bacteria 595
55 Ga0075367_10887312 3300006178 Bacteria 568
56 Ga0075366_10210800 3300006195 Bacteria 1183
57 Ga0075366_11068703 3300006195 Bacteria 504
58 Ga0097621_100841321 3300006237 Bacteria 852
59 Ga0097621_101208537 3300006237 Bacteria 712
60 Ga0075370_10179715 3300006353 Bacteria 1245
61 Ga0075370_10187161 3300006353 Bacteria 1219
62 Ga0075370_10500118 3300006353 Bacteria 734
63 Ga0105240_10053776 3300009093 Bacteria 5051
64 Ga0105240_10119677 3300009093 Bacteria 3172
65 Ga0105240_11018305 3300009093 Bacteria 885
66 Ga0105240_12297335 3300009093 Bacteria 559
67 Ga0105245_10577325 3300009098 Bacteria 1149
68 Ga0105245_11554601 3300009098 Bacteria 713
69 Ga0105247_10798589 3300009101 Bacteria 720
70 Ga0105243_11089450 3300009148 Bacteria 806
71 Ga0105243_11756070 3300009148 Bacteria 650
72 Ga0105241_10146959 3300009174 Bacteria 1924
73 Ga0105241_10175871 3300009174 Bacteria 1771
74 Ga0105241_10851255 3300009174 Bacteria 843
75 Ga0105248_10238573 3300009177 Bacteria 2047
76 Ga0105237_10071997 3300009545 Bacteria 3450
77 Ga0105237_10360901 3300009545 Bacteria 1457
78 Ga0105237_10509063 3300009545 Bacteria 1210
79 Ga0105238_10013898 3300009551 Bacteria 8141
80 Ga0105238_10282251 3300009551 Bacteria 1642
81 Ga0105238_10297072 3300009551 Bacteria 1598
82 Ga0105238_12137018 3300009551 Bacteria 594
83 Ga0105249_11552663 3300009553 Bacteria 734
84 Ga0105249_12067336 3300009553 Bacteria 642
85 Ga0105239_10767951 3300010375 Bacteria 1103
86 Ga0105239_11020778 3300010375 Bacteria 951
87 Ga0105239_11100259 3300010375 Bacteria 915
88 Ga0105239_11122909 3300010375 Bacteria 905
89 Ga0105239_11351138 3300010375 Bacteria 822
90 Ga0105239_11718183 3300010375 Bacteria 727
91 Ga0105239_12196578 3300010375 Bacteria 642
92 Ga0105239_12548576 3300010375 Bacteria 596
93 Ga0105246_10423355 3300011119 Bacteria 1112
94 Ga0157373_11025670 3300013100 Bacteria 616
95 Ga0157373_11159585 3300013100 Bacteria 581
96 Ga0157370_10468432 3300013104 Bacteria 1158
97 Ga0157370_10973263 3300013104 Bacteria 769
98 Ga0157370_11430685 3300013104 Bacteria 622
99 Ga0157370_12102007 3300013104 Bacteria 506
100 Ga0157369_10148306 3300013105 Bacteria 2480
101 Ga0157369_11278077 3300013105 Bacteria 748
102 Ga0157374_10734840 3300013296 Bacteria 1001
103 Ga0163162_10570432 3300013306 Bacteria 1259
104 Ga0163162_12033017 3300013306 Bacteria 659
105 Ga0157372_10649126 3300013307 Bacteria 1229
106 Ga0157372_10971685 3300013307 Bacteria 984
107 Ga0182008_10108479 3300014497 Bacteria 1375
108 Ga0182008_10766650 3300014497 Bacteria 557
109 Ga0182006_1090444 3300015261 Bacteria 1102
110 Ga0182007_10009758 3300015262 Bacteria 3841
111 Ga0182005_1014469 3300015265 Bacteria 2206
112 Ga0163161_10214837 3300017792 Bacteria 1487
113 Ga0163161_10673667 3300017792 Bacteria 859
114 Ga0206356_11725356 3300020070 Bacteria 597
115 Ga0209646_1021728 3300025246 Bacteria 920
116 Ga0209026_1000151 3300025250 Bacteria 110338
117 Ga0209148_1000032 3300025254 Bacteria 557660
118 Ga0209148_1008856 3300025254 Bacteria 1998
119 Ga0209759_1000076 3300025256 Bacteria 175911
120 Ga0209233_1000150 3300025261 Bacteria 179401
121 Ga0209233_1019416 3300025261 Bacteria 1807
122 Ga0209455_1000085 3300025272 Bacteria 247601
123 Ga0209758_1018922 3300025297 Bacteria 3349
124 Ga0207656_10347111 3300025321 Bacteria 740
125 Ga0207680_10372330 3300025903 Bacteria 1006
126 Ga0207680_10586341 3300025903 Bacteria 797
127 Ga0207647_10018216 3300025904 Bacteria 4757
128 Ga0207647_10068128 3300025904 Bacteria 2155
129 Ga0207705_10040424 3300025909 Bacteria 3345
130 Ga0207654_10118713 3300025911 Bacteria 1657
131 Ga0207695_10031165 3300025913 Bacteria 5854
132 Ga0207695_10340695 3300025913 Bacteria 1387
133 Ga0207695_11240446 3300025913 Bacteria 626
134 Ga0207695_11481608 3300025913 Bacteria 559
135 Ga0207695_11658858 3300025913 Bacteria 520
136 Ga0207671_10171946 3300025914 Bacteria 1683
137 Ga0207671_10297898 3300025914 Bacteria 1274
138 Ga0207671_10475780 3300025914 Bacteria 996
139 Ga0207657_10382493 3300025919 Bacteria 1108
140 Ga0207694_10023324 3300025924 Bacteria 4697
141 Ga0207690_10430553 3300025932 Bacteria 1057
142 Ga0207690_10432691 3300025932 Bacteria 1054
143 Ga0207706_10895023 3300025933 Bacteria 750
144 Ga0207669_10362308 3300025937 Bacteria 1124
145 Ga0207669_10811197 3300025937 Bacteria 777
146 Ga0207711_10253025 3300025941 Bacteria 1618
147 Ga0207667_10339317 3300025949 Bacteria 1533
148 Ga0207668_10413732 3300025972 Bacteria 1143
149 Ga0207640_10031560 3300025981 Bacteria 3275
150 Ga0207640_10696186 3300025981 Bacteria 871
151 Ga0207677_10875692 3300026023 Bacteria 808
152 Ga0207639_10255411 3300026041 Bacteria 1530
153 Ga0207639_10637203 3300026041 Bacteria 985
154 Ga0207678_10240269 3300026067 Bacteria 1551
155 Ga0207678_10405323 3300026067 Bacteria 1181
156 Ga0207678_10502327 3300026067 Bacteria 1057
157 Ga0207702_10134933 3300026078 Bacteria 2225
158 Ga0207702_10300833 3300026078 Bacteria 1522
159 Ga0207641_12307462 3300026088 Bacteria 538
160 Ga0207648_10305738 3300026089 Bacteria 1427
161 Ga0207674_10449545 3300026116 Bacteria 1245
162 Ga0207674_10493765 3300026116 Bacteria 1183
163 Ga0207675_102728560 3300026118 Bacteria 502
164 Ga0207698_10221660 3300026142 Bacteria 1710
165 Ga0207698_10442033 3300026142 Bacteria 1253
166 Ga0207698_10938471 3300026142 Bacteria 874
167 Ga0209813_10200959 3300027866 Bacteria 738
168 Ga0268266_10007362 3300028379 Bacteria 9941
169 Ga0268266_10086552 3300028379 Bacteria 2740
170 Ga0268266_11094017 3300028379 Bacteria 771
171 Ga0307515_10646133 3300028794 Bacteria 670
172 Ga0307513_10096997 3300031456 Bacteria 2984
173 Ga0307416_102570015 3300032002 Bacteria 607
