F466129
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 324 | 1164 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10062850|rootL2_100628504 |
| Length | 172 |
| Sequence | MIATNFTNNKKLITSNHKPATRMRAVIQRVTKASITIDGKIYSSINNGLLVLLGIEDADTNDDIEWLSGKIVNLRIFNDENGVMNVSVKDSNGEILVVSQFTLHASTKKGNRPSYIKASKPGFAVPMYEKFVQQLSNDLGKKIQTGVFGADMKVELLNDGPVTIVIDTKNKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 190 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 194 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 236 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 237 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 238 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 246 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 248 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 249 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 250 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 262 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 265 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 270 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 271 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 286 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 292 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 296 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 298 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 302 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 303 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 304 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 305 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 306 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 307 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 308 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 309 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 310 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 311 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 312 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 313 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 314 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 315 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 316 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 317 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 318 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 319 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 320 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 321 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 322 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 323 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 324 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.05 |
| Metatranscriptomes | 0 |
| Isolates | 3.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.67 |
| Nodule | 0.17 |
| Rhizoplane | 1.89 |
| Rhizosphere | 84.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10062850 | 3300003322 | Bacteria | 2677 |
| 2 | MRS1b_contig_6820906 | 2162886011 | Bacteria | 1398 |
| 3 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 4 | JGI25157J39369_1011591 | 3300002741 | Bacteria | 1137 |
| 5 | rootH1_10001870 | 3300003316 | Bacteria | 68851 |
| 6 | rootH2_10088081 | 3300003320 | Bacteria | 2816 |
| 7 | rootL2_10009529 | 3300003322 | Bacteria | 24087 |
| 8 | rootL2_10024221 | 3300003322 | Bacteria | 7211 |
| 9 | rootL2_10024222 | 3300003322 | Bacteria | 5842 |
| 10 | rootL2_10176412 | 3300003322 | Bacteria | 1983 |
| 11 | rootL2_10334933 | 3300003322 | Bacteria | 1074 |
| 12 | rootH1_10012417 | 3300003323 | Bacteria | 6214 |
| 13 | rootH1_10033067 | 3300003323 | Bacteria | 14621 |
| 14 | rootH1_10163868 | 3300003323 | Bacteria | 3459 |
| 15 | rootH1_10398835 | 3300003323 | Bacteria | 1460 |
| 16 | JGI25160J50197_1008924 | 3300003354 | Bacteria | 3768 |
| 17 | Ga0065714_10003873 | 3300005288 | Bacteria | 6555 |
| 18 | Ga0065714_10072417 | 3300005288 | Bacteria | 3373 |
| 19 | Ga0065714_10140865 | 3300005288 | Bacteria | 1172 |
| 20 | Ga0065714_10233419 | 3300005288 | Bacteria | 802 |
| 21 | Ga0065704_10013290 | 3300005289 | Bacteria | 2101 |
| 22 | Ga0065704_10084390 | 3300005289 | Bacteria | 3315 |
| 23 | Ga0065704_10119380 | 3300005289 | Bacteria | 1801 |
| 24 | Ga0065704_10189468 | 3300005289 | Bacteria | 1197 |
| 25 | Ga0065712_10171667 | 3300005290 | Bacteria | 1240 |
| 26 | Ga0065715_10171969 | 3300005293 | Bacteria | 1540 |
| 27 | Ga0065707_10016442 | 3300005295 | Bacteria | 3185 |
| 28 | Ga0065707_10018800 | 3300005295 | Bacteria | 1586 |
| 29 | Ga0070658_10013937 | 3300005327 | Bacteria | 6453 |
| 30 | Ga0070658_11250291 | 3300005327 | Unclassified | 645 |
| 31 | Ga0070670_100093583 | 3300005331 | Bacteria | 2585 |
| 32 | Ga0070670_100152166 | 3300005331 | Bacteria | 2002 |
| 33 | Ga0070666_10065105 | 3300005335 | Bacteria | 2473 |
| 34 | Ga0070666_10176832 | 3300005335 | Unclassified | 1496 |
| 35 | Ga0070666_10530821 | 3300005335 | Bacteria | 855 |
| 36 | Ga0068868_100068287 | 3300005338 | Bacteria | 2830 |
| 37 | Ga0068868_100721998 | 3300005338 | Unclassified | 893 |
| 38 | Ga0068868_101688987 | 3300005338 | Unclassified | 596 |
| 39 | Ga0070689_100016199 | 3300005340 | Bacteria | 5450 |
| 40 | Ga0070687_101240642 | 3300005343 | Bacteria | 551 |
| 41 | Ga0070661_100042353 | 3300005344 | Bacteria | 3323 |
| 42 | Ga0070661_100196070 | 3300005344 | Bacteria | 1541 |
| 43 | Ga0070668_100075389 | 3300005347 | Unclassified | 2633 |
| 44 | Ga0070668_100323521 | 3300005347 | Bacteria | 1299 |
| 45 | Ga0070668_100371139 | 3300005347 | Unclassified | 1215 |
| 46 | Ga0070669_100224013 | 3300005353 | Unclassified | 1488 |
| 47 | Ga0070669_100981731 | 3300005353 | Bacteria | 724 |
| 48 | Ga0070675_100006660 | 3300005354 | Bacteria | 8883 |
| 49 | Ga0070675_100681016 | 3300005354 | Bacteria | 936 |
| 50 | Ga0070675_101137234 | 3300005354 | Unclassified | 718 |
| 51 | Ga0070671_100047889 | 3300005355 | Bacteria | 3554 |
| 52 | Ga0070671_100093713 | 3300005355 | Bacteria | 2517 |
| 53 | Ga0070674_100022974 | 3300005356 | Bacteria | 4027 |
| 54 | Ga0070673_100074029 | 3300005364 | Bacteria | 2743 |
| 55 | Ga0070673_100144248 | 3300005364 | Unclassified | 2011 |
| 56 | Ga0070673_101280301 | 3300005364 | Bacteria | 688 |
| 57 | Ga0070688_100423134 | 3300005365 | Bacteria | 990 |
| 58 | Ga0070659_100020411 | 3300005366 | Bacteria | 5031 |
| 59 | Ga0070667_100009396 | 3300005367 | Bacteria | 8111 |
| 60 | Ga0070667_100032870 | 3300005367 | Bacteria | 4329 |
| 61 | Ga0070667_100521019 | 3300005367 | Unclassified | 1091 |
| 62 | Ga0070667_101447329 | 3300005367 | Bacteria | 645 |
| 63 | Ga0070667_101769996 | 3300005367 | Unclassified | 581 |
| 64 | Ga0070709_10712973 | 3300005434 | Unclassified | 781 |
| 65 | Ga0070711_101749579 | 3300005439 | Unclassified | 545 |
| 66 | Ga0070663_100275519 | 3300005455 | Bacteria | 1339 |
| 67 | Ga0070663_100743611 | 3300005455 | Bacteria | 837 |
| 68 | Ga0070678_100211600 | 3300005456 | Bacteria | 1607 |
| 69 | Ga0070678_100683736 | 3300005456 | Unclassified | 923 |
