F466100

General Info

Members Datasets Scaffolds Average Seq Length
581 270 1162 183

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0136464|Ga0495663_0136464_49_645
Length 198
Sequence MKIALFFAPLKERKEMAEPLGGLIRTTRVIDRFTDTTGSWIAWLNVPLVLAVSYEVFARYLFNAPTIWSFDVTYMLYGTIFMLGAAYALHKGAHIRTDFFYEKWSVKTKGMVDSISYVVFFFPSLILFLAASGNEAWYAWTIHETSEQTPWRPILWPYKAVVPVTCVLLMLQGVSEVIKSVYAWRTGVELEHKEKIEI

Samples

Sample ID Description Type Environment
1 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
240 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.17
Rhizosphere 99.31
Stem 0
Stem Tuber 0
Unclassified 2.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495663_0136464 3300046525 Bacteria 830
2 JGI24742J22300_10039004 3300002244 Bacteria 843
3 rootL2_10098582 3300003322 Bacteria 1443
4 Ga0065704_10048997 3300005289 Bacteria 772
5 Ga0065715_10539767 3300005293 Bacteria 735
6 Ga0065707_10162417 3300005295 Bacteria 1552
7 Ga0065707_10173005 3300005295 Bacteria 1471
8 Ga0065707_10236602 3300005295 Bacteria 1162
9 Ga0065707_10304391 3300005295 Bacteria 995
10 Ga0070683_100884718 3300005329 Bacteria 857
11 Ga0070690_100067372 3300005330 Bacteria 2319
12 Ga0070690_100099247 3300005330 Bacteria 1928
13 Ga0070690_100162476 3300005330 Bacteria 1531
14 Ga0068869_100084760 3300005334 Bacteria 2372
15 Ga0070666_10079352 3300005335 Bacteria 2242
16 Ga0070680_100004944 3300005336 Bacteria 10037
17 Ga0070680_100181943 3300005336 Bacteria 1770
18 Ga0070680_100208195 3300005336 Bacteria 1650
19 Ga0070680_101071012 3300005336 Unclassified 697
20 Ga0070682_100032167 3300005337 Bacteria 3179
21 Ga0068868_100076429 3300005338 Bacteria 2677
22 Ga0070689_100016666 3300005340 Bacteria 5379
23 Ga0070689_100100240 3300005340 Bacteria 2291
24 Ga0070689_100234177 3300005340 Bacteria 1510
25 Ga0070689_100272462 3300005340 Bacteria 1402
26 Ga0070691_10032606 3300005341 Bacteria 2448
27 Ga0070692_10003772 3300005345 Bacteria 6231
28 Ga0070692_10031298 3300005345 Bacteria 2667
29 Ga0070668_100010867 3300005347 Bacteria 6774
30 Ga0070669_100005087 3300005353 Bacteria 9509
31 Ga0070669_100489702 3300005353 Bacteria 1019
32 Ga0070675_100013865 3300005354 Bacteria 6346
33 Ga0070674_100137328 3300005356 Bacteria 1831
34 Ga0070673_100445932 3300005364 Bacteria 1163
35 Ga0070673_100767185 3300005364 Bacteria 889
36 Ga0070688_100100107 3300005365 Bacteria 1909
37 Ga0070688_100617286 3300005365 Bacteria 832
38 Ga0070703_10019000 3300005406 Bacteria 1991
39 Ga0070714_100075644 3300005435 Bacteria 2922
40 Ga0070713_100632592 3300005436 Bacteria 1018
41 Ga0070701_10024217 3300005438 Bacteria 2935
42 Ga0070701_10284738 3300005438 Bacteria 1010
43 Ga0070705_100000974 3300005440 Bacteria 16059
44 Ga0070705_100001341 3300005440 Bacteria 13133
45 Ga0070700_100030484 3300005441 Bacteria 3224
46 Ga0070700_100049744 3300005441 Bacteria 2603
47 Ga0070700_100848559 3300005441 Bacteria 739
48 Ga0070694_100001628 3300005444 Bacteria 13178
49 Ga0070694_100023032 3300005444 Bacteria 3998
50 Ga0070694_100151778 3300005444 Bacteria 1693
51 Ga0070694_100191082 3300005444 Bacteria 1520
52 Ga0070694_100284050 3300005444 Bacteria 1263
53 Ga0070694_101103594 3300005444 Bacteria 662
54 Ga0070708_100281739 3300005445 Bacteria 1565
55 Ga0070678_101275075 3300005456 Bacteria 683
56 Ga0070681_10001134 3300005458 Bacteria 22908
57 Ga0070681_10806653 3300005458 Bacteria 856
58 Ga0068867_100001149 3300005459 Bacteria 18088
59 Ga0068867_100019717 3300005459 Bacteria 4805
60 Ga0068867_100308954 3300005459 Bacteria 1306
61 Ga0070706_100378908 3300005467 Bacteria 1318
62 Ga0070707_100097822 3300005468 Bacteria 2843
63 Ga0070698_100057229 3300005471 Bacteria 3946
64 Ga0070699_100589686 3300005518 Bacteria 1013
65 Ga0070679_100016778 3300005530 Bacteria 7077
66 Ga0070679_100432236 3300005530 Bacteria 1262
67 Ga0070697_100015045 3300005536 Bacteria 6073
68 Ga0070697_100371343 3300005536 Bacteria 1238
69 Ga0070697_100557792 3300005536 Bacteria 1005
70 Ga0068853_100420705 3300005539 Bacteria 1253
71 Ga0070672_100556129 3300005543 Bacteria 996
72 Ga0070686_100039307 3300005544 Bacteria 2947
73 Ga0070686_100061149 3300005544 Bacteria 2433
74 Ga0070686_100187000 3300005544 Bacteria 1476
75 Ga0070695_100005191 3300005545 Bacteria 7683
76 Ga0070695_100036044 3300005545 Bacteria 3111
77 Ga0070695_100122869 3300005545 Bacteria 1779
78 Ga0070695_100125896 3300005545 Bacteria 1759
79 Ga0070695_100458107 3300005545 Bacteria 979
80 Ga0070696_100000273 3300005546 Bacteria 30956
81 Ga0070696_100000739 3300005546 Bacteria 20870
82 Ga0070696_100000933 3300005546 Bacteria 18945
83 Ga0070696_100054645 3300005546 Bacteria 2783
84 Ga0070696_100137589 3300005546 Bacteria 1782
85 Ga0070696_100159155 3300005546 Bacteria 1663
86 Ga0070696_100281171 3300005546 Bacteria 1269
87 Ga0070693_100001421 3300005547 Bacteria 10813
88 Ga0070693_100185568 3300005547 Unclassified 1342
89 Ga0070704_100000093 3300005549 Bacteria 30795
90 Ga0070704_100000515 3300005549 Bacteria 18450
91 Ga0070704_100100001 3300005549 Bacteria 2182
92 Ga0070704_100109326 3300005549 Bacteria 2101
93 Ga0070704_100267208 3300005549 Bacteria 1411
94 Ga0070704_100273896 3300005549 Bacteria 1395
95 Ga0070704_100544011 3300005549 Bacteria 1014
96 Ga0068855_100006371 3300005563 Bacteria 14381
97 Ga0068857_100224249 3300005577 Bacteria 1717
98 Ga0068854_100017141 3300005578 Bacteria 4843
99 Ga0068856_100007368 3300005614 Bacteria 10738
100 Ga0070702_100000565 3300005615 Bacteria 13487
101 Ga0070702_100245594 3300005615 Bacteria 1210