174 Ga0307411_10157514 3300032005 Bacteria 1696
175 Ga0395899_0000107 3300037312 Bacteria 144087
176 Ga0395900_0000101 3300037418 Bacteria 153550
177 Ga0395900_0057404 3300037418 Bacteria 4008
178 Ga0395900_0061014 3300037418 Bacteria 3878
179 Ga0395900_0154761 3300037418 Bacteria 2342
180 Ga0395900_0176778 3300037418 Bacteria 2171
181 Ga0395900_0310617 3300037418 Bacteria 1560
182 Ga0395898_0000043 3300037466 Bacteria 301783
183 Ga0395898_0716761 3300037466 Bacteria 942
184 Ga0395898_0983233 3300037466 Bacteria 780
185 Ga0395898_1897556 3300037466 Bacteria 516
186 Ga0395905_0000101 3300037471 Bacteria 144115
187 Ga0395905_0193578 3300037471 Bacteria 1907
188 Ga0395905_0794849 3300037471 Bacteria 849
189 Ga0395905_0861386 3300037471 Bacteria 809
190 Ga0395905_1002005 3300037471 Bacteria 738
191 Ga0395901_0000068 3300038443 Bacteria 144095
192 Ga0395901_0013412 3300038443 Bacteria 8330
193 Ga0395901_0901087 3300038443 Bacteria 866
194 Ga0395901_0929491 3300038443 Bacteria 850
195 Ga0395901_1595164 3300038443 Bacteria 606
196 Ga0451787_216693 3300041441 Bacteria 546
197 Ga0451793_0945188 3300041452 Bacteria 554
198 Ga0451797_1100702 3300041453 Bacteria 704
199 Ga0451800_0513463 3300041459 Bacteria 547
200 Ga0451807_1983938 3300041486 Bacteria 599
201 Ga0451837_1431403 3300041494 Bacteria 523
202 Ga0451847_0595254 3300041503 Bacteria 622
203 Ga0451843_0850527 3300041509 Bacteria 535
204 Ga0439458_0025487 3300042157 Bacteria 1388
205 Ga0466961_0246809 3300044693 Bacteria 1097
206 Ga0466964_0306713 3300044706 Bacteria 802
207 Ga0466968_0067311 3300044735 Bacteria 1553
208 Ga0495638_0370375 3300046460 Bacteria 751
209 Ga0495605_0465109 3300046474 Bacteria 520
210 Ga0495606_0328111 3300046507 Bacteria 820
211 Ga0495610_0097702 3300046512 Bacteria 1320
212 Ga0495620_0195786 3300046515 Bacteria 778
213 Ga0495654_0402291 3300046530 Bacteria 544
214 Ga0495597_0165292 3300046542 Bacteria 901
215 Ga0495668_0094652 3300046616 Bacteria 1635
216 Ga0495611_0190365 3300046648 Bacteria 958
217 Ga0495625_0164132 3300046660 Bacteria 1486
218 Ga0495625_0195096 3300046660 Bacteria 1339
219 Ga0495625_0619346 3300046660 Bacteria 648
220 Ga0495659_0021325 3300046664 Bacteria 2182
221 Ga0495661_0277527 3300046665 Bacteria 846
222 Ga0495660_0170270 3300046810 Bacteria 1061
223 Ga0495683_0372531 3300047323 Bacteria 599
224 Ga0495687_067947 3300047443 Bacteria 1440
225 Ga0495686_0576145 3300047472 Bacteria 585
226 Ga0495626_0031875 3300048091 Bacteria 2534
227 Ga0496104_1336941 3300048907 Bacteria 620
228 Ga0496104_1719063 3300048907 Bacteria 530
229 Ga0496105_1086695 3300048908 Bacteria 594
230 Ga0496110_0201029 3300048913 Bacteria 1811
231 Ga0496110_0546520 3300048913 Bacteria 1053
232 Ga0496110_0673526 3300048913 Bacteria 935
233 Ga0496111_0110984 3300048914 Bacteria 2020
234 Ga0496112_0109805 3300048915 Bacteria 2728
235 Ga0496112_0230245 3300048915 Bacteria 1808
236 Ga0496115_0180213 3300048918 Bacteria 1747
237 Ga0496115_0581379 3300048918 Bacteria 892
238 Ga0496117_0188040 3300048920 Bacteria 1180
239 Ga0496118_0297080 3300048921 Bacteria 889
240 Ga0496118_0372071 3300048921 Bacteria 753
241 Ga0496119_0063371 3300048922 Bacteria 2199
242 Ga0496119_0152614 3300048922 Bacteria 1236
243 Ga0496119_0395021 3300048922 Bacteria 661
244 Ga0496120_0002559 3300048923 Bacteria 18148
245 Ga0496120_0034633 3300048923 Bacteria 3023
246 Ga0496124_0358816 3300048927 Bacteria 1028
247 Ga0496125_0119857 3300048928 Bacteria 1880
248 Ga0496126_0164509 3300048929 Bacteria 1894
249 Ga0501032_0070185 3300049569 Bacteria 2337
250 Ga0501032_0204071 3300049569 Bacteria 1290
251 Ga0501032_0426326 3300049569 Bacteria 851
252 Ga0501033_0065064 3300049570 Bacteria 2682
253 Ga0501033_0197852 3300049570 Bacteria 1436
254 Ga0501034_0027699 3300049571 Bacteria 5762
255 Ga0501034_0046572 3300049571 Bacteria 4381
256 Ga0501034_0280041 3300049571 Bacteria 1607
257 Ga0501034_0431595 3300049571 Bacteria 1237
258 Ga0501034_0828398 3300049571 Bacteria 817
259 Ga0501034_0870666 3300049571 Bacteria 790
260 Ga0501036_0305338 3300049572 Bacteria 1331
261 Ga0501037_0421080 3300049573 Bacteria 914
262 Ga0501038_0573319 3300049574 Bacteria 856
263 Ga0501039_0151665 3300049575 Bacteria 1821
264 Ga0501043_0319921 3300049579 Bacteria 1183
265 Ga0501047_0506006 3300049581 Bacteria 1034
266 Ga0501047_0715596 3300049581 Bacteria 818
267 Ga0501067_0055481 3300049583 Bacteria 2196
268 Ga0501070_0558242 3300049586 Bacteria 916
269 Ga0501070_0907016 3300049586 Bacteria 687
270 Ga0501070_1009878 3300049586 Bacteria 645
271 Ga0501070_1410291 3300049586 Bacteria 529
272 Ga0501035_0033734 3300049822 Bacteria 4653
273 Ga0501035_1150364 3300049822 Bacteria 604
274 Ga0501044_0016850 3300049823 Bacteria 7839
275 nmdc:mga03683_357930_c1 3300050489 Bacteria 692
276 nmdc:mga03683_45590_c1 3300050489 Bacteria 1815
277 nmdc:mga03n38_267895_c1 3300050490 Bacteria 908
278 nmdc:mga03n38_343979_c1 3300050490 Bacteria 810
279 nmdc:mga03n38_364455_c1 3300050490 Bacteria 789
280 nmdc:mga00v17_140309_c1 3300050491 Bacteria 1549
281 nmdc:mga0yw44_111696_c1 3300050492 Bacteria 1752
282 nmdc:mga0yw44_178571_c1 3300050492 Bacteria 1396
283 nmdc:mga0yw44_2040_c1 3300050492 Bacteria 8418
284 nmdc:mga0yw44_25004_c1 3300050492 Bacteria 3389
285 nmdc:mga0yw44_455336_c1 3300050492 Bacteria 867
286 nmdc:mga0k408_533893_c1 3300050493 Bacteria 694
287 nmdc:mga06z11_209638_c1 3300050494 Bacteria 1135
288 nmdc:mga06z11_302942_c1 3300050494 Bacteria 950
289 nmdc:mga06z11_7128_c1 3300050494 Bacteria 4589
290 nmdc:mga04h51_230521_c1 3300050495 Bacteria 737
291 nmdc:mga07m45_151364_c1 3300050496 Bacteria 1345