| 70 | Ga0070662_100041673 | 3300005457 | Bacteria | 3277 |
| 71 | Ga0070662_100858043 | 3300005457 | Unclassified | 773 |
| 72 | Ga0070662_101749900 | 3300005457 | Bacteria | 537 |
| 73 | Ga0068867_100040437 | 3300005459 | Unclassified | 3403 |
| 74 | Ga0068867_100081944 | 3300005459 | Bacteria | 2433 |
| 75 | Ga0068867_100287293 | 3300005459 | Bacteria | 1351 |
| 76 | Ga0068867_100533142 | 3300005459 | Bacteria | 1014 |
| 77 | Ga0070685_10113647 | 3300005466 | Unclassified | 1672 |
| 78 | Ga0070698_100004536 | 3300005471 | Bacteria | 15258 |
| 79 | Ga0070699_100428601 | 3300005518 | Bacteria | 1198 |
| 80 | Ga0070684_100428157 | 3300005535 | Bacteria | 1222 |
| 81 | Ga0070684_101897465 | 3300005535 | Bacteria | 562 |
| 82 | Ga0070697_100507106 | 3300005536 | Bacteria | 1055 |
| 83 | Ga0068853_100156865 | 3300005539 | Bacteria | 2051 |
| 84 | Ga0068853_100254886 | 3300005539 | Bacteria | 1611 |
| 85 | Ga0068853_100288966 | 3300005539 | Bacteria | 1513 |
| 86 | Ga0070672_100094126 | 3300005543 | Bacteria | 2421 |
| 87 | Ga0070672_100601524 | 3300005543 | Unclassified | 958 |
| 88 | Ga0070693_100160350 | 3300005547 | Bacteria | 1432 |
| 89 | Ga0068855_100004102 | 3300005563 | Bacteria | 17772 |
| 90 | Ga0068855_100236698 | 3300005563 | Bacteria | 2042 |
| 91 | Ga0070664_100930583 | 3300005564 | Unclassified | 815 |
| 92 | Ga0068857_100045396 | 3300005577 | Bacteria | 3898 |
| 93 | Ga0068857_100074969 | 3300005577 | Bacteria | 3015 |
| 94 | Ga0068857_100298272 | 3300005577 | Bacteria | 1485 |
| 95 | Ga0068857_100487266 | 3300005577 | Bacteria | 1156 |
| 96 | Ga0068857_100735910 | 3300005577 | Bacteria | 939 |
| 97 | Ga0068856_100229234 | 3300005614 | Bacteria | 1873 |
| 98 | Ga0068852_100019736 | 3300005616 | Bacteria | 5344 |
| 99 | Ga0068852_100338980 | 3300005616 | Unclassified | 1465 |
| 100 | Ga0068852_100556534 | 3300005616 | Unclassified | 1148 |
| 101 | Ga0068859_100125822 | 3300005617 | Bacteria | 2632 |
| 102 | Ga0068859_101383159 | 3300005617 | Bacteria | 776 |
| 103 | Ga0068864_100051884 | 3300005618 | Unclassified | 3534 |
| 104 | Ga0068864_100067548 | 3300005618 | Bacteria | 3105 |
| 105 | Ga0068864_100284392 | 3300005618 | Bacteria | 1544 |
| 106 | Ga0068864_100416070 | 3300005618 | Unclassified | 1280 |
| 107 | Ga0068864_101038630 | 3300005618 | Bacteria | 814 |
| 108 | Ga0068861_100385234 | 3300005719 | Unclassified | 1240 |
| 109 | Ga0068861_101443981 | 3300005719 | Unclassified | 673 |
| 110 | Ga0068851_10063504 | 3300005834 | Unclassified | 1897 |
| 111 | Ga0068870_10392564 | 3300005840 | Unclassified | 901 |
| 112 | Ga0068863_100006021 | 3300005841 | Bacteria | 11896 |
| 113 | Ga0068863_100256263 | 3300005841 | Bacteria | 1691 |
| 114 | Ga0068863_100399847 | 3300005841 | Bacteria | 1343 |
| 115 | Ga0068860_100000443 | 3300005843 | Bacteria | 52294 |
| 116 | Ga0068860_100015182 | 3300005843 | Bacteria | 7523 |
| 117 | Ga0068860_100283641 | 3300005843 | Unclassified | 1619 |
| 118 | Ga0068862_101153440 | 3300005844 | Bacteria | 772 |
| 119 | Ga0081539_10005379 | 3300005985 | Bacteria | 13105 |
| 120 | Ga0070717_10406048 | 3300006028 | Bacteria | 1224 |
| 121 | Ga0070715_10296405 | 3300006163 | Unclassified | 863 |
| 122 | Ga0070716_100325277 | 3300006173 | Bacteria | 1079 |
| 123 | Ga0075427_10025686 | 3300006194 | Bacteria | 951 |
| 124 | Ga0075366_10034256 | 3300006195 | Bacteria | 2990 |
| 125 | Ga0075366_10046124 | 3300006195 | Bacteria | 2582 |
| 126 | Ga0075366_10080838 | 3300006195 | Unclassified | 1941 |
| 127 | Ga0097621_100002296 | 3300006237 | Bacteria | 13100 |
| 128 | Ga0097621_100002810 | 3300006237 | Bacteria | 11927 |
| 129 | Ga0097621_100052282 | 3300006237 | Bacteria | 3328 |
| 130 | Ga0097621_100142527 | 3300006237 | Bacteria | 2049 |
| 131 | Ga0097621_100446080 | 3300006237 | Bacteria | 1165 |
| 132 | Ga0068871_100000814 | 3300006358 | Bacteria | 20927 |
| 133 | Ga0068871_100086241 | 3300006358 | Bacteria | 2608 |
| 134 | Ga0075428_100014184 | 3300006844 | Bacteria | 8865 |
| 135 | Ga0075428_100222964 | 3300006844 | Unclassified | 2035 |
| 136 | Ga0075428_100431917 | 3300006844 | Bacteria | 1411 |
| 137 | Ga0075428_101722565 | 3300006844 | Unclassified | 654 |
| 138 | Ga0075430_100005140 | 3300006846 | Bacteria | 11016 |
| 139 | Ga0075430_100047614 | 3300006846 | Bacteria | 3621 |
| 140 | Ga0075430_100367190 | 3300006846 | Bacteria | 1188 |
| 141 | Ga0075431_100103625 | 3300006847 | Bacteria | 2937 |
| 142 | Ga0075431_100117208 | 3300006847 | Bacteria | 2748 |
| 143 | Ga0075429_100029461 | 3300006880 | Unclassified | 4767 |
| 144 | Ga0068865_100055188 | 3300006881 | Unclassified | 2763 |
| 145 | Ga0097620_100125823 | 3300006931 | Bacteria | 2632 |
| 146 | Ga0097620_100738481 | 3300006931 | Bacteria | 1074 |
| 147 | Ga0097620_101382972 | 3300006931 | Bacteria | 776 |
| 148 | Ga0099826_10000966 | 3300006948 | Bacteria | 15994 |
| 149 | Ga0105244_10054936 | 3300009036 | Bacteria | 2019 |
| 150 | Ga0105240_10000329 | 3300009093 | Bacteria | 89375 |
| 151 | Ga0105240_10062828 | 3300009093 | Bacteria | 4622 |
| 152 | Ga0111539_10023564 | 3300009094 | Bacteria | 7564 |
| 153 | Ga0111539_11613800 | 3300009094 | Unclassified | 752 |
| 154 | Ga0111539_11637289 | 3300009094 | Bacteria | 746 |
| 155 | Ga0105247_10003717 | 3300009101 | Bacteria | 9902 |
| 156 | Ga0114129_10019889 | 3300009147 | Bacteria | 9555 |
| 157 | Ga0105241_10006108 | 3300009174 | Bacteria | 8877 |
| 158 | Ga0105241_10019786 | 3300009174 | Bacteria | 4968 |
| 159 | Ga0105241_10240005 | 3300009174 | Bacteria | 1532 |
| 160 | Ga0105241_10333747 | 3300009174 | Bacteria | 1311 |
| 161 | Ga0105242_10014337 | 3300009176 | Bacteria | 6139 |
| 162 | Ga0105242_10064474 | 3300009176 | Bacteria | 3020 |
| 163 | Ga0105242_10083048 | 3300009176 | Bacteria | 2682 |
| 164 | Ga0105248_10074284 | 3300009177 | Bacteria | 3821 |
| 165 | Ga0105248_10217180 | 3300009177 | Bacteria | 2153 |
| 166 | Ga0105237_10063389 | 3300009545 | Bacteria | 3694 |
| 167 | Ga0105237_10063410 | 3300009545 | Bacteria | 3693 |
| 168 | Ga0105237_10126743 | 3300009545 | Bacteria | 2547 |
| 169 | Ga0105237_10379532 | 3300009545 | Bacteria | 1418 |
| 170 | Ga0105237_10484958 | 3300009545 | Unclassified | 1242 |
| 171 | Ga0105238_10004094 | 3300009551 | Bacteria | 14466 |
| 172 | Ga0105249_10094480 | 3300009553 | Bacteria | 2802 |
| 173 | Ga0105249_10115961 | 3300009553 | Unclassified | 2538 |
| 174 | Ga0105249_10632550 | 3300009553 | Bacteria | 1127 |
| 175 | Ga0105249_10759541 | 3300009553 | Unclassified | 1032 |
| 176 | Ga0105249_10830712 | 3300009553 | Unclassified | 989 |
| 177 | Ga0105239_10028606 | 3300010375 | Bacteria | 6128 |
| 178 | Ga0105239_10284754 | 3300010375 | Unclassified | 1861 |
| 179 | Ga0105239_10610150 | 3300010375 | Bacteria | 1245 |
| 180 | Ga0105239_10739039 | 3300010375 | Bacteria | 1126 |
| 181 | Ga0105239_11374211 | 3300010375 | Bacteria | 815 |
| 182 | Ga0105246_10015893 | 3300011119 | Bacteria | 4760 |
| 183 | Ga0105246_11049915 | 3300011119 | Unclassified | 741 |