102 Ga0070702_100431023 3300005615 Bacteria 951
103 Ga0068859_100008910 3300005617 Bacteria 10132
104 Ga0068859_100054296 3300005617 Bacteria 4029
105 Ga0068859_100102868 3300005617 Bacteria 2914
106 Ga0068859_100223324 3300005617 Bacteria 1971
107 Ga0068864_100164190 3300005618 Bacteria 2021
108 Ga0068866_10000746 3300005718 Bacteria 14720
109 Ga0068866_10276385 3300005718 Bacteria 1039
110 Ga0068861_100001913 3300005719 Bacteria 13403
111 Ga0068861_100001922 3300005719 Bacteria 13372
112 Ga0068861_101278643 3300005719 Bacteria 712
113 Ga0068870_10039986 3300005840 Bacteria 2429
114 Ga0068870_10147941 3300005840 Bacteria 1381
115 Ga0068870_10324015 3300005840 Bacteria 980
116 Ga0068863_100362787 3300005841 Bacteria 1413
117 Ga0068860_100008118 3300005843 Bacteria 10455
118 Ga0068862_100017829 3300005844 Bacteria 5911
119 Ga0068862_100038786 3300005844 Bacteria 4042
120 Ga0068862_100622332 3300005844 Bacteria 1039
121 Ga0081538_10035515 3300005981 Bacteria 3272
122 Ga0081539_10000365 3300005985 Bacteria 99063
123 Ga0070716_100095464 3300006173 Bacteria 1810
124 Ga0075362_10198970 3300006177 Bacteria 975
125 Ga0097621_100001187 3300006237 Bacteria 18061
126 Ga0097621_100004204 3300006237 Bacteria 9992
127 Ga0068871_100024686 3300006358 Bacteria 4664
128 Ga0068871_100025566 3300006358 Bacteria 4596
129 Ga0075428_100000502 3300006844 Bacteria 39707
130 Ga0075428_100002035 3300006844 Bacteria 21794
131 Ga0075428_100341990 3300006844 Bacteria 1606
132 Ga0075428_100455879 3300006844 Bacteria 1369
133 Ga0075428_100524127 3300006844 Bacteria 1267
134 Ga0075428_100593693 3300006844 Bacteria 1183
135 Ga0075428_101171261 3300006844 Bacteria 811
136 Ga0075430_100000620 3300006846 Bacteria 27115
137 Ga0075430_100007238 3300006846 Bacteria 9371
138 Ga0075430_100014819 3300006846 Bacteria 6639
139 Ga0075430_100248243 3300006846 Bacteria 1475
140 Ga0075430_100641390 3300006846 Bacteria 876
141 Ga0075431_100066156 3300006847 Bacteria 3731
142 Ga0075431_100074130 3300006847 Bacteria 3512
143 Ga0075431_100128621 3300006847 Bacteria 2613
144 Ga0075431_100145990 3300006847 Bacteria 2438
145 Ga0075431_100603829 3300006847 Bacteria 1081
146 Ga0075431_100707544 3300006847 Bacteria 985
147 Ga0075433_10000611 3300006852 Bacteria 23830
148 Ga0075433_10233296 3300006852 Bacteria 1634
149 Ga0075433_10322407 3300006852 Bacteria 1367
150 Ga0075433_10441807 3300006852 Bacteria 1147
151 Ga0075434_100000406 3300006871 Bacteria 31740
152 Ga0075434_100007989 3300006871 Bacteria 9807
153 Ga0075434_100064318 3300006871 Bacteria 3652
154 Ga0075429_100000081 3300006880 Bacteria 49207
155 Ga0075429_100000145 3300006880 Bacteria 43529
156 Ga0075429_100078877 3300006880 Bacteria 2870
157 Ga0075429_100123110 3300006880 Bacteria 2267
158 Ga0075429_100128615 3300006880 Bacteria 2216
159 Ga0075429_100250289 3300006880 Bacteria 1552
160 Ga0068865_100000922 3300006881 Bacteria 16653
161 Ga0068865_100001100 3300006881 Bacteria 15603
162 Ga0075436_100000375 3300006914 Bacteria 28483
163 Ga0075436_100000513 3300006914 Bacteria 25110
164 Ga0075436_100275724 3300006914 Bacteria 1202
165 Ga0097620_100008910 3300006931 Bacteria 10132
166 Ga0097620_100054294 3300006931 Bacteria 4029
167 Ga0097620_100102861 3300006931 Bacteria 2914
168 Ga0097620_100223334 3300006931 Bacteria 1971
169 Ga0075435_100000668 3300007076 Bacteria 21181
170 Ga0075435_100000820 3300007076 Bacteria 19375
171 Ga0075435_100038536 3300007076 Bacteria 3810
172 Ga0075435_100094652 3300007076 Bacteria 2469
173 Ga0075435_100122190 3300007076 Bacteria 2174
174 Ga0075435_100194868 3300007076 Bacteria 1716
175 Ga0099794_10018041 3300007265 Bacteria 3158
176 Ga0099794_10027883 3300007265 Bacteria 2622
177 Ga0099794_10240426 3300007265 Bacteria 933
178 Ga0105240_10374347 3300009093 Bacteria 1609
179 Ga0111539_10022821 3300009094 Bacteria 7686
180 Ga0111539_10096189 3300009094 Bacteria 3478
181 Ga0111539_10141863 3300009094 Bacteria 2812
182 Ga0111539_10220095 3300009094 Bacteria 2211
183 Ga0111539_10368556 3300009094 Bacteria 1672
184 Ga0111539_10869191 3300009094 Bacteria 1049
185 Ga0111539_11318386 3300009094 Bacteria 838
186 Ga0105245_10004790 3300009098 Bacteria 11943
187 Ga0105245_10125608 3300009098 Bacteria 2401
188 Ga0114129_10000393 3300009147 Bacteria 51077
189 Ga0114129_10002113 3300009147 Bacteria 27369
190 Ga0114129_10076304 3300009147 Bacteria 4667
191 Ga0114129_10196261 3300009147 Bacteria 2737
192 Ga0114129_10471699 3300009147 Bacteria 1643
193 Ga0114129_12808972 3300009147 Bacteria 578
194 Ga0105243_10016884 3300009148 Bacteria 5520
195 Ga0105243_10047896 3300009148 Bacteria 3367
196 Ga0105243_10231139 3300009148 Bacteria 1641
197 Ga0105243_11198363 3300009148 Unclassified 772
198 Ga0105241_10077029 3300009174 Unclassified 2602
199 Ga0105242_10000296 3300009176 Bacteria 39554
200 Ga0105242_10008018 3300009176 Bacteria 8134
201 Ga0105242_11420768 3300009176 Bacteria 722
202 Ga0105248_10824065 3300009177 Bacteria 1047
203 Ga0105249_10001763 3300009553 Bacteria 18843
204 Ga0105239_10495774 3300010375 Bacteria 1388
205 Ga0105246_10048210 3300011119 Bacteria 2912
206 Ga0157378_10003195 3300013297 Bacteria 14558
207 Ga0157378_10260458 3300013297 Bacteria 1664
208 Ga0163162_10147275 3300013306 Bacteria 2471
209 Ga0157372_10613611 3300013307 Bacteria 1268
210 Ga0157375_10840041 3300013308 Bacteria 1065
211 Ga0157375_11010906 3300013308 Bacteria 971
212 Ga0157380_10029114 3300014326 Bacteria 4220
213 Ga0157380_10279714 3300014326 Bacteria 1526