292 nmdc:mga07m45_171889_c1 3300050496 Bacteria 1259
293 Ga0495655_0103990 3300053083 Bacteria 845
294 Ga0495655_0215780 3300053083 Bacteria 633
295 Ga0500578_0352177 3300053086 Bacteria 860
296 Ga0500646_0158334 3300053090 Bacteria 755
297 Ga0500595_047738 3300053119 Bacteria 1340
298 Ga0500658_0203989 3300053134 Bacteria 904
299 Ga0500658_0238311 3300053134 Bacteria 835
300 Ga0500604_0097615 3300053151 Bacteria 965
301 Ga0500616_0207928 3300053153 Bacteria 862
302 Ga0500620_000353 3300053155 Bacteria 8565
303 Ga0500620_028902 3300053155 Bacteria 1738
304 Ga0500620_060499 3300053155 Bacteria 1288
305 Ga0500627_0118554 3300053158 Bacteria 1193
306 Ga0500611_061806 3300053727 Bacteria 889
307 Ga0587082_065643 3300059504 Bacteria 726
308 Ga0501082_1504844 3300060353 Bacteria 588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2508501127 2509140733 101
2 iso_pu_bacteria 2503198000 2503198460 103
3 iso_pu_bacteria 2508501123 2509114050 103
4 iso_pu_bacteria 2509276018 2509368526 103
5 iso_pu_bacteria 2509276022 2509393554 103
6 iso_pu_bacteria 2510065059 2510314807 103
7 iso_pu_bacteria 2512875016 2512934075 103
8 iso_pu_bacteria 2512875024 2512962364 103
9 iso_pu_bacteria 2513237164 2514038675 103
10 iso_pu_bacteria 2513237305 2514418220 103
11 iso_pu_bacteria 2588253730 2588520214 103
12 iso_pu_bacteria 2597489875 2597810414 103
13 iso_pu_bacteria 2599185301 2599935241 103
14 iso_pu_bacteria 2643221550 2643773385 103
15 iso_pu_bacteria 2643221564 2643839483 103
16 iso_pu_bacteria 2643221595 2643983793 103
17 iso_pu_bacteria 2643221627 2644155926 103
18 iso_pu_bacteria 2687453392 2688595781 103
19 iso_pu_bacteria 2693429783 2694627957 103
20 iso_pu_bacteria 2693429784 2694636207 103
21 iso_pu_bacteria 2721755686 2723573071 103
22 iso_pu_bacteria 2791355123 2792746969 103
23 iso_pu_bacteria 2841734538 2841736202 103
24 iso_pu_bacteria 2844002411 2844003671 103
25 iso_pu_bacteria 2844009547 2844010586 103
26 iso_pu_bacteria 2847670302 2847673380 103
27 iso_pu_bacteria 2847686936 2847689890 103
28 iso_pu_bacteria 2856314179 2856319151 103
29 iso_pu_bacteria 2856320880 2856322208 103
30 iso_pu_bacteria 2856328259 2856332733 103
31 iso_pu_bacteria 2856334872 2856340720 103
32 iso_pu_bacteria 2856342000 2856342822 103
33 iso_pu_bacteria 2856349417 2856354278 103
34 iso_pu_bacteria 2856356410 2856361557 103
35 iso_pu_bacteria 2856364286 2856369953 103
36 iso_pu_bacteria 2857349434 2857352849 103
37 iso_pu_bacteria 2857367948 2857369277 103
38 iso_pu_bacteria 2869162929 2869165321 103
39 iso_pu_bacteria 2869169390 2869176213 103
40 iso_pu_bacteria 2869234852 2869235305 103
41 iso_pu_bacteria 2869242130 2869249344 103
42 iso_pu_bacteria 2869249662 2869251653 103
43 iso_pu_bacteria 2869256925 2869257076 103
44 iso_pu_bacteria 2869264136 2869269887 103
45 iso_pu_bacteria 2869271264 2869272556 103
46 iso_pu_bacteria 2869278585 2869284697 103
47 iso_pu_bacteria 2869285874 2869290760 103
48 iso_pu_bacteria 2871429161 2871433042 103
49 iso_pu_bacteria 2871435913 2871440701 103
50 iso_pu_bacteria 2871444079 2871447764 103
51 iso_pu_bacteria 2871451962 2871452953 103
52 iso_pu_bacteria 2871459585 2871460463 103
53 iso_pu_bacteria 2871466892 2871470074 103
54 iso_pu_bacteria 2871474448 2871480379 103
55 iso_pu_bacteria 2871481445 2871483992 103
56 iso_pu_bacteria 2871488783 2871489672 103
57 iso_pu_bacteria 2871495908 2871502317 103
58 iso_pu_bacteria 2874102143 2874105821 103
59 iso_pu_bacteria 2874109183 2874116487 103
60 iso_pu_bacteria 2874116593 2874122049 103
61 iso_pu_bacteria 2874123672 2874124253 103
62 iso_pu_bacteria 2874131515 2874133671 103
63 iso_pu_bacteria 2874139085 2874142983 103
64 iso_pu_bacteria 2874146452 2874153797 103
65 iso_pu_bacteria 2874155637 2874161062 103
66 iso_pu_bacteria 2874162495 2874168355 103
67 iso_pu_bacteria 2874168670 2874172193 103
68 iso_pu_bacteria 2876363079 2876363667 103
69 iso_pu_bacteria 2876369609 2876376561 103
70 iso_pu_bacteria 2876377896 2876380246 103
71 iso_pu_bacteria 2876386047 2876386536 103
72 iso_pu_bacteria 2876392853 2876397118 103
73 iso_pu_bacteria 2876399893 2876406087 103
74 iso_pu_bacteria 2876406927 2876408539 103
75 iso_pu_bacteria 2876413966 2876419102 103
76 iso_pu_bacteria 2876420981 2876424513 103
77 iso_pu_bacteria 2878035449 2878039540 103
78 iso_pu_bacteria 2878730984 2878736619 103
79 iso_pu_bacteria 2878738818 2878740948 103
80 iso_pu_bacteria 2878745973 2878750655 103
81 iso_pu_bacteria 2878753008 2878754292 103
82 iso_pu_bacteria 2878760144 2878766208 103
83 iso_pu_bacteria 2878767105 2878773409 103
84 iso_pu_bacteria 2878774303 2878776597 103
85 iso_pu_bacteria 2878781027 2878781409 103
86 iso_pu_bacteria 2881147464 2881148209 103
87 iso_pu_bacteria 2881155292 2881159208 103
88 iso_pu_bacteria 2881161766 2881164904 103
89 iso_pu_bacteria 2881845957 2881851480 103
90 iso_pu_bacteria 2881853255 2881855927 103
91 iso_pu_bacteria 2881861095 2881866003 103
92 iso_pu_bacteria 2882632389 2882634563 103
93 iso_pu_bacteria 2882912400 2882913282 103
94 iso_pu_bacteria 2885305155 2885306779 103
95 iso_pu_bacteria 2885312484 2885314343 103
96 iso_pu_bacteria 2885318864 2885325030 103
97 iso_pu_bacteria 2885326080 2885327936 103
98 iso_pu_bacteria 2885334103 2885342244 103
99 iso_pu_bacteria 2885342637 2885347227 103
100 iso_pu_bacteria 2885350715 2885352823 103
101 iso_pu_bacteria 2888343758 2888344159 103
102 iso_pu_bacteria 2888350351 2888353079 103
103 iso_pu_bacteria 2889010040 2889014825 103
104 iso_pu_bacteria 2889016732 2889020092 103
105 iso_pu_bacteria 2903448605 2903454248 103
106 iso_pu_bacteria 2903492973 2903496262 103
107 iso_pu_bacteria 2903492973 2903497393 103