| 184 | Ga0157373_10000033 | 3300013100 | Bacteria | 124744 |
| 185 | Ga0157371_10003330 | 3300013102 | Bacteria | 14676 |
| 186 | Ga0157371_10244984 | 3300013102 | Bacteria | 1290 |
| 187 | Ga0157371_10290468 | 3300013102 | Bacteria | 1182 |
| 188 | Ga0157371_10674175 | 3300013102 | Bacteria | 773 |
| 189 | Ga0157370_10001263 | 3300013104 | Bacteria | 31604 |
| 190 | Ga0157370_10007296 | 3300013104 | Bacteria | 12063 |
| 191 | Ga0157370_10043458 | 3300013104 | Bacteria | 4324 |
| 192 | Ga0157370_10099555 | 3300013104 | Bacteria | 2725 |
| 193 | Ga0157370_10170532 | 3300013104 | Bacteria | 2023 |
| 194 | Ga0157370_10352423 | 3300013104 | Bacteria | 1357 |
| 195 | Ga0157370_10564586 | 3300013104 | Bacteria | 1043 |
| 196 | Ga0157370_11236844 | 3300013104 | Bacteria | 673 |
| 197 | Ga0157369_10012442 | 3300013105 | Bacteria | 9659 |
| 198 | Ga0157369_10129173 | 3300013105 | Bacteria | 2678 |
| 199 | Ga0157369_10949541 | 3300013105 | Bacteria | 881 |
| 200 | Ga0157374_10831346 | 3300013296 | Bacteria | 940 |
| 201 | Ga0157378_10010383 | 3300013297 | Bacteria | 8130 |
| 202 | Ga0157378_10012714 | 3300013297 | Bacteria | 7365 |
| 203 | Ga0157378_10198670 | 3300013297 | Bacteria | 1896 |
| 204 | Ga0157378_10282567 | 3300013297 | Unclassified | 1600 |
| 205 | Ga0157378_11663912 | 3300013297 | Bacteria | 685 |
| 206 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 207 | Ga0163162_10001199 | 3300013306 | Bacteria | 24183 |
| 208 | Ga0163162_10003537 | 3300013306 | Bacteria | 14946 |
| 209 | Ga0163162_10120248 | 3300013306 | Bacteria | 2730 |
| 210 | Ga0163162_10127721 | 3300013306 | Unclassified | 2650 |
| 211 | Ga0163162_10236201 | 3300013306 | Bacteria | 1958 |
| 212 | Ga0163162_10256593 | 3300013306 | Unclassified | 1880 |
| 213 | Ga0163162_10829945 | 3300013306 | Bacteria | 1040 |
| 214 | Ga0157372_10000494 | 3300013307 | Bacteria | 43474 |
| 215 | Ga0157372_10072360 | 3300013307 | Bacteria | 3885 |
| 216 | Ga0157372_10083339 | 3300013307 | Bacteria | 3622 |
| 217 | Ga0157372_10102212 | 3300013307 | Bacteria | 3273 |
| 218 | Ga0157372_10365902 | 3300013307 | Bacteria | 1680 |
| 219 | Ga0157372_10593080 | 3300013307 | Unclassified | 1291 |
| 220 | Ga0157372_10904796 | 3300013307 | Bacteria | 1024 |
| 221 | Ga0157372_11351866 | 3300013307 | Unclassified | 822 |
| 222 | Ga0157372_11609765 | 3300013307 | Bacteria | 748 |
| 223 | Ga0157375_10000773 | 3300013308 | Bacteria | 28047 |
| 224 | Ga0157375_10009118 | 3300013308 | Bacteria | 8694 |
| 225 | Ga0157375_10711085 | 3300013308 | Bacteria | 1158 |
| 226 | Ga0157375_10965033 | 3300013308 | Bacteria | 993 |
| 227 | Ga0157375_10999819 | 3300013308 | Unclassified | 976 |
| 228 | Ga0157375_12278671 | 3300013308 | Bacteria | 646 |
| 229 | Ga0157375_13343400 | 3300013308 | Bacteria | 534 |
| 230 | Ga0163163_10140110 | 3300014325 | Bacteria | 2461 |
| 231 | Ga0163163_10678103 | 3300014325 | Bacteria | 1094 |
| 232 | Ga0163163_10714951 | 3300014325 | Bacteria | 1065 |
| 233 | Ga0163163_11250214 | 3300014325 | Bacteria | 805 |
| 234 | Ga0163163_11667752 | 3300014325 | Bacteria | 698 |
| 235 | Ga0157380_10001024 | 3300014326 | Bacteria | 17823 |
| 236 | Ga0157380_10889385 | 3300014326 | Unclassified | 916 |
| 237 | Ga0157377_10567624 | 3300014745 | Unclassified | 804 |
| 238 | Ga0157379_10070134 | 3300014968 | Bacteria | 3136 |
| 239 | Ga0157379_10074438 | 3300014968 | Unclassified | 3040 |
| 240 | Ga0157379_10223834 | 3300014968 | Unclassified | 1705 |
| 241 | Ga0157379_10577294 | 3300014968 | Bacteria | 1048 |
| 242 | Ga0157376_10001241 | 3300014969 | Bacteria | 16805 |
| 243 | Ga0157376_10950232 | 3300014969 | Bacteria | 880 |
| 244 | Ga0182006_1020125 | 3300015261 | Bacteria | 2800 |
| 245 | Ga0163161_10000034 | 3300017792 | Bacteria | 156805 |
| 246 | Ga0163161_10001826 | 3300017792 | Bacteria | 15550 |
| 247 | Ga0163161_10228198 | 3300017792 | Bacteria | 1444 |
| 248 | Ga0163161_11081643 | 3300017792 | Bacteria | 688 |
| 249 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 250 | Ga0209646_1002048 | 3300025246 | Bacteria | 4782 |
| 251 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 252 | Ga0209129_1016784 | 3300025258 | Bacteria | 1457 |
| 253 | Ga0209758_1002724 | 3300025297 | Bacteria | 17405 |
| 254 | Ga0207426_1000445 | 3300025302 | Bacteria | 66319 |
| 255 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 256 | Ga0207656_10178774 | 3300025321 | Bacteria | 1017 |
| 257 | Ga0207655_1078037 | 3300025728 | Bacteria | 1205 |
| 258 | Ga0207710_10000886 | 3300025900 | Bacteria | 16030 |
| 259 | Ga0207680_10111822 | 3300025903 | Unclassified | 1773 |
| 260 | Ga0207680_10580761 | 3300025903 | Bacteria | 801 |
| 261 | Ga0207647_10000088 | 3300025904 | Bacteria | 70267 |
| 262 | Ga0207647_10136292 | 3300025904 | Bacteria | 1440 |
| 263 | Ga0207647_10237634 | 3300025904 | Bacteria | 1047 |
| 264 | Ga0207645_10136145 | 3300025907 | Unclassified | 1600 |
| 265 | Ga0207645_11015932 | 3300025907 | Bacteria | 561 |
| 266 | Ga0207705_11142075 | 3300025909 | Unclassified | 599 |
| 267 | Ga0207654_10034380 | 3300025911 | Bacteria | 2816 |
| 268 | Ga0207654_10358363 | 3300025911 | Unclassified | 1006 |
| 269 | Ga0207654_10666783 | 3300025911 | Bacteria | 746 |
| 270 | Ga0207695_10001095 | 3300025913 | Bacteria | 47228 |
| 271 | Ga0207671_10007870 | 3300025914 | Bacteria | 9149 |
| 272 | Ga0207671_10399821 | 3300025914 | Bacteria | 1092 |
| 273 | Ga0207657_10189786 | 3300025919 | Bacteria | 1658 |
| 274 | Ga0207649_10037276 | 3300025920 | Bacteria | 2936 |
| 275 | Ga0207681_10109865 | 3300025923 | Unclassified | 2004 |
| 276 | Ga0207681_10394655 | 3300025923 | Bacteria | 1116 |
| 277 | Ga0207694_10087969 | 3300025924 | Unclassified | 2448 |
| 278 | Ga0207650_10015889 | 3300025925 | Bacteria | 5252 |
| 279 | Ga0207650_10077070 | 3300025925 | Bacteria | 2520 |
| 280 | Ga0207650_10168579 | 3300025925 | Unclassified | 1739 |
| 281 | Ga0207659_10578270 | 3300025926 | Bacteria | 956 |
| 282 | Ga0207659_10931994 | 3300025926 | Unclassified | 747 |
| 283 | Ga0207659_11423341 | 3300025926 | Unclassified | 594 |
| 284 | Ga0207644_10151251 | 3300025931 | Bacteria | 1796 |
| 285 | Ga0207644_10388218 | 3300025931 | Unclassified | 1139 |
| 286 | Ga0207706_10744933 | 3300025933 | Unclassified | 835 |
| 287 | Ga0207686_10049658 | 3300025934 | Bacteria | 2605 |
| 288 | Ga0207669_10046592 | 3300025937 | Bacteria | 2563 |
| 289 | Ga0207669_10397187 | 3300025937 | Unclassified | 1079 |
| 290 | Ga0207704_10030424 | 3300025938 | Unclassified | 3027 |
| 291 | Ga0207691_10078579 | 3300025940 | Bacteria | 2970 |
| 292 | Ga0207691_10402631 | 3300025940 | Bacteria | 1167 |
| 293 | Ga0207691_11478394 | 3300025940 | Bacteria | 556 |
| 294 | Ga0207689_10100770 | 3300025942 | Bacteria | 2372 |
| 295 | Ga0207661_10330419 | 3300025944 | Bacteria | 1372 |
| 296 | Ga0207679_10072855 | 3300025945 | Bacteria | 2596 |
| 297 | Ga0207667_10006745 | 3300025949 | Bacteria | 13859 |
| 298 | Ga0207667_10327708 | 3300025949 | Unclassified | 1564 |
| 299 | Ga0207712_10060227 | 3300025961 | Bacteria | 2690 |