214 Ga0157377_10034443 3300014745 Bacteria 2770
215 Ga0157379_10053730 3300014968 Bacteria 3599
216 Ga0157376_10011070 3300014969 Bacteria 6633
217 Ga0207653_10007973 3300025885 Bacteria 3301
218 Ga0207653_10019105 3300025885 Bacteria 2161
219 Ga0207642_10014619 3300025899 Bacteria 2901
220 Ga0207642_10265018 3300025899 Bacteria 981
221 Ga0207688_10069086 3300025901 Bacteria 2002
222 Ga0207688_10135061 3300025901 Bacteria 1448
223 Ga0207680_10187394 3300025903 Bacteria 1402
224 Ga0207685_10152804 3300025905 Bacteria 1046
225 Ga0207643_10039448 3300025908 Bacteria 2656
226 Ga0207643_10048143 3300025908 Bacteria 2414
227 Ga0207684_10239857 3300025910 Bacteria 1564
228 Ga0207707_10008207 3300025912 Bacteria 9062
229 Ga0207707_10156666 3300025912 Bacteria 1992
230 Ga0207707_11284380 3300025912 Unclassified 589
231 Ga0207660_10033615 3300025917 Bacteria 3549
232 Ga0207660_10074307 3300025917 Bacteria 2481
233 Ga0207660_10216392 3300025917 Bacteria 1502
234 Ga0207660_10631775 3300025917 Bacteria 873
235 Ga0207662_10000024 3300025918 Bacteria 70677
236 Ga0207662_10246786 3300025918 Bacteria 1171
237 Ga0207662_10287659 3300025918 Bacteria 1089
238 Ga0207662_10356794 3300025918 Bacteria 983
239 Ga0207652_10581920 3300025921 Bacteria 1005
240 Ga0207646_10549906 3300025922 Bacteria 1038
241 Ga0207681_10001419 3300025923 Bacteria 15459
242 Ga0207659_10055430 3300025926 Bacteria 2835
243 Ga0207687_10030729 3300025927 Bacteria 3624
244 Ga0207687_10582823 3300025927 Bacteria 941
245 Ga0207700_10343191 3300025928 Bacteria 1299
246 Ga0207706_10102730 3300025933 Bacteria 2515
247 Ga0207686_10001177 3300025934 Bacteria 15116
248 Ga0207686_10010567 3300025934 Bacteria 5030
249 Ga0207709_10009182 3300025935 Bacteria 5447
250 Ga0207709_10010644 3300025935 Bacteria 5067
251 Ga0207709_10460929 3300025935 Bacteria 984
252 Ga0207670_10002055 3300025936 Bacteria 10541
253 Ga0207670_10164267 3300025936 Bacteria 1660
254 Ga0207670_10203145 3300025936 Bacteria 1507
255 Ga0207669_10062535 3300025937 Bacteria 2293
256 Ga0207704_10000918 3300025938 Bacteria 13025
257 Ga0207704_10003103 3300025938 Bacteria 7512
258 Ga0207665_10046937 3300025939 Bacteria 2895
259 Ga0207691_10214908 3300025940 Bacteria 1669
260 Ga0207691_10562949 3300025940 Bacteria 966
261 Ga0207689_10063599 3300025942 Bacteria 3035
262 Ga0207689_10068059 3300025942 Bacteria 2926
263 Ga0207667_10005789 3300025949 Bacteria 15080
264 Ga0207651_10019775 3300025960 Bacteria 4046
265 Ga0207651_10609819 3300025960 Bacteria 955
266 Ga0207712_10013044 3300025961 Bacteria 5323
267 Ga0207712_10022123 3300025961 Bacteria 4184
268 Ga0207668_10012611 3300025972 Bacteria 5180
269 Ga0207640_10007225 3300025981 Bacteria 6125
270 Ga0207677_10000875 3300026023 Bacteria 17082
271 Ga0207703_10199071 3300026035 Bacteria 1779
272 Ga0207639_10642603 3300026041 Bacteria 981
273 Ga0207708_10002074 3300026075 Bacteria 14763
274 Ga0207708_10374779 3300026075 Bacteria 1172
275 Ga0207708_10543052 3300026075 Bacteria 979
276 Ga0207708_10547219 3300026075 Bacteria 976
277 Ga0207708_10694568 3300026075 Unclassified 869
278 Ga0207702_10209225 3300026078 Bacteria 1812
279 Ga0207641_10133363 3300026088 Bacteria 2233
280 Ga0207648_10005161 3300026089 Bacteria 13223
281 Ga0207648_10014513 3300026089 Bacteria 7275
282 Ga0207648_10049940 3300026089 Bacteria 3658
283 Ga0207648_11112681 3300026089 Bacteria 741
284 Ga0207676_10272943 3300026095 Bacteria 1532
285 Ga0207676_10702801 3300026095 Bacteria 980
286 Ga0207674_10142260 3300026116 Bacteria 2358
287 Ga0207675_100000954 3300026118 Bacteria 28821
288 Ga0207675_100002609 3300026118 Bacteria 17841
289 Ga0207683_10102509 3300026121 Bacteria 2556
290 Ga0209969_1004100 3300027360 Bacteria 2036
291 Ga0209969_1016375 3300027360 Bacteria 1087
292 Ga0209967_1003038 3300027364 Bacteria 2199
293 Ga0209981_1030401 3300027378 Bacteria 791
294 Ga0209996_1010823 3300027395 Bacteria 1213
295 Ga0209996_1022382 3300027395 Bacteria 894
296 Ga0210000_1004382 3300027462 Bacteria 2040
297 Ga0210000_1016163 3300027462 Bacteria 1126
298 Ga0209995_1001101 3300027471 Bacteria 4155
299 Ga0209995_1016483 3300027471 Bacteria 1214
300 Ga0209995_1037772 3300027471 Bacteria 813
301 Ga0209968_1022480 3300027526 Bacteria 1029
302 Ga0209999_1007147 3300027543 Bacteria 2009
303 Ga0209999_1010557 3300027543 Bacteria 1669
304 Ga0210002_1055064 3300027617 Bacteria 689
305 Ga0209966_1001585 3300027695 Bacteria 3913
306 Ga0209966_1019647 3300027695 Bacteria 1303
307 Ga0207428_10009302 3300027907 Bacteria 8817
308 Ga0207428_10028030 3300027907 Bacteria 4682
309 Ga0207428_10036346 3300027907 Bacteria 4018
310 Ga0268265_10004469 3300028380 Bacteria 9692
311 Ga0268265_10009414 3300028380 Bacteria 6597
312 Ga0268265_10335398 3300028380 Unclassified 1375
313 Ga0268265_10360989 3300028380 Bacteria 1330
314 Ga0268264_10000841 3300028381 Bacteria 32855
315 Ga0268264_10741826 3300028381 Bacteria 978
316 Ga0307408_100078396 3300031548 Bacteria 2462
317 Ga0307408_100539331 3300031548 Bacteria 1028
318 Ga0307413_10475038 3300031824 Bacteria 998
319 Ga0307410_10820010 3300031852 Bacteria 792
320 Ga0307407_10584124 3300031903 Bacteria 830
321 Ga0307409_100208017 3300031995 Bacteria 1756
322 Ga0307416_100409488 3300032002 Bacteria 1396
323 Ga0307416_100428887 3300032002 Bacteria 1369
324 Ga0307416_100568855 3300032002 Bacteria 1209
325 Ga0307411_10152968 3300032005 Bacteria 1717
326 Ga0307411_10206451 3300032005 Bacteria 1513
327 Ga0373930_0046016 3300034816 Bacteria 941
328 Ga0373948_0002713 3300034817 Bacteria 2647