108 iso_pu_bacteria 2903513507 2903514836 103
109 iso_pu_bacteria 2903521522 2903523272 103
110 iso_pu_bacteria 2903528002 2903529311 103
111 iso_pu_bacteria 2903540706 2903547254 103
112 iso_pu_bacteria 2904659560 2904663872 103
113 iso_pu_bacteria 2906308376 2906313580 103
114 iso_pu_bacteria 2906321335 2906326289 103
115 iso_pu_bacteria 2906328253 2906334248 103
116 iso_pu_bacteria 2906363423 2906367221 103
117 iso_pu_bacteria 2906370794 2906372816 103
118 iso_pu_bacteria 2906386501 2906393369 103
119 iso_pu_bacteria 2906401398 2906407344 103
120 iso_pu_bacteria 2906408224 2906409440 103
121 iso_pu_bacteria 2906414383 2906419223 103
122 iso_pu_bacteria 2922130491 2922133157 103
123 iso_pu_bacteria 2922151315 2922151889 103
124 iso_pu_bacteria 2922158528 2922162660 103
125 iso_pu_bacteria 2922172374 2922174407 103
126 iso_pu_bacteria 2922178524 2922179751 103
127 iso_pu_bacteria 2922185730 2922187712 103
128 iso_pu_bacteria 2924710171 2924716436 103
129 iso_pu_bacteria 2924718760 2924726145 103
130 iso_pu_bacteria 2924726620 2924728965 103
131 iso_pu_bacteria 2924733363 2924736530 103
132 iso_pu_bacteria 2924741084 2924741101 103
133 iso_pu_bacteria 2924748358 2924748651 103
134 iso_pu_bacteria 2924754689 2924759352 103
135 iso_pu_bacteria 2924762789 2924765581 103
136 iso_pu_bacteria 2924776078 2924778549 103
137 iso_pu_bacteria 2924784321 2924784980 103
138 iso_pu_bacteria 2937813078 2937820115 103
139 iso_pu_bacteria 2937822353 2937826519 103
140 iso_pu_bacteria 2937836603 2937840573 103
141 iso_pu_bacteria 2937848649 2937849590 103
142 iso_pu_bacteria 2937861824 2937866129 103
143 iso_pu_bacteria 2937868953 2937876085 103
144 iso_pu_bacteria 2937877337 2937878817 103
145 iso_pu_bacteria 2937891427 2937897243 103
146 iso_pu_bacteria 2937972304 2937974402 103
147 iso_pu_bacteria 2937980651 2937982391 103
148 iso_pu_bacteria 2937994558 2938001117 103
149 iso_pu_bacteria 2938014810 2938017696 103
150 iso_pu_bacteria 2958034702 2958041448 103
151 iso_pu_bacteria 2958041894 2958042422 103
152 iso_pu_bacteria 2958064165 2958065274 103
153 iso_pu_bacteria 2958071322 2958077164 103
154 iso_pu_bacteria 2958084443 2958085968 103
155 iso_pu_bacteria 2958092219 2958097645 103
156 iso_pu_bacteria 2958108152 2958109027 103
157 iso_pu_bacteria 2958115193 2958119229 103
158 iso_pu_bacteria 2958122699 2958123271 103
159 iso_pu_bacteria 2958130278 2958135160 103
160 iso_pu_bacteria 2958137437 2958140793 103
161 iso_pu_bacteria 2958144490 2958150579 103
162 iso_pu_bacteria 2958165035 2958171383 103
163 iso_pu_bacteria 2958179912 2958184189 103
164 iso_pu_bacteria 2961077736 2961082244 103
165 iso_pu_bacteria 2961127735 2961135603 103
166 iso_pu_bacteria 2961136820 2961140080 103
167 iso_pu_bacteria 2961163497 2961169824 103
168 iso_pu_bacteria 2961170736 2961176349 103
169 iso_pu_bacteria 2961183825 2961184409 103
170 iso_pu_bacteria 2963644680 2963645127 103
171 iso_pu_bacteria 2965018300 2965024584 103
172 iso_pu_bacteria 2965025482 2965030182 103
173 iso_pu_bacteria 2965032056 2965032774 103
174 iso_pu_bacteria 2965040258 2965040878 103
175 iso_pu_bacteria 2965047637 2965050543 103
176 iso_pu_bacteria 2965062239 2965062337 103
177 iso_pu_bacteria 2965089291 2965096622 103
178 iso_pu_bacteria 2965102966 2965107230 103
179 iso_pu_bacteria 2965110997 2965119337 103
180 iso_pu_bacteria 2967996073 2967996736 103
181 iso_pu_bacteria 2968003550 2968004798 103
182 iso_pu_bacteria 2968016561 2968022968 103
183 iso_pu_bacteria 2968083720 2968089974 103
184 iso_pu_bacteria 2968091066 2968093660 103
185 iso_pu_bacteria 2968097103 2968098490 103
186 iso_pu_bacteria 2968128360 2968133907 103
187 iso_pu_bacteria 2968138860 2968146112 103
188 iso_pu_bacteria 2968171901 2968178216 103
189 iso_pu_bacteria 2970469710 2970475553 103
190 iso_pu_bacteria 2970489779 2970490035 103
191 iso_pu_bacteria 2970503327 2970509020 103
192 iso_pu_bacteria 2970510686 2970517550 103
193 iso_pu_bacteria 2970524798 2970525871 103
194 iso_pu_bacteria 2970532167 2970535533 103
195 iso_pu_bacteria 2970540015 2970545665 103
196 iso_pu_bacteria 2970547951 2970554379 103
197 iso_pu_bacteria 2970554993 2970561062 103
198 iso_pu_bacteria 2970593180 2970599308 103
199 iso_pu_bacteria 2970619444 2970624195 103
200 iso_pu_bacteria 2970627176 2970630194 103
201 iso_pu_bacteria 2977821940 2977823506 103
202 iso_pu_bacteria 2977828996 2977834930 103
203 iso_pu_bacteria 2977843712 2977850341 103
204 iso_pu_bacteria 2977851361 2977855262 103
205 iso_pu_bacteria 2977858184 2977859840 103
206 iso_pu_bacteria 2977864932 2977870216 103
207 iso_pu_bacteria 2977872689 2977879661 103
208 iso_pu_bacteria 2977907340 2977911648 103
209 iso_pu_bacteria 2977915119 2977921260 103
210 iso_pu_bacteria 2977922695 2977925744 103
211 iso_pu_bacteria 2977935797 2977940949 103
212 iso_pu_bacteria 2977950692 2977950911 103
213 iso_pu_bacteria 2977957713 2977960675 103
214 iso_pu_bacteria 2977986579 2977988132 103
215 iso_pu_bacteria 2979764755 2979770912 103
216 iso_pu_bacteria 2979772303 2979778935 103
217 iso_pu_bacteria 2979779861 2979781818 103
218 iso_pu_bacteria 2979793036 2979798191 103
219 iso_pu_bacteria 2979808191 2979813699 103
220 iso_pu_bacteria 2987645492 2987651458 103
221 iso_pu_bacteria 2987659509 2987666048 103
222 iso_pu_bacteria 2987666974 2987669326 103
223 iso_pu_bacteria 2987673487 2987675282 103
224 iso_pu_bacteria 2996341866 2996342411 103
225 iso_pu_bacteria 2996348954 2996355837 103
226 iso_pu_bacteria 2996386984 2996387532 103
227 iso_pu_bacteria 3000135777 3000137150 103
228 iso_pu_bacteria 3004167301 3004173011 103
229 iso_pu_bacteria 3004188549 3004195071 103