| 300 | Ga0207712_10196623 | 3300025961 | Unclassified | 1595 |
| 301 | Ga0207712_10419780 | 3300025961 | Bacteria | 1128 |
| 302 | Ga0207712_10614053 | 3300025961 | Bacteria | 942 |
| 303 | Ga0207712_11270216 | 3300025961 | Unclassified | 658 |
| 304 | Ga0207668_10614830 | 3300025972 | Unclassified | 948 |
| 305 | Ga0207668_10830395 | 3300025972 | Unclassified | 819 |
| 306 | Ga0207658_10079378 | 3300025986 | Bacteria | 2510 |
| 307 | Ga0207658_10127330 | 3300025986 | Bacteria | 2040 |
| 308 | Ga0207658_10496901 | 3300025986 | Bacteria | 1086 |
| 309 | Ga0207677_10029490 | 3300026023 | Bacteria | 3487 |
| 310 | Ga0207703_11647079 | 3300026035 | Bacteria | 617 |
| 311 | Ga0207639_10032059 | 3300026041 | Bacteria | 3866 |
| 312 | Ga0207639_10069236 | 3300026041 | Bacteria | 2753 |
| 313 | Ga0207639_10258631 | 3300026041 | Bacteria | 1521 |
| 314 | Ga0207639_10608094 | 3300026041 | Bacteria | 1009 |
| 315 | Ga0207678_10234837 | 3300026067 | Bacteria | 1570 |
| 316 | Ga0207678_10550607 | 3300026067 | Bacteria | 1009 |
| 317 | Ga0207702_10039409 | 3300026078 | Bacteria | 3958 |
| 318 | Ga0207702_10070931 | 3300026078 | Bacteria | 2998 |
| 319 | Ga0207702_11083793 | 3300026078 | Bacteria | 795 |
| 320 | Ga0207641_10006712 | 3300026088 | Bacteria | 9643 |
| 321 | Ga0207641_10133607 | 3300026088 | Bacteria | 2231 |
| 322 | Ga0207641_10790132 | 3300026088 | Unclassified | 938 |
| 323 | Ga0207648_10021453 | 3300026089 | Bacteria | 5805 |
| 324 | Ga0207648_10047489 | 3300026089 | Bacteria | 3763 |
| 325 | Ga0207648_10119727 | 3300026089 | Bacteria | 2314 |
| 326 | Ga0207648_10173275 | 3300026089 | Bacteria | 1908 |
| 327 | Ga0207676_10074684 | 3300026095 | Bacteria | 2732 |
| 328 | Ga0207676_10222308 | 3300026095 | Bacteria | 1682 |
| 329 | Ga0207676_10388480 | 3300026095 | Unclassified | 1301 |
| 330 | Ga0207676_11743972 | 3300026095 | Bacteria | 621 |
| 331 | Ga0207674_10106704 | 3300026116 | Bacteria | 2778 |
| 332 | Ga0207674_10203647 | 3300026116 | Bacteria | 1928 |
| 333 | Ga0207674_10446662 | 3300026116 | Bacteria | 1250 |
| 334 | Ga0207674_10568147 | 3300026116 | Bacteria | 1096 |
| 335 | Ga0207674_11933385 | 3300026116 | Bacteria | 556 |
| 336 | Ga0207675_100011769 | 3300026118 | Bacteria | 8178 |
| 337 | Ga0207675_101398929 | 3300026118 | Unclassified | 720 |
| 338 | Ga0207683_10102370 | 3300026121 | Bacteria | 2557 |
| 339 | Ga0207683_10715528 | 3300026121 | Unclassified | 928 |
| 340 | Ga0207683_10957811 | 3300026121 | Bacteria | 795 |
| 341 | Ga0207683_10983003 | 3300026121 | Bacteria | 784 |
| 342 | Ga0207698_10001428 | 3300026142 | Bacteria | 13881 |
| 343 | Ga0207698_10098259 | 3300026142 | Bacteria | 2419 |
| 344 | Ga0207698_10237747 | 3300026142 | Bacteria | 1658 |
| 345 | Ga0207428_10307570 | 3300027907 | Bacteria | 1172 |
| 346 | Ga0268266_10859849 | 3300028379 | Bacteria | 877 |
| 347 | Ga0268265_10727773 | 3300028380 | Bacteria | 961 |
| 348 | Ga0268264_10000507 | 3300028381 | Bacteria | 50105 |
| 349 | Ga0268264_10011287 | 3300028381 | Bacteria | 7380 |
| 350 | Ga0268264_10165856 | 3300028381 | Bacteria | 1994 |
| 351 | Ga0265323_10000221 | 3300028653 | Bacteria | 33540 |
| 352 | Ga0307515_10000021 | 3300028794 | Bacteria | 406008 |
| 353 | Ga0265338_10009194 | 3300028800 | Bacteria | 11838 |
| 354 | Ga0265338_10228583 | 3300028800 | Bacteria | 1385 |
| 355 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 356 | Ga0265327_10047772 | 3300031251 | Bacteria | 2255 |
| 357 | Ga0265316_10002752 | 3300031344 | Bacteria | 18013 |
| 358 | Ga0265316_10092887 | 3300031344 | Bacteria | 2300 |
| 359 | Ga0265316_10577099 | 3300031344 | Bacteria | 799 |
| 360 | Ga0307513_10324677 | 3300031456 | Bacteria | 1296 |
| 361 | Ga0307509_10070264 | 3300031507 | Bacteria | 3657 |
| 362 | Ga0307408_100080864 | 3300031548 | Bacteria | 2428 |
| 363 | Ga0316578_10803815 | 3300031728 | Bacteria | 545 |
| 364 | Ga0307516_10000624 | 3300031730 | Bacteria | 47647 |
| 365 | Ga0307516_10238316 | 3300031730 | Unclassified | 1519 |
| 366 | Ga0307405_10000004 | 3300031731 | Bacteria | 444977 |
| 367 | Ga0307413_10000051 | 3300031824 | Bacteria | 30566 |
| 368 | Ga0307413_10198783 | 3300031824 | Unclassified | 1446 |
| 369 | Ga0307413_10216165 | 3300031824 | Bacteria | 1396 |
| 370 | Ga0307410_12063254 | 3300031852 | Bacteria | 509 |
| 371 | Ga0307406_10008772 | 3300031901 | Bacteria | 5652 |
| 372 | Ga0307407_10478704 | 3300031903 | Unclassified | 909 |
| 373 | Ga0307412_10436070 | 3300031911 | Bacteria | 1075 |
| 374 | Ga0307412_10511951 | 3300031911 | Bacteria | 1001 |
| 375 | Ga0307412_11902552 | 3300031911 | Bacteria | 549 |
| 376 | Ga0307416_100415032 | 3300032002 | Bacteria | 1388 |
| 377 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 378 | Ga0307414_10045576 | 3300032004 | Bacteria | 3004 |
| 379 | Ga0307414_10076399 | 3300032004 | Bacteria | 2434 |
| 380 | Ga0307414_10232621 | 3300032004 | Unclassified | 1520 |
| 381 | Ga0307414_11462431 | 3300032004 | Bacteria | 636 |
| 382 | Ga0307411_10000009 | 3300032005 | Bacteria | 319906 |
| 383 | Ga0307415_101349758 | 3300032126 | Bacteria | 677 |
| 384 | Ga0307510_10024942 | 3300033180 | Bacteria | 6903 |
| 385 | Ga0373953_0110293 | 3300035117 | Bacteria | 1163 |
| 386 | Ga0373956_0117247 | 3300035119 | Bacteria | 1242 |
| 387 | Ga0373955_0096163 | 3300035172 | Bacteria | 1695 |
| 388 | Ga0373933_0067789 | 3300035724 | Unclassified | 2166 |
| 389 | Ga0373937_0000626 | 3300036401 | Bacteria | 31047 |
| 390 | Ga0373937_0116266 | 3300036401 | Bacteria | 2491 |
| 391 | Ga0373925_0099752 | 3300037068 | Bacteria | 2231 |
| 392 | Ga0395905_0088466 | 3300037471 | Unclassified | 2903 |
| 393 | Ga0400489_30564 | 3300039093 | Unclassified | 2434 |
| 394 | Ga0436365_1642374 | 3300039437 | Bacteria | 37274 |
| 395 | Ga0439436_0000241 | 3300041404 | Bacteria | 13168 |
| 396 | Ga0439436_0109200 | 3300041404 | Bacteria | 772 |
| 397 | Ga0439439_0020088 | 3300041406 | Bacteria | 1659 |
| 398 | Ga0439439_0251965 | 3300041406 | Bacteria | 524 |
| 399 | Ga0439466_0011475 | 3300041411 | Bacteria | 3279 |
| 400 | Ga0451793_0706105 | 3300041452 | Bacteria | 841 |
| 401 | Ga0451793_1495812 | 3300041452 | Bacteria | 810 |
| 402 | Ga0451795_0564429 | 3300041456 | Bacteria | 904 |
| 403 | Ga0451804_0049540 | 3300041463 | Bacteria | 729 |
| 404 | Ga0451804_0150909 | 3300041463 | Bacteria | 512 |
| 405 | Ga0451807_1891133 | 3300041486 | Bacteria | 595 |
| 406 | Ga0451807_2719456 | 3300041486 | Bacteria | 765 |
| 407 | Ga0451849_0338528 | 3300041505 | Bacteria | 855 |
| 408 | Ga0451855_0347797 | 3300041511 | Bacteria | 736 |
| 409 | Ga0451853_0282940 | 3300041512 | Bacteria | 627 |
| 410 | Ga0439449_0006359 | 3300042007 | Bacteria | 4515 |
| 411 | Ga0439449_0108870 | 3300042007 | Unclassified | 1026 |
| 412 | Ga0439457_000013 | 3300042014 | Bacteria | 36480 |
| 413 | Ga0439462_0005652 | 3300042015 | Bacteria | 3087 |
| 414 | Ga0451577_0152156 | 3300042876 | Bacteria | 2082 |
| 415 | Ga0451577_0310080 | 3300042876 | Unclassified | 1430 |
| 416 | Ga0451577_0323299 | 3300042876 | Bacteria | 1399 |