329 Ga0373950_0007812 3300034818 Bacteria 1669
330 Ga0373938_0025120 3300034957 Bacteria 1237
331 Ga0373928_0018806 3300035084 Bacteria 1436
332 Ga0373929_0069443 3300035085 Bacteria 840
333 Ga0373940_0024050 3300035088 Bacteria 1577
334 Ga0373932_0001177 3300035112 Bacteria 7478
335 Ga0373936_0202024 3300035113 Bacteria 877
336 Ga0373939_0049430 3300035114 Unclassified 1300
337 Ga0373941_0014998 3300035115 Bacteria 2082
338 Ga0373941_0055604 3300035115 Bacteria 1272
339 Ga0373941_0171538 3300035115 Bacteria 809
340 Ga0373961_0002326 3300035241 Bacteria 4967
341 Ga0373961_0152895 3300035241 Bacteria 787
342 Ga0373962_0077378 3300035242 Bacteria 1004
343 Ga0373931_0000177 3300035691 Bacteria 27824
344 Ga0373931_0012034 3300035691 Bacteria 4188
345 Ga0373931_0026008 3300035691 Bacteria 2975
346 Ga0373931_0187183 3300035691 Bacteria 1229
347 Ga0373931_0386226 3300035691 Bacteria 884
348 Ga0373937_0127278 3300036401 Bacteria 2377
349 Ga0439439_0031632 3300041406 Bacteria 1349
350 Ga0439453_0027668 3300041408 Bacteria 1057
351 Ga0439461_0049558 3300041410 Bacteria 928
352 Ga0451804_1068127 3300041463 Bacteria 959
353 Ga0451853_1506806 3300041512 Bacteria 1485
354 Ga0439441_013204 3300042001 Bacteria 1430
355 Ga0439443_001907 3300042003 Bacteria 2405
356 Ga0439450_070826 3300042008 Bacteria 855
357 Ga0439451_005225 3300042009 Bacteria 2642
358 Ga0439462_0097402 3300042015 Bacteria 809
359 Ga0439446_0003451 3300042156 Bacteria 3927
360 Ga0439434_0003761 3300042435 Bacteria 4434
361 Ga0439434_0170684 3300042435 Bacteria 726
362 Ga0439435_0000966 3300042436 Bacteria 5009
363 Ga0439435_0018938 3300042436 Bacteria 1757
364 Ga0439444_0000672 3300042437 Bacteria 4001
365 Ga0439444_0009256 3300042437 Bacteria 1549
366 Ga0439459_0016797 3300042438 Bacteria 1356
367 Ga0439460_0001831 3300042461 Bacteria 5068
368 Ga0451577_0164051 3300042876 Bacteria 2002
369 Ga0451576_0009298 3300045051 Bacteria 11411
370 Ga0451576_0020989 3300045051 Bacteria 7107
371 Ga0451576_0026259 3300045051 Bacteria 6265
372 Ga0495603_0192646 3300046455 Bacteria 1179
373 Ga0495662_0043151 3300046476 Bacteria 2177
374 Ga0495608_0037973 3300046511 Bacteria 3237
375 Ga0495628_0009779 3300046516 Bacteria 8172
376 Ga0495630_0019320 3300046517 Bacteria 5008
377 Ga0495630_0827260 3300046517 Bacteria 706
378 Ga0495666_0031461 3300046526 Bacteria 2600
379 Ga0495652_0031366 3300046529 Bacteria 4655
380 Ga0495640_0032561 3300046533 Bacteria 3712
381 Ga0495640_0088600 3300046533 Bacteria 2045
382 Ga0495586_0011534 3300046535 Bacteria 4701
383 Ga0495586_0027203 3300046535 Bacteria 3060
384 Ga0495598_0245694 3300046537 Unclassified 661
385 Ga0495621_0008822 3300046539 Bacteria 3037
386 Ga0495621_0078555 3300046539 Bacteria 1227
387 Ga0495621_0099042 3300046539 Bacteria 1107
388 Ga0495621_0117572 3300046539 Bacteria 1025
389 Ga0495667_0014782 3300046559 Bacteria 5275
390 Ga0495635_0073380 3300046663 Bacteria 2344
391 Ga0495659_0048579 3300046664 Bacteria 1538
392 Ga0495646_0141136 3300046680 Bacteria 1347
393 Ga0495658_0021201 3300046683 Bacteria 3423
394 Ga0495658_0034706 3300046683 Bacteria 2769
395 Ga0495669_0022285 3300046684 Bacteria 2751
396 Ga0495669_0046200 3300046684 Bacteria 1943
397 Ga0495669_0166321 3300046684 Bacteria 1048
398 Ga0495613_0008807 3300046689 Bacteria 7483
399 Ga0495624_0056350 3300046690 Bacteria 2473
400 Ga0495600_0012118 3300046809 Bacteria 5385
401 Ga0495581_0205766 3300047315 Bacteria 1151
402 Ga0495604_0017573 3300047317 Bacteria 5726
403 Ga0495636_0001613 3300047318 Bacteria 8574
404 Ga0495680_0004125 3300047322 Bacteria 13968
405 Ga0501291_019296 3300049514 Bacteria 1069
406 Ga0501298_009420 3300049521 Bacteria 1661
407 Ga0501299_029320 3300049522 Bacteria 1053
408 Ga0501031_0026854 3300049568 Bacteria 3753
409 Ga0501031_0285658 3300049568 Bacteria 1070
410 Ga0501033_0016766 3300049570 Bacteria 5542
411 Ga0501034_1345022 3300049571 Unclassified 590
412 Ga0501036_0008179 3300049572 Bacteria 8575
413 Ga0501036_0400854 3300049572 Bacteria 1144
414 Ga0501036_0734589 3300049572 Bacteria 815
415 Ga0501037_0012879 3300049573 Bacteria 6165
416 Ga0501037_0042031 3300049573 Bacteria 3360
417 Ga0501037_0202080 3300049573 Bacteria 1404
418 Ga0501038_0011271 3300049574 Bacteria 8163
419 Ga0501038_0034843 3300049574 Bacteria 4424
420 Ga0501039_0007682 3300049575 Bacteria 8231
421 Ga0501039_0020405 3300049575 Bacteria 5078
422 Ga0501039_0163118 3300049575 Bacteria 1752
423 Ga0501039_0190250 3300049575 Bacteria 1614
424 Ga0501039_0237314 3300049575 Bacteria 1434
425 Ga0501039_0251229 3300049575 Bacteria 1390
426 Ga0501039_0268630 3300049575 Unclassified 1341
427 Ga0501040_0006268 3300049576 Bacteria 7722
428 Ga0501040_0028332 3300049576 Bacteria 3775
429 Ga0501040_0030687 3300049576 Bacteria 3631
430 Ga0501040_0053644 3300049576 Bacteria 2762
431 Ga0501040_0105899 3300049576 Bacteria 1965
432 Ga0501041_0000358 3300049577 Bacteria 22614
433 Ga0501041_0007744 3300049577 Bacteria 6307
434 Ga0501042_0000291 3300049578 Bacteria 24757
435 Ga0501042_0096681 3300049578 Bacteria 2122
436 Ga0501042_0180846 3300049578 Bacteria 1521
437 Ga0501042_0309311 3300049578 Bacteria 1142
438 Ga0501042_0377229 3300049578 Bacteria 1027
439 Ga0501043_0048212 3300049579 Bacteria 3349
440 Ga0501043_0230598 3300049579 Bacteria 1430
441 Ga0501043_0417302 3300049579 Bacteria 1012
442 Ga0501046_0010378 3300049580 Bacteria 8003
443 Ga0501046_0073060 3300049580 Bacteria 2662
444 Ga0501047_1089663 3300049581 Bacteria 612
445 Ga0501048_0016337 3300049582 Bacteria 5469