230 iso_pu_bacteria 3004195979 3004199893 103
231 iso_pu_bacteria 3004211236 3004217282 103
232 iso_pu_bacteria 3004218560 3004220452 103
233 iso_pu_bacteria 3004232784 3004233572 103
234 iso_pu_bacteria 3004239961 3004244500 103
235 iso_pu_bacteria 3004248173 3004255160 103
236 iso_pu_bacteria 3004268573 3004272422 103
237 iso_pu_bacteria 3004275668 3004282263 103
238 iso_pu_bacteria 3004289098 3004294639 103
239 iso_pu_bacteria 3004334049 3004337608 103
240 iso_pu_bacteria 637000159 637077225 103
241 iso_pu_bacteria 649633066 649870348 103
242 iso_pu_bacteria 8002285264 8002286376 103
243 iso_pu_bacteria 8004300914 8004300930 103
244 iso_pu_bacteria 8004312739 8004316572 103
245 iso_pu_bacteria 8004361976 8004367502 103
246 iso_pu_bacteria 8004374579 8004375868 103
247 iso_pu_bacteria 8004387939 8004393049 103
248 iso_pu_bacteria 8004395343 8004403858 103
249 iso_pu_bacteria 8004445564 8004450316 103
250 iso_pu_bacteria 8004633249 8004639990 103
251 iso_pu_bacteria 8004640170 8004641537 103
252 iso_pu_bacteria 8004695233 8004696144 103
253 iso_pu_bacteria 8004703790 8004706813 103
254 iso_pu_bacteria 8004714634 8004719836 103
255 iso_pu_bacteria 8004727605 8004731464 103
256 iso_pu_bacteria 8055617313 8055617687 103
257 3300009093 Ga0105240_10053776 Ga0105240_100537766 104
258 3300013306 Ga0163162_12033017 Ga0163162_120330172 104
259 3300020070 Ga0206356_11725356 Ga0206356_117253562 104
260 3300025254 Ga0209148_1008856 Ga0209148_10088564 104
261 3300025913 Ga0207695_10031165 Ga0207695_100311656 104
262 3300025913 Ga0207695_11658858 Ga0207695_116588582 104
263 3300025933 Ga0207706_10895023 Ga0207706_108950232 104
264 3300046664 Ga0495659_0021325 Ga0495659_0021325_1820_2143 104
265 3300049586 Ga0501070_0907016 Ga0501070_0907016_305_619 104
266 3300005459 Ga0068867_100362510 Ga0068867_1003625102 105
267 3300005718 Ga0068866_10927410 Ga0068866_109274102 105
268 3300006042 Ga0075368_10044930 Ga0075368_100449302 105
269 3300006048 Ga0075363_100056337 Ga0075363_1000563373 105
270 3300006177 Ga0075362_10119215 Ga0075362_101192151 105
271 3300006178 Ga0075367_10128663 Ga0075367_101286632 105
272 3300006195 Ga0075366_11068703 Ga0075366_110687031 105
273 3300006237 Ga0097621_100841321 Ga0097621_1008413212 105
274 3300006353 Ga0075370_10187161 Ga0075370_101871612 105
275 3300009098 Ga0105245_11554601 Ga0105245_115546012 105
276 3300009148 Ga0105243_11756070 Ga0105243_117560703 105
277 3300011119 Ga0105246_10423355 Ga0105246_104233552 105
278 3300026089 Ga0207648_10305738 Ga0207648_103057382 105
279 3300027866 Ga0209813_10200959 Ga0209813_102009592 105
280 3300044693 Ga0466961_0246809 Ga0466961_0246809_285_611 105
281 3300049569 Ga0501032_0070185 Ga0501032_0070185_1644_1964 105
282 3300049570 Ga0501033_0065064 Ga0501033_0065064_542_862 105
283 3300049571 Ga0501034_0046572 Ga0501034_0046572_1348_1668 105
284 3300049571 Ga0501034_0280041 Ga0501034_0280041_151_468 105
285 3300049571 Ga0501034_0431595 Ga0501034_0431595_455_778 105
286 3300049572 Ga0501036_0305338 Ga0501036_0305338_176_496 105
287 3300049574 Ga0501038_0573319 Ga0501038_0573319_361_681 105
288 3300049575 Ga0501039_0151665 Ga0501039_0151665_1058_1378 105
289 3300049586 Ga0501070_1410291 Ga0501070_1410291_189_509 105
290 3300049822 Ga0501035_0033734 Ga0501035_0033734_698_1018 105
291 3300049823 Ga0501044_0016850 Ga0501044_0016850_890_1210 105
292 3300050489 nmdc:mga03683_357930_c1 nmdc:mga03683_357930_c1_355_672 105
293 3300050490 nmdc:mga03n38_267895_c1 nmdc:mga03n38_267895_c1_575_892 105
294 3300050495 nmdc:mga04h51_230521_c1 nmdc:mga04h51_230521_c1_177_494 105
295 3300005335 Ga0070666_10207363 Ga0070666_102073632 106
296 3300005356 Ga0070674_101582937 Ga0070674_1015829371 106
297 3300005548 Ga0070665_102304011 Ga0070665_1023040112 106
298 3300009553 Ga0105249_11552663 Ga0105249_115526631 106
299 3300025903 Ga0207680_10372330 Ga0207680_103723302 106
300 3300028379 Ga0268266_10007362 Ga0268266_100073622 106
301 3300049569 Ga0501032_0426326 Ga0501032_0426326_215_535 106
302 3300049571 Ga0501034_0027699 Ga0501034_0027699_4857_5177 106
303 3300049573 Ga0501037_0421080 Ga0501037_0421080_420_740 106
304 3300049579 Ga0501043_0319921 Ga0501043_0319921_675_995 106
305 3300049581 Ga0501047_0506006 Ga0501047_0506006_296_616 106
306 3300053155 Ga0500620_000353 Ga0500620_000353_2000_2320 106
307 iso_pu_bacteria 2513237090 2513610642 106
308 iso_pu_bacteria 2756170246 2756674852 106
309 iso_pu_bacteria 2906354277 2906360739 106
310 iso_pu_bacteria 2906378014 2906382092 106
311 iso_pu_bacteria 2958100919 2958101943 106
312 iso_pu_bacteria 2958172287 2958173391 106
313 iso_pu_bacteria 2961114664 2961118988 106
314 iso_pu_bacteria 2965119406 2965123820 106
315 iso_pu_bacteria 2968110612 2968115011 106
316 iso_pu_bacteria 2968117919 2968122746 106
317 iso_pu_bacteria 2977942078 2977943430 106
318 iso_pu_bacteria 2977971508 2977974035 106
319 iso_pu_bacteria 2979742915 2979743724 106
320 iso_pu_bacteria 2987636660 2987641441 106
321 iso_pu_bacteria 2987652177 2987656430 106
322 iso_pu_bacteria 3004203850 3004210250 106
323 3300001979 JGI24740J21852_10002208 JGI24740J21852_100022089 107
324 3300001989 JGI24739J22299_10011162 JGI24739J22299_100111623 107
325 3300002067 JGI24735J21928_10125741 JGI24735J21928_101257412 107
326 3300002705 JGI25156J39149_1003248 JGI25156J39149_10032486 107
327 3300002741 JGI25157J39369_1001109 JGI25157J39369_100110915 107
328 3300003203 JGI25406J46586_10008175 JGI25406J46586_100081754 107
329 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078149 107
330 3300003762 Ga0055542_1001659 Ga0055542_10016591 107
331 3300003763 Ga0055529_1006920 Ga0055529_10069202 107