| 417 | Ga0466972_0023006 | 3300044658 | Bacteria | 3101 |
| 418 | Ga0453683_1173705 | 3300044673 | Bacteria | 513 |
| 419 | Ga0466965_0170178 | 3300044683 | Unclassified | 1146 |
| 420 | Ga0466966_0000215 | 3300044684 | Bacteria | 38667 |
| 421 | Ga0466961_0088709 | 3300044693 | Bacteria | 1954 |
| 422 | Ga0453684_0009201 | 3300044712 | Bacteria | 17361 |
| 423 | Ga0453684_0080844 | 3300044712 | Bacteria | 4056 |
| 424 | Ga0453684_0261441 | 3300044712 | Unclassified | 1982 |
| 425 | Ga0453684_0721578 | 3300044712 | Unclassified | 1081 |
| 426 | Ga0466957_0001062 | 3300044842 | Bacteria | 14167 |
| 427 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 428 | Ga0466959_0858257 | 3300045049 | Bacteria | 606 |
| 429 | Ga0466959_1098298 | 3300045049 | Bacteria | 529 |
| 430 | Ga0451576_0453707 | 3300045051 | Bacteria | 1346 |
| 431 | Ga0451576_0491101 | 3300045051 | Bacteria | 1290 |
| 432 | Ga0451576_0592236 | 3300045051 | Bacteria | 1165 |
| 433 | Ga0451576_0643197 | 3300045051 | Unclassified | 1114 |
| 434 | Ga0495592_0036257 | 3300046454 | Bacteria | 3715 |
| 435 | Ga0495638_0038781 | 3300046460 | Bacteria | 3026 |
| 436 | Ga0495638_0288053 | 3300046460 | Unclassified | 890 |
| 437 | Ga0495653_0105669 | 3300046463 | Unclassified | 2032 |
| 438 | Ga0495664_0171988 | 3300046477 | Bacteria | 1314 |
| 439 | Ga0495608_0030685 | 3300046511 | Bacteria | 3638 |
| 440 | Ga0495628_0022572 | 3300046516 | Bacteria | 5169 |
| 441 | Ga0495630_0002445 | 3300046517 | Bacteria | 12849 |
| 442 | Ga0495632_0194311 | 3300046519 | Bacteria | 926 |
| 443 | Ga0495648_0190471 | 3300046524 | Unclassified | 1035 |
| 444 | Ga0495586_0229893 | 3300046535 | Bacteria | 1055 |
| 445 | Ga0495668_0000187 | 3300046616 | Bacteria | 92571 |
| 446 | Ga0495668_0001516 | 3300046616 | Bacteria | 22085 |
| 447 | Ga0495668_0514404 | 3300046616 | Bacteria | 660 |
| 448 | Ga0495634_0030402 | 3300046642 | Unclassified | 3730 |
| 449 | Ga0495599_0090757 | 3300046678 | Unclassified | 1906 |
| 450 | Ga0495613_0193967 | 3300046689 | Bacteria | 1435 |
| 451 | Ga0495674_0115663 | 3300047319 | Unclassified | 2270 |
| 452 | Ga0495680_0054648 | 3300047322 | Unclassified | 3100 |
| 453 | Ga0495675_0049320 | 3300047444 | Bacteria | 2677 |
| 454 | Ga0495684_0028889 | 3300047471 | Bacteria | 4256 |
| 455 | Ga0495686_0083105 | 3300047472 | Bacteria | 1954 |
| 456 | Ga0495686_0152118 | 3300047472 | Bacteria | 1358 |
| 457 | Ga0496100_0107985 | 3300048903 | Bacteria | 1929 |
| 458 | Ga0496101_0008439 | 3300048904 | Bacteria | 6730 |
| 459 | Ga0496104_0187951 | 3300048907 | Unclassified | 1977 |
| 460 | Ga0496105_0868653 | 3300048908 | Unclassified | 682 |
| 461 | Ga0496116_0000131 | 3300048919 | Bacteria | 157025 |
| 462 | Ga0496118_0023070 | 3300048921 | Bacteria | 5418 |
| 463 | Ga0496121_0132060 | 3300048924 | Bacteria | 1867 |
| 464 | Ga0496124_0032013 | 3300048927 | Bacteria | 4651 |
| 465 | Ga0496125_0000298 | 3300048928 | Bacteria | 97630 |
| 466 | Ga0496125_0001303 | 3300048928 | Bacteria | 36999 |
| 467 | Ga0496126_0022891 | 3300048929 | Bacteria | 6065 |
| 468 | Ga0501291_155525 | 3300049514 | Unclassified | 519 |
| 469 | Ga0501292_041879 | 3300049515 | Bacteria | 793 |
| 470 | Ga0501294_013754 | 3300049517 | Bacteria | 822 |
| 471 | Ga0501299_076752 | 3300049522 | Bacteria | 735 |
| 472 | Ga0501303_033391 | 3300049526 | Bacteria | 612 |
| 473 | Ga0501034_0034462 | 3300049571 | Bacteria | 5132 |
| 474 | Ga0501036_0062315 | 3300049572 | Bacteria | 3159 |
| 475 | Ga0501038_0167866 | 3300049574 | Bacteria | 1779 |
| 476 | Ga0501043_0046407 | 3300049579 | Bacteria | 3416 |
| 477 | Ga0501043_0185062 | 3300049579 | Unclassified | 1622 |
| 478 | Ga0501047_0228247 | 3300049581 | Bacteria | 1716 |
| 479 | Ga0501047_0240788 | 3300049581 | Bacteria | 1660 |
| 480 | Ga0501047_0488128 | 3300049581 | Bacteria | 1059 |
| 481 | Ga0501072_0184637 | 3300049588 | Unclassified | 1664 |
| 482 | Ga0501198_006303 | 3300049649 | Bacteria | 1685 |
| 483 | Ga0501201_000274 | 3300049651 | Bacteria | 4662 |
| 484 | Ga0501202_000772 | 3300049652 | Bacteria | 4807 |
| 485 | Ga0501202_038698 | 3300049652 | Bacteria | 1023 |
| 486 | Ga0501202_130623 | 3300049652 | Bacteria | 640 |
| 487 | Ga0501206_000771 | 3300049653 | Unclassified | 3921 |
| 488 | Ga0501207_001256 | 3300049654 | Unclassified | 3131 |
| 489 | Ga0501217_000499 | 3300049661 | Bacteria | 6489 |
| 490 | Ga0501224_027801 | 3300049664 | Unclassified | 846 |
| 491 | Ga0501233_000921 | 3300049668 | Bacteria | 4984 |
| 492 | Ga0501233_176898 | 3300049668 | Bacteria | 609 |
| 493 | Ga0501235_001515 | 3300049669 | Bacteria | 4978 |
| 494 | Ga0501235_026150 | 3300049669 | Bacteria | 1307 |
| 495 | Ga0501235_035796 | 3300049669 | Unclassified | 1128 |
| 496 | Ga0501235_045461 | 3300049669 | Bacteria | 1010 |
| 497 | Ga0501236_000151 | 3300049670 | Bacteria | 7148 |
| 498 | Ga0501238_000326 | 3300049671 | Bacteria | 6178 |
| 499 | Ga0501242_004634 | 3300049674 | Unclassified | 1529 |
| 500 | Ga0501242_023830 | 3300049674 | Bacteria | 800 |
| 501 | Ga0501242_067885 | 3300049674 | Bacteria | 554 |
| 502 | Ga0501243_000084 | 3300049675 | Bacteria | 9537 |
| 503 | Ga0501250_004999 | 3300049680 | Unclassified | 1345 |
| 504 | Ga0501250_036534 | 3300049680 | Unclassified | 704 |
| 505 | Ga0501252_087586 | 3300049682 | Bacteria | 523 |
| 506 | Ga0501256_005165 | 3300049685 | Bacteria | 1143 |
| 507 | Ga0501257_001118 | 3300049686 | Bacteria | 5452 |
| 508 | Ga0501257_074115 | 3300049686 | Unclassified | 872 |
| 509 | Ga0501257_105192 | 3300049686 | Bacteria | 744 |
| 510 | Ga0501260_008996 | 3300049689 | Unclassified | 989 |
| 511 | Ga0501261_000499 | 3300049690 | Bacteria | 5024 |
| 512 | Ga0501221_154719 | 3300049704 | Bacteria | 610 |
| 513 | Ga0501225_0001569 | 3300049705 | Bacteria | 7163 |
| 514 | Ga0501234_024739 | 3300049707 | Unclassified | 962 |
| 515 | Ga0501080_0606396 | 3300049742 | Bacteria | 971 |
| 516 | Ga0501241_031805 | 3300049758 | Bacteria | 999 |
| 517 | Ga0501241_079604 | 3300049758 | Bacteria | 680 |
| 518 | Ga0501264_000204 | 3300049761 | Bacteria | 9608 |
| 519 | Ga0501266_000013 | 3300049763 | Bacteria | 183849 |
| 520 | Ga0501269_002382 | 3300049766 | Bacteria | 2320 |
| 521 | Ga0501270_103554 | 3300049767 | Bacteria | 598 |
| 522 | Ga0501272_059692 | 3300049769 | Bacteria | 543 |
| 523 | Ga0501279_044406 | 3300049775 | Unclassified | 690 |
| 524 | Ga0501283_005917 | 3300049779 | Unclassified | 1696 |
| 525 | Ga0501044_0989185 | 3300049823 | Bacteria | 713 |
| 526 | Ga0501212_012397 | 3300049851 | Bacteria | 1240 |
| 527 | nmdc:mga0k408_121453_c1 | 3300050493 | Bacteria | 1547 |
| 528 | nmdc:mga0k408_25887_c1 | 3300050493 | Bacteria | 3324 |
| 529 | nmdc:mga05p37_66944_c1 | 3300050507 | Bacteria | 4418 |
| 530 | nmdc:mga09592_1146978_c1 | 3300050508 | Bacteria | 644 |
| 531 | nmdc:mga09592_53621_c1 | 3300050508 | Bacteria | 3405 |
| 532 | nmdc:mga0qj67_38892_c1 | 3300050509 | Bacteria | 3733 |
| 533 | nmdc:mga06r32_42304_c1 | 3300050510 | Bacteria | 4331 |
| 534 | nmdc:mga06r32_845837_c1 | 3300050510 | Unclassified | 874 |