446 Ga0501048_0520648 3300049582 Bacteria 853
447 Ga0501068_0109167 3300049584 Bacteria 1719
448 Ga0501069_0209621 3300049585 Bacteria 1131
449 Ga0501071_0004120 3300049587 Bacteria 9189
450 Ga0501071_0050912 3300049587 Bacteria 2983
451 Ga0501071_0053220 3300049587 Bacteria 2919
452 Ga0501071_0092717 3300049587 Bacteria 2220
453 Ga0501071_0399535 3300049587 Bacteria 1049
454 Ga0501072_0000720 3300049588 Bacteria 24044
455 Ga0501072_0001286 3300049588 Bacteria 18770
456 Ga0501072_0016019 3300049588 Bacteria 5749
457 Ga0501072_0133284 3300049588 Bacteria 1981
458 Ga0501072_0140334 3300049588 Bacteria 1926
459 Ga0501072_0148958 3300049588 Bacteria 1866
460 Ga0501072_0311253 3300049588 Bacteria 1252
461 Ga0501072_0366753 3300049588 Bacteria 1143
462 Ga0501074_0056482 3300049590 Bacteria 2829
463 Ga0501074_0408588 3300049590 Bacteria 963
464 Ga0501074_0723867 3300049590 Bacteria 702
465 Ga0501075_0005455 3300049591 Bacteria 8697
466 Ga0501075_0052774 3300049591 Bacteria 3057
467 Ga0501075_0060896 3300049591 Bacteria 2843
468 Ga0501075_0248915 3300049591 Bacteria 1354
469 Ga0501076_0002120 3300049592 Bacteria 13613
470 Ga0501076_0002813 3300049592 Bacteria 12033
471 Ga0501076_0003881 3300049592 Bacteria 10528
472 Ga0501076_0590243 3300049592 Bacteria 916
473 Ga0501077_0004484 3300049593 Bacteria 8478
474 Ga0501077_0020675 3300049593 Bacteria 4167
475 Ga0501077_0033120 3300049593 Bacteria 3290
476 Ga0501077_0130444 3300049593 Bacteria 1594
477 Ga0501209_049413 3300049656 Bacteria 1143
478 Ga0501216_047758 3300049660 Bacteria 835
479 Ga0501217_024459 3300049661 Bacteria 1445
480 Ga0501217_215945 3300049661 Bacteria 604
481 Ga0501249_029062 3300049679 Bacteria 1228
482 Ga0501219_011674 3300049703 Bacteria 673
483 Ga0501225_0039011 3300049705 Bacteria 1309
484 Ga0501234_038330 3300049707 Bacteria 782
485 Ga0501245_016687 3300049708 Bacteria 1116
486 Ga0501079_0013275 3300049741 Bacteria 6280
487 Ga0501079_0015686 3300049741 Bacteria 5787
488 Ga0501079_0088100 3300049741 Bacteria 2403
489 Ga0501079_0253768 3300049741 Bacteria 1375
490 Ga0501080_0109009 3300049742 Bacteria 2566
491 Ga0501080_0138422 3300049742 Bacteria 2252
492 Ga0501080_0151342 3300049742 Bacteria 2144
493 Ga0501080_0290203 3300049742 Bacteria 1485
494 Ga0501081_0002739 3300049743 Bacteria 11163
495 Ga0501081_0003592 3300049743 Bacteria 9924
496 Ga0501081_0010072 3300049743 Bacteria 6165
497 Ga0501081_0226647 3300049743 Bacteria 1360
498 Ga0501081_0232757 3300049743 Unclassified 1342
499 Ga0501083_0113734 3300049744 Bacteria 1778
500 Ga0501083_0327977 3300049744 Bacteria 995
501 Ga0501083_0541927 3300049744 Bacteria 757
502 Ga0501280_095625 3300049776 Bacteria 565
503 Ga0501283_056889 3300049779 Bacteria 701
504 Ga0501035_0010832 3300049822 Bacteria 8445
505 Ga0501035_0092695 3300049822 Bacteria 2658
506 Ga0501035_0104044 3300049822 Bacteria 2490
507 Ga0501044_0333287 3300049823 Bacteria 1440
508 Ga0501045_0005295 3300049824 Bacteria 8938
509 Ga0501045_0366137 3300049824 Bacteria 1073
510 Ga0501226_015909 3300049853 Bacteria 829
511 nmdc:mga05p37_2146_c1 3300050507 Bacteria 23034
512 nmdc:mga05p37_266246_c1 3300050507 Bacteria 2049
513 nmdc:mga05p37_572138_c1 3300050507 Bacteria 1281
514 nmdc:mga05p37_74562_c1 3300050507 Bacteria 4176
515 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
516 nmdc:mga09592_109817_c1 3300050508 Bacteria 2366
517 nmdc:mga09592_126809_c1 3300050508 Bacteria 2194
518 nmdc:mga09592_1359803_c1 3300050508 Bacteria 582
519 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
520 nmdc:mga09592_253145_c1 3300050508 Bacteria 1527
521 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
522 nmdc:mga09592_34000_c1 3300050508 Bacteria 4260
523 nmdc:mga09592_422796_c1 3300050508 Bacteria 1151
524 nmdc:mga09592_87291_c1 3300050508 Bacteria 2663
525 nmdc:mga0qj67_1004775_c1 3300050509 Bacteria 654
526 nmdc:mga0qj67_12222_c1 3300050509 Bacteria 6463
527 nmdc:mga0qj67_350279_c1 3300050509 Bacteria 1194
528 nmdc:mga0qj67_38899_c1 3300050509 Bacteria 3733
529 nmdc:mga0qj67_58443_c1 3300050509 Bacteria 3058
530 nmdc:mga0qj67_715866_c1 3300050509 Bacteria 796
531 nmdc:mga0qj67_740_c1 3300050509 Bacteria 22151
532 nmdc:mga0qj67_873766_c1 3300050509 Unclassified 709
533 nmdc:mga0qj67_933637_c1 3300050509 Bacteria 683
534 nmdc:mga06r32_124849_c2 3300050510 Bacteria 792
535 nmdc:mga06r32_21812_c1 3300050510 Bacteria 5914
536 nmdc:mga06r32_248162_c1 3300050510 Bacteria 1768
537 nmdc:mga06r32_33186_c1 3300050510 Bacteria 4861
538 nmdc:mga06r32_354814_c1 3300050510 Bacteria 1451
539 nmdc:mga06r32_451746_c1 3300050510 Bacteria 1265
540 nmdc:mga06r32_81914_c1 3300050510 Bacteria 3143
541 nmdc:mga06r32_89483_c1 3300050510 Bacteria 3006
542 nmdc:mga08y16_142861_c1 3300050511 Bacteria 2488
543 nmdc:mga08y16_1941_c1 3300050511 Bacteria 21104
544 nmdc:mga08y16_21668_c1 3300050511 Bacteria 6784
545 nmdc:mga08y16_220096_c1 3300050511 Bacteria 1966
546 nmdc:mga08y16_377830_c1 3300050511 Bacteria 1453
547 nmdc:mga08y16_79226_c1 3300050511 Bacteria 3424
548 nmdc:mga08y16_864518_c1 3300050511 Bacteria 893
549 nmdc:mga08y16_873553_c1 3300050511 Bacteria 887
550 nmdc:mga08y16_916981_c1 3300050511 Bacteria 861
551 nmdc:mga0n895_1820_c1 3300050512 Bacteria 16236
552 nmdc:mga0n895_83407_c1 3300050512 Bacteria 3188
553 nmdc:mga0n895_924_c1 3300050512 Bacteria 21172
554 nmdc:mga0rr50_1686_c1 3300050513 Bacteria 12197
555 nmdc:mga0rr50_2253_c1 3300050513 Bacteria 10830
556 nmdc:mga0rr50_4538_c1 3300050513 Bacteria 8177