332 3300005327 Ga0070658_10036715 Ga0070658_100367155 107
333 3300005328 Ga0070676_11612538 Ga0070676_116125381 107
334 3300005331 Ga0070670_100639327 Ga0070670_1006393272 107
335 3300005366 Ga0070659_100499604 Ga0070659_1004996041 107
336 3300005366 Ga0070659_101364117 Ga0070659_1013641171 107
337 3300005455 Ga0070663_100324071 Ga0070663_1003240712 107
338 3300005455 Ga0070663_100573506 Ga0070663_1005735062 107
339 3300005455 Ga0070663_100751437 Ga0070663_1007514372 107
340 3300005539 Ga0068853_100013757 Ga0068853_1000137576 107
341 3300005539 Ga0068853_100135177 Ga0068853_1001351773 107
342 3300005539 Ga0068853_100623002 Ga0068853_1006230022 107
343 3300005539 Ga0068853_100838000 Ga0068853_1008380002 107
344 3300005548 Ga0070665_100141205 Ga0070665_1001412052 107
345 3300005548 Ga0070665_100310079 Ga0070665_1003100792 107
346 3300005548 Ga0070665_100478701 Ga0070665_1004787012 107
347 3300005563 Ga0068855_100563068 Ga0068855_1005630682 107
348 3300005577 Ga0068857_100453955 Ga0068857_1004539551 107
349 3300005578 Ga0068854_100798222 Ga0068854_1007982222 107
350 3300005614 Ga0068856_100239043 Ga0068856_1002390433 107
351 3300005614 Ga0068856_100442313 Ga0068856_1004423132 107
352 3300005616 Ga0068852_100134478 Ga0068852_1001344783 107
353 3300005616 Ga0068852_100242084 Ga0068852_1002420841 107
354 3300005616 Ga0068852_100565232 Ga0068852_1005652321 107
355 3300005985 Ga0081539_10000690 Ga0081539_1000069060 107
356 3300006038 Ga0075365_10016702 Ga0075365_100167025 107
357 3300006038 Ga0075365_10021497 Ga0075365_100214974 107
358 3300006038 Ga0075365_10042272 Ga0075365_100422722 107
359 3300006038 Ga0075365_10079739 Ga0075365_100797391 107
360 3300006038 Ga0075365_10118596 Ga0075365_101185962 107
361 3300006042 Ga0075368_10040625 Ga0075368_100406252 107
362 3300006042 Ga0075368_10167776 Ga0075368_101677762 107
363 3300006048 Ga0075363_100018781 Ga0075363_1000187814 107
364 3300006051 Ga0075364_10303748 Ga0075364_103037482 107
365 3300006177 Ga0075362_10030637 Ga0075362_100306372 107
366 3300006178 Ga0075367_10105893 Ga0075367_101058932 107
367 3300006178 Ga0075367_10815115 Ga0075367_108151151 107
368 3300006178 Ga0075367_10887312 Ga0075367_108873121 107
369 3300006195 Ga0075366_10210800 Ga0075366_102108002 107
370 3300006237 Ga0097621_101208537 Ga0097621_1012085372 107
371 3300006353 Ga0075370_10179715 Ga0075370_101797152 107
372 3300006353 Ga0075370_10500118 Ga0075370_105001182 107
373 3300009093 Ga0105240_10119677 Ga0105240_101196773 107
374 3300009093 Ga0105240_11018305 Ga0105240_110183051 107
375 3300009093 Ga0105240_12297335 Ga0105240_122973351 107
376 3300009098 Ga0105245_10577325 Ga0105245_105773252 107
377 3300009101 Ga0105247_10798589 Ga0105247_107985892 107
378 3300009148 Ga0105243_11089450 Ga0105243_110894502 107
379 3300009174 Ga0105241_10146959 Ga0105241_101469593 107
380 3300009174 Ga0105241_10175871 Ga0105241_101758711 107
381 3300009174 Ga0105241_10851255 Ga0105241_108512552 107
382 3300009177 Ga0105248_10238573 Ga0105248_102385733 107
383 3300009545 Ga0105237_10071997 Ga0105237_100719972 107
384 3300009545 Ga0105237_10360901 Ga0105237_103609012 107
385 3300009545 Ga0105237_10509063 Ga0105237_105090632 107
386 3300009551 Ga0105238_10013898 Ga0105238_100138983 107
387 3300009551 Ga0105238_10282251 Ga0105238_102822512 107
388 3300009551 Ga0105238_10297072 Ga0105238_102970722 107
389 3300009551 Ga0105238_12137018 Ga0105238_121370181 107
390 3300009553 Ga0105249_12067336 Ga0105249_120673361 107
391 3300010375 Ga0105239_10767951 Ga0105239_107679512 107
392 3300010375 Ga0105239_11020778 Ga0105239_110207782 107
393 3300010375 Ga0105239_11100259 Ga0105239_111002592 107
394 3300010375 Ga0105239_11122909 Ga0105239_111229092 107
395 3300010375 Ga0105239_11351138 Ga0105239_113511382 107
396 3300010375 Ga0105239_11718183 Ga0105239_117181831 107
397 3300010375 Ga0105239_12196578 Ga0105239_121965781 107
398 3300010375 Ga0105239_12548576 Ga0105239_125485762 107
399 3300013100 Ga0157373_11025670 Ga0157373_110256701 107
400 3300013100 Ga0157373_11159585 Ga0157373_111595851 107
401 3300013104 Ga0157370_10468432 Ga0157370_104684322 107
402 3300013104 Ga0157370_10973263 Ga0157370_109732632 107
403 3300013104 Ga0157370_11430685 Ga0157370_114306851 107
404 3300013104 Ga0157370_12102007 Ga0157370_121020071 107
405 3300013105 Ga0157369_10148306 Ga0157369_101483063 107
406 3300013105 Ga0157369_11278077 Ga0157369_112780772 107
407 3300013296 Ga0157374_10734840 Ga0157374_107348402 107
408 3300013306 Ga0163162_10570432 Ga0163162_105704322 107
409 3300013307 Ga0157372_10649126 Ga0157372_106491262 107
410 3300013307 Ga0157372_10971685 Ga0157372_109716852 107
411 3300014497 Ga0182008_10108479 Ga0182008_101084792 107
412 3300014497 Ga0182008_10766650 Ga0182008_107666501 107
413 3300015261 Ga0182006_1090444 Ga0182006_10904441 107
414 3300015262 Ga0182007_10009758 Ga0182007_100097583 107
415 3300015265 Ga0182005_1014469 Ga0182005_10144693 107
416 3300017792 Ga0163161_10214837 Ga0163161_102148372 107
417 3300017792 Ga0163161_10673667 Ga0163161_106736672 107
418 3300025246 Ga0209646_1021728 Ga0209646_10217282 107
419 3300025250 Ga0209026_1000151 Ga0209026_100015198 107
420 3300025254 Ga0209148_1000032 Ga0209148_1000032470 107
421 3300025256 Ga0209759_1000076 Ga0209759_100007628 107
422 3300025261 Ga0209233_1000150 Ga0209233_100015032 107
423 3300025261 Ga0209233_1019416 Ga0209233_10194162 107
424 3300025272 Ga0209455_1000085 Ga0209455_1000085202 107
425 3300025297 Ga0209758_1018922 Ga0209758_10189221 107
426 3300025321 Ga0207656_10347111 Ga0207656_103471111 107
427 3300025903 Ga0207680_10586341 Ga0207680_105863412 107