| 535 | nmdc:mga08y16_1132145_c1 | 3300050511 | Unclassified | 756 |
| 536 | nmdc:mga08y16_484725_c1 | 3300050511 | Bacteria | 1258 |
| 537 | Ga0500581_240133 | 3300053089 | Bacteria | 770 |
| 538 | Ga0500646_0089613 | 3300053090 | Bacteria | 950 |
| 539 | Ga0500583_0041595 | 3300053092 | Bacteria | 2089 |
| 540 | Ga0500651_0212312 | 3300053093 | Bacteria | 1138 |
| 541 | Ga0500651_0227864 | 3300053093 | Bacteria | 1091 |
| 542 | Ga0500651_0235971 | 3300053093 | Bacteria | 1068 |
| 543 | Ga0500641_0015523 | 3300053096 | Bacteria | 2829 |
| 544 | Ga0500650_0066053 | 3300053098 | Bacteria | 1690 |
| 545 | Ga0500650_0323348 | 3300053098 | Unclassified | 679 |
| 546 | Ga0500555_023557 | 3300053103 | Bacteria | 1765 |
| 547 | Ga0500628_071235 | 3300053129 | Bacteria | 871 |
| 548 | Ga0500652_038110 | 3300053131 | Bacteria | 1921 |
| 549 | Ga0500559_0020975 | 3300053136 | Bacteria | 2766 |
| 550 | Ga0500568_0001318 | 3300053139 | Bacteria | 16265 |
| 551 | Ga0500568_0051927 | 3300053139 | Bacteria | 1611 |
| 552 | Ga0500589_003695 | 3300053147 | Bacteria | 5581 |
| 553 | Ga0500616_0010714 | 3300053153 | Bacteria | 5470 |
| 554 | Ga0500622_0047253 | 3300053156 | Bacteria | 2224 |
| 555 | Ga0500627_0066990 | 3300053158 | Unclassified | 1586 |
| 556 | Ga0500627_0184642 | 3300053158 | Bacteria | 938 |
| 557 | Ga0500639_131507 | 3300053163 | Bacteria | 1185 |
| 558 | Ga0500636_0156746 | 3300053177 | Bacteria | 1245 |
| 559 | Ga0500637_0193736 | 3300053178 | Bacteria | 1160 |
| 560 | 2513236227 | 2513020052 | Bacteria | 5120511 |
| 561 | 2520879976 | 2519899754 | Bacteria | 5336938 |
| 562 | 2522552024 | 2522125168 | Bacteria | 7376607 |
| 563 | 2644012631 | 2643221600 | Bacteria | 5530138 |
| 564 | 2644641905 | 2643221716 | Bacteria | 4986332 |
| 565 | 2644681989 | 2643221725 | Bacteria | 5087956 |
| 566 | 2738736801 | 2738541279 | Bacteria | 6149495 |
| 567 | 2738769341 | 2738541285 | Bacteria | 6150075 |
| 568 | 2739218383 | 2738543007 | Bacteria | 6149845 |
| 569 | 2802654938 | 2802428842 | Bacteria | 4926114 |
| 570 | 2817413662 | 2816332280 | Bacteria | 5109718 |
| 571 | 2819590460 | 2818991444 | Bacteria | 6968812 |
| 572 | 2852626371 | 2852623160 | Bacteria | 4376875 |
| 573 | 2857616596 | 2857613821 | Bacteria | 4917088 |
| 574 | 2883070233 | 2883068021 | Bacteria | 6192739 |
| 575 | 2884797112 | 2884791551 | Bacteria | 8511252 |
| 576 | 2884934823 | 2884933994 | Bacteria | 4535041 |
| 577 | 2903899311 | 2903895155 | Bacteria | 5258610 |
| 578 | 2904421744 | 2904419702 | Bacteria | 5166287 |
| 579 | 2929921430 | 2929921140 | Bacteria | 8649150 |
| 580 | 2977272179 | 2977268062 | Bacteria | 5243061 |
| 581 | 8054308711 | 8054307821 | Bacteria | 5212224 |
| 582 | 8055597324 | 8055592153 | Bacteria | 5961247 |
| 583 | rootL2_10062850 | |||
| 584 | MRS1b_contig_6820906 | |||
| 585 | JGI25154J39366_1000006 | |||
| 586 | JGI25157J39369_1011591 | |||
| 587 | rootH1_10001870 | |||
| 588 | rootH2_10088081 | |||
| 589 | rootL2_10009529 | |||
| 590 | rootL2_10024221 | |||
| 591 | rootL2_10024222 | |||
| 592 | rootL2_10176412 | |||
| 593 | rootL2_10334933 | |||
| 594 | rootH1_10012417 | |||
| 595 | rootH1_10033067 | |||
| 596 | rootH1_10163868 | |||
| 597 | rootH1_10398835 | |||
| 598 | JGI25160J50197_1008924 | |||
| 599 | Ga0065714_10003873 | |||
| 600 | Ga0065714_10072417 | |||
| 601 | Ga0065714_10140865 | |||
| 602 | Ga0065714_10233419 | |||
| 603 | Ga0065704_10013290 | |||
| 604 | Ga0065704_10084390 | |||
| 605 | Ga0065704_10119380 | |||
| 606 | Ga0065704_10189468 | |||
| 607 | Ga0065712_10171667 | |||
| 608 | Ga0065715_10171969 | |||
| 609 | Ga0065707_10016442 | |||
| 610 | Ga0065707_10018800 | |||
| 611 | Ga0070658_10013937 | |||
| 612 | Ga0070658_11250291 | |||
| 613 | Ga0070670_100093583 | |||
| 614 | Ga0070670_100152166 | |||
| 615 | Ga0070666_10065105 | |||
| 616 | Ga0070666_10176832 | |||
| 617 | Ga0070666_10530821 | |||
| 618 | Ga0068868_100068287 | |||
| 619 | Ga0068868_100721998 | |||
| 620 | Ga0068868_101688987 | |||
| 621 | Ga0070689_100016199 | |||
| 622 | Ga0070687_101240642 | |||
| 623 | Ga0070661_100042353 | |||
| 624 | Ga0070661_100196070 | |||
| 625 | Ga0070668_100075389 | |||
| 626 | Ga0070668_100323521 | |||
| 627 | Ga0070668_100371139 | |||
| 628 | Ga0070669_100224013 | |||
| 629 | Ga0070669_100981731 | |||
| 630 | Ga0070675_100006660 | |||
| 631 | Ga0070675_100681016 | |||
| 632 | Ga0070675_101137234 | |||
| 633 | Ga0070671_100047889 | |||
| 634 | Ga0070671_100093713 | |||
| 635 | Ga0070674_100022974 | |||
| 636 | Ga0070673_100074029 | |||
| 637 | Ga0070673_100144248 | |||
| 638 | Ga0070673_101280301 | |||
| 639 | Ga0070688_100423134 | |||
| 640 | Ga0070659_100020411 | |||
| 641 | Ga0070667_100009396 | |||
| 642 | Ga0070667_100032870 | |||
| 643 | Ga0070667_100521019 | |||
| 644 | Ga0070667_101447329 | |||
| 645 | Ga0070667_101769996 | |||
| 646 | Ga0070709_10712973 | |||
| 647 | Ga0070711_101749579 | |||
| 648 | Ga0070663_100275519 | |||
| 649 | Ga0070663_100743611 | |||
| 650 | Ga0070678_100211600 | |||
| 651 | Ga0070678_100683736 | |||
| 652 | Ga0070662_100041673 | |||
| 653 | Ga0070662_100858043 | |||
| 654 | Ga0070662_101749900 | |||
| 655 | Ga0068867_100040437 | |||
| 656 | Ga0068867_100081944 | |||
| 657 | Ga0068867_100287293 | |||
| 658 | Ga0068867_100533142 | |||
| 659 | Ga0070685_10113647 | |||
| 660 | Ga0070698_100004536 | |||
| 661 | Ga0070699_100428601 | |||
| 662 | Ga0070684_100428157 | |||
| 663 | Ga0070684_101897465 | |||
| 664 | Ga0070697_100507106 | |||
| 665 | Ga0068853_100156865 | |||
| 666 | Ga0068853_100254886 | |||
| 667 | Ga0068853_100288966 | |||
| 668 | Ga0070672_100094126 | |||
| 669 | Ga0070672_100601524 | |||
| 670 | Ga0070693_100160350 | |||
| 671 | Ga0068855_100004102 | |||
| 672 | Ga0068855_100236698 | |||
| 673 | Ga0070664_100930583 | |||
| 674 | Ga0068857_100045396 | |||
| 675 | Ga0068857_100074969 | |||
| 676 | Ga0068857_100298272 | |||
| 677 | Ga0068857_100487266 | |||
| 678 | Ga0068857_100735910 | |||
| 679 | Ga0068856_100229234 | |||
| 680 | Ga0068852_100019736 | |||
| 681 | Ga0068852_100338980 | |||
| 682 | Ga0068852_100556534 | |||
| 683 | Ga0068859_100125822 | |||
| 684 | Ga0068859_101383159 | |||
| 685 | Ga0068864_100051884 | |||
| 686 | Ga0068864_100067548 | |||
| 687 | Ga0068864_100284392 | |||
| 688 | Ga0068864_100416070 | |||
| 689 | Ga0068864_101038630 | |||
| 690 | Ga0068861_100385234 | |||
| 691 | Ga0068861_101443981 | |||
| 692 | Ga0068851_10063504 | |||
| 693 | Ga0068870_10392564 | |||
| 694 | Ga0068863_100006021 | |||
| 695 | Ga0068863_100256263 | |||
| 696 | Ga0068863_100399847 | |||
| 697 | Ga0068860_100000443 | |||
| 698 | Ga0068860_100015182 | |||
| 699 | Ga0068860_100283641 | |||
| 700 | Ga0068862_101153440 | |||
| 701 | Ga0081539_10005379 | |||
| 702 | Ga0070717_10406048 | |||
| 703 | Ga0070715_10296405 | |||
| 704 | Ga0070716_100325277 | |||
| 705 | Ga0075427_10025686 | |||
| 706 | Ga0075366_10034256 | |||
| 707 | Ga0075366_10046124 | |||
| 708 | Ga0075366_10080838 | |||
| 709 | Ga0097621_100002296 | |||