557 nmdc:mga08x19_280598_c1 3300050514 Bacteria 1154
558 nmdc:mga08x19_418697_c1 3300050514 Bacteria 941
559 nmdc:mga08x19_46296_c1 3300050514 Bacteria 2453
560 nmdc:mga08x19_820_c1 3300050514 Bacteria 19741
561 nmdc:mga08x19_834_c1 3300050514 Bacteria 19567
562 nmdc:mga08x19_8472_c1 3300050514 Bacteria 6124
563 nmdc:mga0a205_1015089_c1 3300050515 Bacteria 677
564 nmdc:mga0a205_14210_c1 3300050515 Bacteria 7425
565 nmdc:mga0a205_642632_c1 3300050515 Bacteria 912
566 nmdc:mga0a205_821_c1 3300050515 Bacteria 25293
567 Ga0495612_0043897 3300053078 Bacteria 1828
568 Ga0501084_0000832 3300054114 Bacteria 23774
569 Ga0501084_0031510 3300054114 Bacteria 4433
570 Ga0501084_0036193 3300054114 Bacteria 4124
571 Ga0501084_0079464 3300054114 Bacteria 2749
572 Ga0501084_1106066 3300054114 Bacteria 665
573 Ga0590077_012905 3300059426 Bacteria 1734
574 Ga0590077_025698 3300059426 Bacteria 1270
575 Ga0501082_0013472 3300060353 Bacteria 7024
576 Ga0501082_0016106 3300060353 Bacteria 6431
577 Ga0501082_0154999 3300060353 Bacteria 1990
578 Ga0501082_0330478 3300060353 Bacteria 1328
579 Ga0530510_0000042 3300061734 Bacteria 58436
580 Ga0530510_0002067 3300061734 Bacteria 13794
581 Ga0530510_0003012 3300061734 Bacteria 11558
582 Ga0495663_0136464
583 JGI24742J22300_10039004
584 rootL2_10098582
585 Ga0065704_10048997
586 Ga0065715_10539767
587 Ga0065707_10162417
588 Ga0065707_10173005
589 Ga0065707_10236602
590 Ga0065707_10304391
591 Ga0070683_100884718
592 Ga0070690_100067372
593 Ga0070690_100099247
594 Ga0070690_100162476
595 Ga0068869_100084760
596 Ga0070666_10079352
597 Ga0070680_100004944
598 Ga0070680_100181943
599 Ga0070680_100208195
600 Ga0070680_101071012
601 Ga0070682_100032167
602 Ga0068868_100076429
603 Ga0070689_100016666
604 Ga0070689_100100240
605 Ga0070689_100234177
606 Ga0070689_100272462
607 Ga0070691_10032606
608 Ga0070692_10003772
609 Ga0070692_10031298
610 Ga0070668_100010867
611 Ga0070669_100005087
612 Ga0070669_100489702
613 Ga0070675_100013865
614 Ga0070674_100137328
615 Ga0070673_100445932
616 Ga0070673_100767185
617 Ga0070688_100100107
618 Ga0070688_100617286
619 Ga0070703_10019000
620 Ga0070714_100075644
621 Ga0070713_100632592
622 Ga0070701_10024217
623 Ga0070701_10284738
624 Ga0070705_100000974
625 Ga0070705_100001341
626 Ga0070700_100030484
627 Ga0070700_100049744
628 Ga0070700_100848559
629 Ga0070694_100001628
630 Ga0070694_100023032
631 Ga0070694_100151778
632 Ga0070694_100191082
633 Ga0070694_100284050
634 Ga0070694_101103594
635 Ga0070708_100281739
636 Ga0070678_101275075
637 Ga0070681_10001134
638 Ga0070681_10806653
639 Ga0068867_100001149
640 Ga0068867_100019717
641 Ga0068867_100308954
642 Ga0070706_100378908
643 Ga0070707_100097822
644 Ga0070698_100057229
645 Ga0070699_100589686
646 Ga0070679_100016778
647 Ga0070679_100432236
648 Ga0070697_100015045
649 Ga0070697_100371343
650 Ga0070697_100557792
651 Ga0068853_100420705
652 Ga0070672_100556129
653 Ga0070686_100039307
654 Ga0070686_100061149
655 Ga0070686_100187000
656 Ga0070695_100005191
657 Ga0070695_100036044
658 Ga0070695_100122869
659 Ga0070695_100125896
660 Ga0070695_100458107
661 Ga0070696_100000273
662 Ga0070696_100000739
663 Ga0070696_100000933
664 Ga0070696_100054645
665 Ga0070696_100137589
666 Ga0070696_100159155
667 Ga0070696_100281171
668 Ga0070693_100001421
669 Ga0070693_100185568
670 Ga0070704_100000093
671 Ga0070704_100000515
672 Ga0070704_100100001
673 Ga0070704_100109326
674 Ga0070704_100267208
675 Ga0070704_100273896
676 Ga0070704_100544011
677 Ga0068855_100006371
678 Ga0068857_100224249
679 Ga0068854_100017141
680 Ga0068856_100007368
681 Ga0070702_100000565
682 Ga0070702_100245594
683 Ga0070702_100431023
684 Ga0068859_100008910
685 Ga0068859_100054296
686 Ga0068859_100102868
687 Ga0068859_100223324
688 Ga0068864_100164190
689 Ga0068866_10000746
690 Ga0068866_10276385
691 Ga0068861_100001913
692 Ga0068861_100001922
693 Ga0068861_101278643
694 Ga0068870_10039986
695 Ga0068870_10147941
696 Ga0068870_10324015
697 Ga0068863_100362787
698 Ga0068860_100008118
699 Ga0068862_100017829
700 Ga0068862_100038786
701 Ga0068862_100622332
702 Ga0081538_10035515
703 Ga0081539_10000365
704 Ga0070716_100095464
705 Ga0075362_10198970
706 Ga0097621_100001187
707 Ga0097621_100004204
708 Ga0068871_100024686
709 Ga0068871_100025566
710 Ga0075428_100000502
711 Ga0075428_100002035
712 Ga0075428_100341990
713 Ga0075428_100455879
714 Ga0075428_100524127
715 Ga0075428_100593693
716 Ga0075428_101171261
717 Ga0075430_100000620
718 Ga0075430_100007238
719 Ga0075430_100014819
720 Ga0075430_100248243
721 Ga0075430_100641390
722 Ga0075431_100066156
723 Ga0075431_100074130
724 Ga0075431_100128621
725 Ga0075431_100145990
726 Ga0075431_100603829
727 Ga0075431_100707544
728 Ga0075433_10000611
729 Ga0075433_10233296
730 Ga0075433_10322407
731 Ga0075433_10441807
732 Ga0075434_100000406
733 Ga0075434_100007989
734 Ga0075434_100064318
735 Ga0075429_100000081
736 Ga0075429_100000145
737 Ga0075429_100078877
738 Ga0075429_100123110
739 Ga0075429_100128615
740 Ga0075429_100250289
741 Ga0068865_100000922
742 Ga0068865_100001100
743 Ga0075436_100000375
744 Ga0075436_100000513
745 Ga0075436_100275724
746 Ga0097620_100008910
747 Ga0097620_100054294
748 Ga0097620_100102861
749 Ga0097620_100223334
750 Ga0075435_100000668
751 Ga0075435_100000820
752 Ga0075435_100038536
753 Ga0075435_100094652
754 Ga0075435_100122190
755 Ga0075435_100194868
756 Ga0099794_10018041
757 Ga0099794_10027883
758 Ga0099794_10240426
759 Ga0105240_10374347
760 Ga0111539_10022821