428 3300025904 Ga0207647_10018216 Ga0207647_100182168 107
429 3300025904 Ga0207647_10068128 Ga0207647_100681283 107
430 3300025909 Ga0207705_10040424 Ga0207705_100404243 107
431 3300025911 Ga0207654_10118713 Ga0207654_101187132 107
432 3300025913 Ga0207695_10340695 Ga0207695_103406952 107
433 3300025913 Ga0207695_11240446 Ga0207695_112404461 107
434 3300025913 Ga0207695_11481608 Ga0207695_114816081 107
435 3300025914 Ga0207671_10171946 Ga0207671_101719463 107
436 3300025914 Ga0207671_10297898 Ga0207671_102978982 107
437 3300025914 Ga0207671_10475780 Ga0207671_104757802 107
438 3300025919 Ga0207657_10382493 Ga0207657_103824932 107
439 3300025924 Ga0207694_10023324 Ga0207694_100233246 107
440 3300025932 Ga0207690_10430553 Ga0207690_104305531 107
441 3300025932 Ga0207690_10432691 Ga0207690_104326912 107
442 3300025937 Ga0207669_10362308 Ga0207669_103623082 107
443 3300025937 Ga0207669_10811197 Ga0207669_108111972 107
444 3300025941 Ga0207711_10253025 Ga0207711_102530253 107
445 3300025949 Ga0207667_10339317 Ga0207667_103393173 107
446 3300025972 Ga0207668_10413732 Ga0207668_104137322 107
447 3300025981 Ga0207640_10031560 Ga0207640_100315603 107
448 3300025981 Ga0207640_10696186 Ga0207640_106961862 107
449 3300026023 Ga0207677_10875692 Ga0207677_108756921 107
450 3300026041 Ga0207639_10255411 Ga0207639_102554112 107
451 3300026041 Ga0207639_10637203 Ga0207639_106372032 107
452 3300026067 Ga0207678_10240269 Ga0207678_102402692 107
453 3300026067 Ga0207678_10405323 Ga0207678_104053232 107
454 3300026067 Ga0207678_10502327 Ga0207678_105023272 107
455 3300026078 Ga0207702_10134933 Ga0207702_101349332 107
456 3300026078 Ga0207702_10300833 Ga0207702_103008332 107
457 3300026088 Ga0207641_12307462 Ga0207641_123074621 107
458 3300026116 Ga0207674_10449545 Ga0207674_104495452 107
459 3300026116 Ga0207674_10493765 Ga0207674_104937652 107
460 3300026118 Ga0207675_102728560 Ga0207675_1027285601 107
461 3300026142 Ga0207698_10221660 Ga0207698_102216602 107
462 3300026142 Ga0207698_10442033 Ga0207698_104420332 107
463 3300026142 Ga0207698_10938471 Ga0207698_109384712 107
464 3300028379 Ga0268266_10086552 Ga0268266_100865522 107
465 3300028379 Ga0268266_11094017 Ga0268266_110940172 107
466 3300028794 Ga0307515_10646133 Ga0307515_106461331 107
467 3300031456 Ga0307513_10096997 Ga0307513_100969973 107
468 3300032002 Ga0307416_102570015 Ga0307416_1025700152 107
469 3300032005 Ga0307411_10157514 Ga0307411_101575142 107
470 3300037312 Ga0395899_0000107 Ga0395899_0000107_48045_48371 107
471 3300037418 Ga0395900_0000101 Ga0395900_0000101_95717_96043 107
472 3300037418 Ga0395900_0057404 Ga0395900_0057404_3284_3607 107
473 3300037418 Ga0395900_0061014 Ga0395900_0061014_983_1306 107
474 3300037418 Ga0395900_0154761 Ga0395900_0154761_1527_1853 107
475 3300037418 Ga0395900_0176778 Ga0395900_0176778_1237_1563 107
476 3300037418 Ga0395900_0310617 Ga0395900_0310617_896_1219 107
477 3300037466 Ga0395898_0000043 Ga0395898_0000043_48073_48399 107
478 3300037466 Ga0395898_0716761 Ga0395898_0716761_47_373 107
479 3300037466 Ga0395898_0983233 Ga0395898_0983233_330_653 107
480 3300037466 Ga0395898_1897556 Ga0395898_1897556_49_372 107
481 3300037471 Ga0395905_0000101 Ga0395905_0000101_48073_48399 107
482 3300037471 Ga0395905_0193578 Ga0395905_0193578_1388_1711 107
483 3300037471 Ga0395905_0794849 Ga0395905_0794849_376_702 107
484 3300037471 Ga0395905_0861386 Ga0395905_0861386_429_752 107
485 3300037471 Ga0395905_1002005 Ga0395905_1002005_71_403 107
486 3300038443 Ga0395901_0000068 Ga0395901_0000068_48073_48399 107
487 3300038443 Ga0395901_0013412 Ga0395901_0013412_5776_6099 107
488 3300038443 Ga0395901_0901087 Ga0395901_0901087_349_672 107
489 3300038443 Ga0395901_0929491 Ga0395901_0929491_152_478 107
490 3300038443 Ga0395901_1595164 Ga0395901_1595164_55_378 107
491 3300041441 Ga0451787_216693 Ga0451787_216693_100_423 107
492 3300041452 Ga0451793_0945188 Ga0451793_0945188_135_458 107
493 3300041453 Ga0451797_1100702 Ga0451797_1100702_151_474 107
494 3300041459 Ga0451800_0513463 Ga0451800_0513463_21_344 107
495 3300041486 Ga0451807_1983938 Ga0451807_1983938_34_357 107
496 3300041494 Ga0451837_1431403 Ga0451837_1431403_126_449 107
497 3300041503 Ga0451847_0595254 Ga0451847_0595254_149_472 107
498 3300041509 Ga0451843_0850527 Ga0451843_0850527_147_470 107
499 3300042157 Ga0439458_0025487 Ga0439458_0025487_938_1261 107
500 3300044706 Ga0466964_0306713 Ga0466964_0306713_427_750 107
501 3300044735 Ga0466968_0067311 Ga0466968_0067311_488_811 107
502 3300046460 Ga0495638_0370375 Ga0495638_0370375_189_512 107
503 3300046474 Ga0495605_0465109 Ga0495605_0465109_76_399 107
504 3300046507 Ga0495606_0328111 Ga0495606_0328111_88_411 107
505 3300046512 Ga0495610_0097702 Ga0495610_0097702_889_1212 107
506 3300046515 Ga0495620_0195786 Ga0495620_0195786_117_440 107
507 3300046530 Ga0495654_0402291 Ga0495654_0402291_65_388 107
508 3300046542 Ga0495597_0165292 Ga0495597_0165292_62_385 107
509 3300046616 Ga0495668_0094652 Ga0495668_0094652_312_635 107
510 3300046648 Ga0495611_0190365 Ga0495611_0190365_305_628 107
511 3300046660 Ga0495625_0164132 Ga0495625_0164132_586_909 107
512 3300046660 Ga0495625_0195096 Ga0495625_0195096_318_641 107
513 3300046660 Ga0495625_0619346 Ga0495625_0619346_225_548 107
514 3300046665 Ga0495661_0277527 Ga0495661_0277527_216_539 107
515 3300046810 Ga0495660_0170270 Ga0495660_0170270_618_941 107
516 3300047323 Ga0495683_0372531 Ga0495683_0372531_241_564 107
517 3300047443 Ga0495687_067947 Ga0495687_067947_904_1227 107
518 3300047472 Ga0495686_0576145 Ga0495686_0576145_94_417 107
519 3300048091 Ga0495626_0031875 Ga0495626_0031875_878_1201 107