| 710 | Ga0097621_100002810 | |||
| 711 | Ga0097621_100052282 | |||
| 712 | Ga0097621_100142527 | |||
| 713 | Ga0097621_100446080 | |||
| 714 | Ga0068871_100000814 | |||
| 715 | Ga0068871_100086241 | |||
| 716 | Ga0075428_100014184 | |||
| 717 | Ga0075428_100222964 | |||
| 718 | Ga0075428_100431917 | |||
| 719 | Ga0075428_101722565 | |||
| 720 | Ga0075430_100005140 | |||
| 721 | Ga0075430_100047614 | |||
| 722 | Ga0075430_100367190 | |||
| 723 | Ga0075431_100103625 | |||
| 724 | Ga0075431_100117208 | |||
| 725 | Ga0075429_100029461 | |||
| 726 | Ga0068865_100055188 | |||
| 727 | Ga0097620_100125823 | |||
| 728 | Ga0097620_100738481 | |||
| 729 | Ga0097620_101382972 | |||
| 730 | Ga0099826_10000966 | |||
| 731 | Ga0105244_10054936 | |||
| 732 | Ga0105240_10000329 | |||
| 733 | Ga0105240_10062828 | |||
| 734 | Ga0111539_10023564 | |||
| 735 | Ga0111539_11613800 | |||
| 736 | Ga0111539_11637289 | |||
| 737 | Ga0105247_10003717 | |||
| 738 | Ga0114129_10019889 | |||
| 739 | Ga0105241_10006108 | |||
| 740 | Ga0105241_10019786 | |||
| 741 | Ga0105241_10240005 | |||
| 742 | Ga0105241_10333747 | |||
| 743 | Ga0105242_10014337 | |||
| 744 | Ga0105242_10064474 | |||
| 745 | Ga0105242_10083048 | |||
| 746 | Ga0105248_10074284 | |||
| 747 | Ga0105248_10217180 | |||
| 748 | Ga0105237_10063389 | |||
| 749 | Ga0105237_10063410 | |||
| 750 | Ga0105237_10126743 | |||
| 751 | Ga0105237_10379532 | |||
| 752 | Ga0105237_10484958 | |||
| 753 | Ga0105238_10004094 | |||
| 754 | Ga0105249_10094480 | |||
| 755 | Ga0105249_10115961 | |||
| 756 | Ga0105249_10632550 | |||
| 757 | Ga0105249_10759541 | |||
| 758 | Ga0105249_10830712 | |||
| 759 | Ga0105239_10028606 | |||
| 760 | Ga0105239_10284754 | |||
| 761 | Ga0105239_10610150 | |||
| 762 | Ga0105239_10739039 | |||
| 763 | Ga0105239_11374211 | |||
| 764 | Ga0105246_10015893 | |||
| 765 | Ga0105246_11049915 | |||
| 766 | Ga0157373_10000033 | |||
| 767 | Ga0157371_10003330 | |||
| 768 | Ga0157371_10244984 | |||
| 769 | Ga0157371_10290468 | |||
| 770 | Ga0157371_10674175 | |||
| 771 | Ga0157370_10001263 | |||
| 772 | Ga0157370_10007296 | |||
| 773 | Ga0157370_10043458 | |||
| 774 | Ga0157370_10099555 | |||
| 775 | Ga0157370_10170532 | |||
| 776 | Ga0157370_10352423 | |||
| 777 | Ga0157370_10564586 | |||
| 778 | Ga0157370_11236844 | |||
| 779 | Ga0157369_10012442 | |||
| 780 | Ga0157369_10129173 | |||
| 781 | Ga0157369_10949541 | |||
| 782 | Ga0157374_10831346 | |||
| 783 | Ga0157378_10010383 | |||
| 784 | Ga0157378_10012714 | |||
| 785 | Ga0157378_10198670 | |||
| 786 | Ga0157378_10282567 | |||
| 787 | Ga0157378_11663912 | |||
| 788 | Ga0163162_10000026 | |||
| 789 | Ga0163162_10001199 | |||
| 790 | Ga0163162_10003537 | |||
| 791 | Ga0163162_10120248 | |||
| 792 | Ga0163162_10127721 | |||
| 793 | Ga0163162_10236201 | |||
| 794 | Ga0163162_10256593 | |||
| 795 | Ga0163162_10829945 | |||
| 796 | Ga0157372_10000494 | |||
| 797 | Ga0157372_10072360 | |||
| 798 | Ga0157372_10083339 | |||
| 799 | Ga0157372_10102212 | |||
| 800 | Ga0157372_10365902 | |||
| 801 | Ga0157372_10593080 | |||
| 802 | Ga0157372_10904796 | |||
| 803 | Ga0157372_11351866 | |||
| 804 | Ga0157372_11609765 | |||
| 805 | Ga0157375_10000773 | |||
| 806 | Ga0157375_10009118 | |||
| 807 | Ga0157375_10711085 | |||
| 808 | Ga0157375_10965033 | |||
| 809 | Ga0157375_10999819 | |||
| 810 | Ga0157375_12278671 | |||
| 811 | Ga0157375_13343400 | |||
| 812 | Ga0163163_10140110 | |||
| 813 | Ga0163163_10678103 | |||
| 814 | Ga0163163_10714951 | |||
| 815 | Ga0163163_11250214 | |||
| 816 | Ga0163163_11667752 | |||
| 817 | Ga0157380_10001024 | |||
| 818 | Ga0157380_10889385 | |||
| 819 | Ga0157377_10567624 | |||
| 820 | Ga0157379_10070134 | |||
| 821 | Ga0157379_10074438 | |||
| 822 | Ga0157379_10223834 | |||
| 823 | Ga0157379_10577294 | |||
| 824 | Ga0157376_10001241 | |||
| 825 | Ga0157376_10950232 | |||
| 826 | Ga0182006_1020125 | |||
| 827 | Ga0163161_10000034 | |||
| 828 | Ga0163161_10001826 | |||
| 829 | Ga0163161_10228198 | |||
| 830 | Ga0163161_11081643 | |||
| 831 | Ga0209646_1000031 | |||
| 832 | Ga0209646_1002048 | |||
| 833 | Ga0209026_1000019 | |||
| 834 | Ga0209129_1016784 | |||
| 835 | Ga0209758_1002724 | |||
| 836 | Ga0207426_1000445 | |||
| 837 | Ga0209257_1000004 | |||
| 838 | Ga0207656_10178774 | |||
| 839 | Ga0207655_1078037 | |||
| 840 | Ga0207710_10000886 | |||
| 841 | Ga0207680_10111822 | |||
| 842 | Ga0207680_10580761 | |||
| 843 | Ga0207647_10000088 | |||
| 844 | Ga0207647_10136292 | |||
| 845 | Ga0207647_10237634 | |||
| 846 | Ga0207645_10136145 | |||
| 847 | Ga0207645_11015932 | |||
| 848 | Ga0207705_11142075 | |||
| 849 | Ga0207654_10034380 | |||
| 850 | Ga0207654_10358363 | |||
| 851 | Ga0207654_10666783 | |||
| 852 | Ga0207695_10001095 | |||
| 853 | Ga0207671_10007870 | |||
| 854 | Ga0207671_10399821 | |||
| 855 | Ga0207657_10189786 | |||
| 856 | Ga0207649_10037276 | |||
| 857 | Ga0207681_10109865 | |||
| 858 | Ga0207681_10394655 | |||
| 859 | Ga0207694_10087969 | |||
| 860 | Ga0207650_10015889 | |||
| 861 | Ga0207650_10077070 | |||
| 862 | Ga0207650_10168579 | |||
| 863 | Ga0207659_10578270 | |||
| 864 | Ga0207659_10931994 | |||
| 865 | Ga0207659_11423341 | |||
| 866 | Ga0207644_10151251 | |||
| 867 | Ga0207644_10388218 | |||
| 868 | Ga0207706_10744933 | |||
| 869 | Ga0207686_10049658 | |||
| 870 | Ga0207669_10046592 | |||
| 871 | Ga0207669_10397187 | |||
| 872 | Ga0207704_10030424 | |||
| 873 | Ga0207691_10078579 | |||
| 874 | Ga0207691_10402631 | |||
| 875 | Ga0207691_11478394 | |||
| 876 | Ga0207689_10100770 | |||
| 877 | Ga0207661_10330419 | |||
| 878 | Ga0207679_10072855 | |||
| 879 | Ga0207667_10006745 | |||
| 880 | Ga0207667_10327708 | |||
| 881 | Ga0207712_10060227 | |||
| 882 | Ga0207712_10196623 | |||
| 883 | Ga0207712_10419780 | |||
| 884 | Ga0207712_10614053 | |||
| 885 | Ga0207712_11270216 | |||
| 886 | Ga0207668_10614830 | |||
| 887 | Ga0207668_10830395 | |||
| 888 | Ga0207658_10079378 | |||
| 889 | Ga0207658_10127330 | |||
| 890 | Ga0207658_10496901 | |||
| 891 | Ga0207677_10029490 | |||
| 892 | Ga0207703_11647079 | |||
| 893 | Ga0207639_10032059 | |||
| 894 | Ga0207639_10069236 | |||
| 895 | Ga0207639_10258631 | |||
| 896 | Ga0207639_10608094 | |||
| 897 | Ga0207678_10234837 | |||
| 898 | Ga0207678_10550607 | |||
| 899 | Ga0207702_10039409 | |||
| 900 | Ga0207702_10070931 | |||
| 901 | Ga0207702_11083793 | |||
| 902 | Ga0207641_10006712 | |||
| 903 | Ga0207641_10133607 | |||
| 904 | Ga0207641_10790132 | |||
| 905 | Ga0207648_10021453 | |||
| 906 | Ga0207648_10047489 | |||
| 907 | Ga0207648_10119727 | |||
| 908 | Ga0207648_10173275 | |||
| 909 | Ga0207676_10074684 | |||
| 910 | Ga0207676_10222308 | |||
| 911 | Ga0207676_10388480 | |||
| 912 | Ga0207676_11743972 | |||
| 913 | Ga0207674_10106704 | |||
| 914 | Ga0207674_10203647 | |||
| 915 | Ga0207674_10446662 | |||
| 916 | Ga0207674_10568147 | |||
| 917 | Ga0207674_11933385 | |||
| 918 | Ga0207675_100011769 | |||
| 919 | Ga0207675_101398929 | |||
| 920 | Ga0207683_10102370 | |||
| 921 | Ga0207683_10715528 | |||