761 Ga0111539_10096189
762 Ga0111539_10141863
763 Ga0111539_10220095
764 Ga0111539_10368556
765 Ga0111539_10869191
766 Ga0111539_11318386
767 Ga0105245_10004790
768 Ga0105245_10125608
769 Ga0114129_10000393
770 Ga0114129_10002113
771 Ga0114129_10076304
772 Ga0114129_10196261
773 Ga0114129_10471699
774 Ga0114129_12808972
775 Ga0105243_10016884
776 Ga0105243_10047896
777 Ga0105243_10231139
778 Ga0105243_11198363
779 Ga0105241_10077029
780 Ga0105242_10000296
781 Ga0105242_10008018
782 Ga0105242_11420768
783 Ga0105248_10824065
784 Ga0105249_10001763
785 Ga0105239_10495774
786 Ga0105246_10048210
787 Ga0157378_10003195
788 Ga0157378_10260458
789 Ga0163162_10147275
790 Ga0157372_10613611
791 Ga0157375_10840041
792 Ga0157375_11010906
793 Ga0157380_10029114
794 Ga0157380_10279714
795 Ga0157377_10034443
796 Ga0157379_10053730
797 Ga0157376_10011070
798 Ga0207653_10007973
799 Ga0207653_10019105
800 Ga0207642_10014619
801 Ga0207642_10265018
802 Ga0207688_10069086
803 Ga0207688_10135061
804 Ga0207680_10187394
805 Ga0207685_10152804
806 Ga0207643_10039448
807 Ga0207643_10048143
808 Ga0207684_10239857
809 Ga0207707_10008207
810 Ga0207707_10156666
811 Ga0207707_11284380
812 Ga0207660_10033615
813 Ga0207660_10074307
814 Ga0207660_10216392
815 Ga0207660_10631775
816 Ga0207662_10000024
817 Ga0207662_10246786
818 Ga0207662_10287659
819 Ga0207662_10356794
820 Ga0207652_10581920
821 Ga0207646_10549906
822 Ga0207681_10001419
823 Ga0207659_10055430
824 Ga0207687_10030729
825 Ga0207687_10582823
826 Ga0207700_10343191
827 Ga0207706_10102730
828 Ga0207686_10001177
829 Ga0207686_10010567
830 Ga0207709_10009182
831 Ga0207709_10010644
832 Ga0207709_10460929
833 Ga0207670_10002055
834 Ga0207670_10164267
835 Ga0207670_10203145
836 Ga0207669_10062535
837 Ga0207704_10000918
838 Ga0207704_10003103
839 Ga0207665_10046937
840 Ga0207691_10214908
841 Ga0207691_10562949
842 Ga0207689_10063599
843 Ga0207689_10068059
844 Ga0207667_10005789
845 Ga0207651_10019775
846 Ga0207651_10609819
847 Ga0207712_10013044
848 Ga0207712_10022123
849 Ga0207668_10012611
850 Ga0207640_10007225
851 Ga0207677_10000875
852 Ga0207703_10199071
853 Ga0207639_10642603
854 Ga0207708_10002074
855 Ga0207708_10374779
856 Ga0207708_10543052
857 Ga0207708_10547219
858 Ga0207708_10694568
859 Ga0207702_10209225
860 Ga0207641_10133363
861 Ga0207648_10005161
862 Ga0207648_10014513
863 Ga0207648_10049940
864 Ga0207648_11112681
865 Ga0207676_10272943
866 Ga0207676_10702801
867 Ga0207674_10142260
868 Ga0207675_100000954
869 Ga0207675_100002609
870 Ga0207683_10102509
871 Ga0209969_1004100
872 Ga0209969_1016375
873 Ga0209967_1003038
874 Ga0209981_1030401
875 Ga0209996_1010823
876 Ga0209996_1022382
877 Ga0210000_1004382
878 Ga0210000_1016163
879 Ga0209995_1001101
880 Ga0209995_1016483
881 Ga0209995_1037772
882 Ga0209968_1022480
883 Ga0209999_1007147
884 Ga0209999_1010557
885 Ga0210002_1055064
886 Ga0209966_1001585
887 Ga0209966_1019647
888 Ga0207428_10009302
889 Ga0207428_10028030
890 Ga0207428_10036346
891 Ga0268265_10004469
892 Ga0268265_10009414
893 Ga0268265_10335398
894 Ga0268265_10360989
895 Ga0268264_10000841
896 Ga0268264_10741826
897 Ga0307408_100078396
898 Ga0307408_100539331
899 Ga0307413_10475038
900 Ga0307410_10820010
901 Ga0307407_10584124
902 Ga0307409_100208017
903 Ga0307416_100409488
904 Ga0307416_100428887
905 Ga0307416_100568855
906 Ga0307411_10152968
907 Ga0307411_10206451
908 Ga0373930_0046016
909 Ga0373948_0002713
910 Ga0373950_0007812
911 Ga0373938_0025120
912 Ga0373928_0018806
913 Ga0373929_0069443
914 Ga0373940_0024050
915 Ga0373932_0001177
916 Ga0373936_0202024
917 Ga0373939_0049430
918 Ga0373941_0014998
919 Ga0373941_0055604
920 Ga0373941_0171538
921 Ga0373961_0002326
922 Ga0373961_0152895
923 Ga0373962_0077378
924 Ga0373931_0000177
925 Ga0373931_0012034
926 Ga0373931_0026008
927 Ga0373931_0187183
928 Ga0373931_0386226
929 Ga0373937_0127278
930 Ga0439439_0031632
931 Ga0439453_0027668
932 Ga0439461_0049558
933 Ga0451804_1068127
934 Ga0451853_1506806
935 Ga0439441_013204
936 Ga0439443_001907
937 Ga0439450_070826
938 Ga0439451_005225
939 Ga0439462_0097402
940 Ga0439446_0003451
941 Ga0439434_0003761
942 Ga0439434_0170684
943 Ga0439435_0000966
944 Ga0439435_0018938
945 Ga0439444_0000672
946 Ga0439444_0009256
947 Ga0439459_0016797
948 Ga0439460_0001831
949 Ga0451577_0164051
950 Ga0451576_0009298
951 Ga0451576_0020989
952 Ga0451576_0026259
953 Ga0495603_0192646
954 Ga0495662_0043151
955 Ga0495608_0037973
956 Ga0495628_0009779
957 Ga0495630_0019320
958 Ga0495630_0827260
959 Ga0495666_0031461
960 Ga0495652_0031366
961 Ga0495640_0032561
962 Ga0495640_0088600
963 Ga0495586_0011534
964 Ga0495586_0027203
965 Ga0495598_0245694
966 Ga0495621_0008822
967 Ga0495621_0078555
968 Ga0495621_0099042
969 Ga0495621_0117572
970 Ga0495667_0014782
971 Ga0495635_0073380
972 Ga0495659_0048579
973 Ga0495646_0141136
974 Ga0495658_0021201
975 Ga0495658_0034706
976 Ga0495669_0022285
977 Ga0495669_0046200
978 Ga0495669_0166321
979 Ga0495613_0008807
980 Ga0495624_0056350
981 Ga0495600_0012118
982 Ga0495581_0205766
983 Ga0495604_0017573
984 Ga0495636_0001613
985 Ga0495680_0004125
986 Ga0501291_019296
987 Ga0501298_009420
988 Ga0501299_029320
989 Ga0501031_0026854
990 Ga0501031_0285658
991 Ga0501033_0016766
992 Ga0501034_1345022
993 Ga0501036_0008179
994 Ga0501036_0400854
995 Ga0501036_0734589
996 Ga0501037_0012879
997 Ga0501037_0042031
998 Ga0501037_0202080
999 Ga0501038_0011271
1000 Ga0501038_0034843
1001 Ga0501039_0007682
1002 Ga0501039_0020405
1003 Ga0501039_0163118