520 3300048907 Ga0496104_1336941 Ga0496104_1336941_263_586 107
521 3300048907 Ga0496104_1719063 Ga0496104_1719063_176_499 107
522 3300048908 Ga0496105_1086695 Ga0496105_1086695_90_413 107
523 3300048913 Ga0496110_0201029 Ga0496110_0201029_1214_1537 107
524 3300048913 Ga0496110_0546520 Ga0496110_0546520_503_826 107
525 3300048913 Ga0496110_0673526 Ga0496110_0673526_371_694 107
526 3300048914 Ga0496111_0110984 Ga0496111_0110984_957_1280 107
527 3300048915 Ga0496112_0109805 Ga0496112_0109805_1105_1428 107
528 3300048915 Ga0496112_0230245 Ga0496112_0230245_1290_1613 107
529 3300048918 Ga0496115_0180213 Ga0496115_0180213_768_1091 107
530 3300048918 Ga0496115_0581379 Ga0496115_0581379_28_360 107
531 3300048920 Ga0496117_0188040 Ga0496117_0188040_778_1101 107
532 3300048921 Ga0496118_0297080 Ga0496118_0297080_157_489 107
533 3300048921 Ga0496118_0372071 Ga0496118_0372071_34_357 107
534 3300048922 Ga0496119_0063371 Ga0496119_0063371_111_434 107
535 3300048922 Ga0496119_0152614 Ga0496119_0152614_435_758 107
536 3300048922 Ga0496119_0395021 Ga0496119_0395021_196_519 107
537 3300048923 Ga0496120_0002559 Ga0496120_0002559_5625_5948 107
538 3300048923 Ga0496120_0034633 Ga0496120_0034633_604_927 107
539 3300048927 Ga0496124_0358816 Ga0496124_0358816_117_440 107
540 3300048928 Ga0496125_0119857 Ga0496125_0119857_69_392 107
541 3300048929 Ga0496126_0164509 Ga0496126_0164509_1133_1456 107
542 3300049569 Ga0501032_0204071 Ga0501032_0204071_694_1020 107
543 3300049570 Ga0501033_0197852 Ga0501033_0197852_108_434 107
544 3300049571 Ga0501034_0828398 Ga0501034_0828398_303_629 107
545 3300049571 Ga0501034_0870666 Ga0501034_0870666_212_538 107
546 3300049581 Ga0501047_0715596 Ga0501047_0715596_90_416 107
547 3300049583 Ga0501067_0055481 Ga0501067_0055481_576_902 107
548 3300049586 Ga0501070_0558242 Ga0501070_0558242_366_692 107
549 3300049586 Ga0501070_1009878 Ga0501070_1009878_166_492 107
550 3300049822 Ga0501035_1150364 Ga0501035_1150364_96_422 107
551 3300050489 nmdc:mga03683_45590_c1 nmdc:mga03683_45590_c1_622_945 107
552 3300050490 nmdc:mga03n38_343979_c1 nmdc:mga03n38_343979_c1_255_578 107
553 3300050490 nmdc:mga03n38_364455_c1 nmdc:mga03n38_364455_c1_248_580 107
554 3300050491 nmdc:mga00v17_140309_c1 nmdc:mga00v17_140309_c1_550_873 107
555 3300050492 nmdc:mga0yw44_111696_c1 nmdc:mga0yw44_111696_c1_678_1001 107
556 3300050492 nmdc:mga0yw44_178571_c1 nmdc:mga0yw44_178571_c1_579_911 107
557 3300050492 nmdc:mga0yw44_2040_c1 nmdc:mga0yw44_2040_c1_8057_8380 107
558 3300050492 nmdc:mga0yw44_25004_c1 nmdc:mga0yw44_25004_c1_2963_3286 107
559 3300050492 nmdc:mga0yw44_455336_c1 nmdc:mga0yw44_455336_c1_18_341 107
560 3300050493 nmdc:mga0k408_533893_c1 nmdc:mga0k408_533893_c1_223_546 107
561 3300050494 nmdc:mga06z11_209638_c1 nmdc:mga06z11_209638_c1_376_708 107
562 3300050494 nmdc:mga06z11_302942_c1 nmdc:mga06z11_302942_c1_297_620 107
563 3300050494 nmdc:mga06z11_7128_c1 nmdc:mga06z11_7128_c1_3840_4163 107
564 3300050496 nmdc:mga07m45_151364_c1 nmdc:mga07m45_151364_c1_749_1081 107
565 3300050496 nmdc:mga07m45_171889_c1 nmdc:mga07m45_171889_c1_677_1000 107
566 3300053083 Ga0495655_0103990 Ga0495655_0103990_74_397 107
567 3300053083 Ga0495655_0215780 Ga0495655_0215780_126_449 107
568 3300053086 Ga0500578_0352177 Ga0500578_0352177_343_666 107
569 3300053090 Ga0500646_0158334 Ga0500646_0158334_274_597 107
570 3300053119 Ga0500595_047738 Ga0500595_047738_261_584 107
571 3300053134 Ga0500658_0203989 Ga0500658_0203989_518_841 107
572 3300053134 Ga0500658_0238311 Ga0500658_0238311_437_760 107
573 3300053151 Ga0500604_0097615 Ga0500604_0097615_176_499 107
574 3300053153 Ga0500616_0207928 Ga0500616_0207928_311_634 107
575 3300053155 Ga0500620_028902 Ga0500620_028902_1399_1722 107
576 3300053155 Ga0500620_060499 Ga0500620_060499_478_801 107
577 3300053158 Ga0500627_0118554 Ga0500627_0118554_218_541 107
578 3300053727 Ga0500611_061806 Ga0500611_061806_229_552 107
579 3300059504 Ga0587082_065643 Ga0587082_065643_218_541 107
580 3300060353 Ga0501082_1504844 Ga0501082_1504844_209_535 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

2

89

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9526 5 95
4b6x-assembly2.cif.gz_B crystal structure of in planta processed avrrps4 0.9395 30 78
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9378 5 88
7t8u-assembly1.cif.gz_A structure of psmbeta2 nanotubes 0.9375 39 76
7t8u-assembly1.cif.gz_C structure of psmbeta2 nanotubes 0.9352 39 76
ID Description Score Start End Superfamily
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9872 5 95 1.10.287.1080
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9662 5 95 1.10.287.1080
1yvwA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9522 5 95 1.10.287.1080
af_Q86I95_32_170_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9464 34 76 1.20.1280.290
3c90A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9413 5 88 1.10.287.1080
ID Description Score Start End GO Terms
AF-A6WX51-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9878 1 107 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A528B9Z4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9873 1 90 GO:0000105
GO:0004636
GO:0005524
AF-C0RFX4-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9843 1 107 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A355RHT4-F1-model_v4 phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) 0.9838 4 76 GO:0000105
GO:0004636
GO:0005524
AF-A0A6B0Z7N5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9768 6 92 GO:0000105
GO:0004636
GO:0005524
GO:0005737

Feature Viewer

pLDDT pTM Quality
90.49 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map