1004 Ga0501039_0190250
1005 Ga0501039_0237314
1006 Ga0501039_0251229
1007 Ga0501039_0268630
1008 Ga0501040_0006268
1009 Ga0501040_0028332
1010 Ga0501040_0030687
1011 Ga0501040_0053644
1012 Ga0501040_0105899
1013 Ga0501041_0000358
1014 Ga0501041_0007744
1015 Ga0501042_0000291
1016 Ga0501042_0096681
1017 Ga0501042_0180846
1018 Ga0501042_0309311
1019 Ga0501042_0377229
1020 Ga0501043_0048212
1021 Ga0501043_0230598
1022 Ga0501043_0417302
1023 Ga0501046_0010378
1024 Ga0501046_0073060
1025 Ga0501047_1089663
1026 Ga0501048_0016337
1027 Ga0501048_0520648
1028 Ga0501068_0109167
1029 Ga0501069_0209621
1030 Ga0501071_0004120
1031 Ga0501071_0050912
1032 Ga0501071_0053220
1033 Ga0501071_0092717
1034 Ga0501071_0399535
1035 Ga0501072_0000720
1036 Ga0501072_0001286
1037 Ga0501072_0016019
1038 Ga0501072_0133284
1039 Ga0501072_0140334
1040 Ga0501072_0148958
1041 Ga0501072_0311253
1042 Ga0501072_0366753
1043 Ga0501074_0056482
1044 Ga0501074_0408588
1045 Ga0501074_0723867
1046 Ga0501075_0005455
1047 Ga0501075_0052774
1048 Ga0501075_0060896
1049 Ga0501075_0248915
1050 Ga0501076_0002120
1051 Ga0501076_0002813
1052 Ga0501076_0003881
1053 Ga0501076_0590243
1054 Ga0501077_0004484
1055 Ga0501077_0020675
1056 Ga0501077_0033120
1057 Ga0501077_0130444
1058 Ga0501209_049413
1059 Ga0501216_047758
1060 Ga0501217_024459
1061 Ga0501217_215945
1062 Ga0501249_029062
1063 Ga0501219_011674
1064 Ga0501225_0039011
1065 Ga0501234_038330
1066 Ga0501245_016687
1067 Ga0501079_0013275
1068 Ga0501079_0015686
1069 Ga0501079_0088100
1070 Ga0501079_0253768
1071 Ga0501080_0109009
1072 Ga0501080_0138422
1073 Ga0501080_0151342
1074 Ga0501080_0290203
1075 Ga0501081_0002739
1076 Ga0501081_0003592
1077 Ga0501081_0010072
1078 Ga0501081_0226647
1079 Ga0501081_0232757
1080 Ga0501083_0113734
1081 Ga0501083_0327977
1082 Ga0501083_0541927
1083 Ga0501280_095625
1084 Ga0501283_056889
1085 Ga0501035_0010832
1086 Ga0501035_0092695
1087 Ga0501035_0104044
1088 Ga0501044_0333287
1089 Ga0501045_0005295
1090 Ga0501045_0366137
1091 Ga0501226_015909
1092 nmdc:mga05p37_2146_c1
1093 nmdc:mga05p37_266246_c1
1094 nmdc:mga05p37_572138_c1
1095 nmdc:mga05p37_74562_c1
1096 nmdc:mga05p37_775_c1
1097 nmdc:mga09592_109817_c1
1098 nmdc:mga09592_126809_c1
1099 nmdc:mga09592_1359803_c1
1100 nmdc:mga09592_148_c1
1101 nmdc:mga09592_253145_c1
1102 nmdc:mga09592_26_c1
1103 nmdc:mga09592_34000_c1
1104 nmdc:mga09592_422796_c1
1105 nmdc:mga09592_87291_c1
1106 nmdc:mga0qj67_1004775_c1
1107 nmdc:mga0qj67_12222_c1
1108 nmdc:mga0qj67_350279_c1
1109 nmdc:mga0qj67_38899_c1
1110 nmdc:mga0qj67_58443_c1
1111 nmdc:mga0qj67_715866_c1
1112 nmdc:mga0qj67_740_c1
1113 nmdc:mga0qj67_873766_c1
1114 nmdc:mga0qj67_933637_c1
1115 nmdc:mga06r32_124849_c2
1116 nmdc:mga06r32_21812_c1
1117 nmdc:mga06r32_248162_c1
1118 nmdc:mga06r32_33186_c1
1119 nmdc:mga06r32_354814_c1
1120 nmdc:mga06r32_451746_c1
1121 nmdc:mga06r32_81914_c1
1122 nmdc:mga06r32_89483_c1
1123 nmdc:mga08y16_142861_c1
1124 nmdc:mga08y16_1941_c1
1125 nmdc:mga08y16_21668_c1
1126 nmdc:mga08y16_220096_c1
1127 nmdc:mga08y16_377830_c1
1128 nmdc:mga08y16_79226_c1
1129 nmdc:mga08y16_864518_c1
1130 nmdc:mga08y16_873553_c1
1131 nmdc:mga08y16_916981_c1
1132 nmdc:mga0n895_1820_c1
1133 nmdc:mga0n895_83407_c1
1134 nmdc:mga0n895_924_c1
1135 nmdc:mga0rr50_1686_c1
1136 nmdc:mga0rr50_2253_c1
1137 nmdc:mga0rr50_4538_c1
1138 nmdc:mga08x19_280598_c1
1139 nmdc:mga08x19_418697_c1
1140 nmdc:mga08x19_46296_c1
1141 nmdc:mga08x19_820_c1
1142 nmdc:mga08x19_834_c1
1143 nmdc:mga08x19_8472_c1
1144 nmdc:mga0a205_1015089_c1
1145 nmdc:mga0a205_14210_c1
1146 nmdc:mga0a205_642632_c1
1147 nmdc:mga0a205_821_c1
1148 Ga0495612_0043897
1149 Ga0501084_0000832
1150 Ga0501084_0031510
1151 Ga0501084_0036193
1152 Ga0501084_0079464
1153 Ga0501084_1106066
1154 Ga0590077_012905
1155 Ga0590077_025698
1156 Ga0501082_0013472
1157 Ga0501082_0016106
1158 Ga0501082_0154999
1159 Ga0501082_0330478
1160 Ga0530510_0000042
1161 Ga0530510_0002067
1162 Ga0530510_0003012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

48

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8101 14 171
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7919 14 171
6akg-assembly2.cif.gz_C crystal structure of mouse claudin-3 p134g mutant in complex with c-terminal fragment of clostridium perfringens enterotoxin 0.3967 59 163
6z0c-assembly1.cif.gz_A structure of in silico modelled artificial maquette-3 protein 0.3642 9 173
4ckg-assembly1.cif.gz_B helical reconstruction of acap1(bar-ph domain) decorated membrane tubules by cryo-electron microscopy 0.3588 9 172
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6565 35 167 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6406 35 167 1.20.120.550
af_P78369_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5413 61 163 1.20.140.150
af_A0A178VGS0_23_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5171 27 173 1.20.140.150
af_A0A2R8Q922_1_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5066 48 163 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2E6NY68-F1-model_v4 TRAP transporter small permease protein 0.9453 14 172 GO:0005886
GO:0022857
AF-A0A0P7YB44-F1-model_v4 TRAP transporter small permease protein 0.9452 22 176 GO:0005886
GO:0022857
AF-A0A6M1LQ77-F1-model_v4 TRAP transporter small permease protein 0.944 11 177 GO:0005886
GO:0022857
AF-A0A7Y2CXB1-F1-model_v4 TRAP transporter small permease protein 0.9392 50 177 GO:0005886
GO:0022857
AF-A0A839Z9N2-F1-model_v4 TRAP transporter small permease protein 0.9347 11 177 GO:0005886
GO:0022857

Map