| 922 | Ga0207683_10957811 | |||
| 923 | Ga0207683_10983003 | |||
| 924 | Ga0207698_10001428 | |||
| 925 | Ga0207698_10098259 | |||
| 926 | Ga0207698_10237747 | |||
| 927 | Ga0207428_10307570 | |||
| 928 | Ga0268266_10859849 | |||
| 929 | Ga0268265_10727773 | |||
| 930 | Ga0268264_10000507 | |||
| 931 | Ga0268264_10011287 | |||
| 932 | Ga0268264_10165856 | |||
| 933 | Ga0265323_10000221 | |||
| 934 | Ga0307515_10000021 | |||
| 935 | Ga0265338_10009194 | |||
| 936 | Ga0265338_10228583 | |||
| 937 | Ga0265327_10000152 | |||
| 938 | Ga0265327_10047772 | |||
| 939 | Ga0265316_10002752 | |||
| 940 | Ga0265316_10092887 | |||
| 941 | Ga0265316_10577099 | |||
| 942 | Ga0307513_10324677 | |||
| 943 | Ga0307509_10070264 | |||
| 944 | Ga0307408_100080864 | |||
| 945 | Ga0316578_10803815 | |||
| 946 | Ga0307516_10000624 | |||
| 947 | Ga0307516_10238316 | |||
| 948 | Ga0307405_10000004 | |||
| 949 | Ga0307413_10000051 | |||
| 950 | Ga0307413_10198783 | |||
| 951 | Ga0307413_10216165 | |||
| 952 | Ga0307410_12063254 | |||
| 953 | Ga0307406_10008772 | |||
| 954 | Ga0307407_10478704 | |||
| 955 | Ga0307412_10436070 | |||
| 956 | Ga0307412_10511951 | |||
| 957 | Ga0307412_11902552 | |||
| 958 | Ga0307416_100415032 | |||
| 959 | Ga0307414_10000268 | |||
| 960 | Ga0307414_10045576 | |||
| 961 | Ga0307414_10076399 | |||
| 962 | Ga0307414_10232621 | |||
| 963 | Ga0307414_11462431 | |||
| 964 | Ga0307411_10000009 | |||
| 965 | Ga0307415_101349758 | |||
| 966 | Ga0307510_10024942 | |||
| 967 | Ga0373953_0110293 | |||
| 968 | Ga0373956_0117247 | |||
| 969 | Ga0373955_0096163 | |||
| 970 | Ga0373933_0067789 | |||
| 971 | Ga0373937_0000626 | |||
| 972 | Ga0373937_0116266 | |||
| 973 | Ga0373925_0099752 | |||
| 974 | Ga0395905_0088466 | |||
| 975 | Ga0400489_30564 | |||
| 976 | Ga0436365_1642374 | |||
| 977 | Ga0439436_0000241 | |||
| 978 | Ga0439436_0109200 | |||
| 979 | Ga0439439_0020088 | |||
| 980 | Ga0439439_0251965 | |||
| 981 | Ga0439466_0011475 | |||
| 982 | Ga0451793_0706105 | |||
| 983 | Ga0451793_1495812 | |||
| 984 | Ga0451795_0564429 | |||
| 985 | Ga0451804_0049540 | |||
| 986 | Ga0451804_0150909 | |||
| 987 | Ga0451807_1891133 | |||
| 988 | Ga0451807_2719456 | |||
| 989 | Ga0451849_0338528 | |||
| 990 | Ga0451855_0347797 | |||
| 991 | Ga0451853_0282940 | |||
| 992 | Ga0439449_0006359 | |||
| 993 | Ga0439449_0108870 | |||
| 994 | Ga0439457_000013 | |||
| 995 | Ga0439462_0005652 | |||
| 996 | Ga0451577_0152156 | |||
| 997 | Ga0451577_0310080 | |||
| 998 | Ga0451577_0323299 | |||
| 999 | Ga0466972_0023006 | |||
| 1000 | Ga0453683_1173705 | |||
| 1001 | Ga0466965_0170178 | |||
| 1002 | Ga0466966_0000215 | |||
| 1003 | Ga0466961_0088709 | |||
| 1004 | Ga0453684_0009201 | |||
| 1005 | Ga0453684_0080844 | |||
| 1006 | Ga0453684_0261441 | |||
| 1007 | Ga0453684_0721578 | |||
| 1008 | Ga0466957_0001062 | |||
| 1009 | Ga0466959_0000004 | |||
| 1010 | Ga0466959_0858257 | |||
| 1011 | Ga0466959_1098298 | |||
| 1012 | Ga0451576_0453707 | |||
| 1013 | Ga0451576_0491101 | |||
| 1014 | Ga0451576_0592236 | |||
| 1015 | Ga0451576_0643197 | |||
| 1016 | Ga0495592_0036257 | |||
| 1017 | Ga0495638_0038781 | |||
| 1018 | Ga0495638_0288053 | |||
| 1019 | Ga0495653_0105669 | |||
| 1020 | Ga0495664_0171988 | |||
| 1021 | Ga0495608_0030685 | |||
| 1022 | Ga0495628_0022572 | |||
| 1023 | Ga0495630_0002445 | |||
| 1024 | Ga0495632_0194311 | |||
| 1025 | Ga0495648_0190471 | |||
| 1026 | Ga0495586_0229893 | |||
| 1027 | Ga0495668_0000187 | |||
| 1028 | Ga0495668_0001516 | |||
| 1029 | Ga0495668_0514404 | |||
| 1030 | Ga0495634_0030402 | |||
| 1031 | Ga0495599_0090757 | |||
| 1032 | Ga0495613_0193967 | |||
| 1033 | Ga0495674_0115663 | |||
| 1034 | Ga0495680_0054648 | |||
| 1035 | Ga0495675_0049320 | |||
| 1036 | Ga0495684_0028889 | |||
| 1037 | Ga0495686_0083105 | |||
| 1038 | Ga0495686_0152118 | |||
| 1039 | Ga0496100_0107985 | |||
| 1040 | Ga0496101_0008439 | |||
| 1041 | Ga0496104_0187951 | |||
| 1042 | Ga0496105_0868653 | |||
| 1043 | Ga0496116_0000131 | |||
| 1044 | Ga0496118_0023070 | |||
| 1045 | Ga0496121_0132060 | |||
| 1046 | Ga0496124_0032013 | |||
| 1047 | Ga0496125_0000298 | |||
| 1048 | Ga0496125_0001303 | |||
| 1049 | Ga0496126_0022891 | |||
| 1050 | Ga0501291_155525 | |||
| 1051 | Ga0501292_041879 | |||
| 1052 | Ga0501294_013754 | |||
| 1053 | Ga0501299_076752 | |||
| 1054 | Ga0501303_033391 | |||
| 1055 | Ga0501034_0034462 | |||
| 1056 | Ga0501036_0062315 | |||
| 1057 | Ga0501038_0167866 | |||
| 1058 | Ga0501043_0046407 | |||
| 1059 | Ga0501043_0185062 | |||
| 1060 | Ga0501047_0228247 | |||
| 1061 | Ga0501047_0240788 | |||
| 1062 | Ga0501047_0488128 | |||
| 1063 | Ga0501072_0184637 | |||
| 1064 | Ga0501198_006303 | |||
| 1065 | Ga0501201_000274 | |||
| 1066 | Ga0501202_000772 | |||
| 1067 | Ga0501202_038698 | |||
| 1068 | Ga0501202_130623 | |||
| 1069 | Ga0501206_000771 | |||
| 1070 | Ga0501207_001256 | |||
| 1071 | Ga0501217_000499 | |||
| 1072 | Ga0501224_027801 | |||
| 1073 | Ga0501233_000921 | |||
| 1074 | Ga0501233_176898 | |||
| 1075 | Ga0501235_001515 | |||
| 1076 | Ga0501235_026150 | |||
| 1077 | Ga0501235_035796 | |||
| 1078 | Ga0501235_045461 | |||
| 1079 | Ga0501236_000151 | |||
| 1080 | Ga0501238_000326 | |||
| 1081 | Ga0501242_004634 | |||
| 1082 | Ga0501242_023830 | |||
| 1083 | Ga0501242_067885 | |||
| 1084 | Ga0501243_000084 | |||
| 1085 | Ga0501250_004999 | |||
| 1086 | Ga0501250_036534 | |||
| 1087 | Ga0501252_087586 | |||
| 1088 | Ga0501256_005165 | |||
| 1089 | Ga0501257_001118 | |||
| 1090 | Ga0501257_074115 | |||
| 1091 | Ga0501257_105192 | |||
| 1092 | Ga0501260_008996 | |||
| 1093 | Ga0501261_000499 | |||
| 1094 | Ga0501221_154719 | |||
| 1095 | Ga0501225_0001569 | |||
| 1096 | Ga0501234_024739 | |||
| 1097 | Ga0501080_0606396 | |||
| 1098 | Ga0501241_031805 | |||
| 1099 | Ga0501241_079604 | |||
| 1100 | Ga0501264_000204 | |||
| 1101 | Ga0501266_000013 | |||
| 1102 | Ga0501269_002382 | |||
| 1103 | Ga0501270_103554 | |||
| 1104 | Ga0501272_059692 | |||
| 1105 | Ga0501279_044406 | |||
| 1106 | Ga0501283_005917 | |||
| 1107 | Ga0501044_0989185 | |||
| 1108 | Ga0501212_012397 | |||
| 1109 | nmdc:mga0k408_121453_c1 | |||
| 1110 | nmdc:mga0k408_25887_c1 | |||
| 1111 | nmdc:mga05p37_66944_c1 | |||
| 1112 | nmdc:mga09592_1146978_c1 | |||
| 1113 | nmdc:mga09592_53621_c1 | |||
| 1114 | nmdc:mga0qj67_38892_c1 | |||
| 1115 | nmdc:mga06r32_42304_c1 | |||
| 1116 | nmdc:mga06r32_845837_c1 | |||
| 1117 | nmdc:mga08y16_1132145_c1 | |||
| 1118 | nmdc:mga08y16_484725_c1 | |||
| 1119 | Ga0500581_240133 | |||
| 1120 | Ga0500646_0089613 | |||
| 1121 | Ga0500583_0041595 | |||
| 1122 | Ga0500651_0212312 | |||
| 1123 | Ga0500651_0227864 | |||
| 1124 | Ga0500651_0235971 | |||
| 1125 | Ga0500641_0015523 | |||
| 1126 | Ga0500650_0066053 | |||
| 1127 | Ga0500650_0323348 | |||
| 1128 | Ga0500555_023557 | |||
| 1129 | Ga0500628_071235 | |||
| 1130 | Ga0500652_038110 | |||
| 1131 | Ga0500559_0020975 | |||
| 1132 | Ga0500568_0001318 | |||
| 1133 | Ga0500568_0051927 | |||
| 1134 | Ga0500589_003695 | |||
| 1135 | Ga0500616_0010714 | |||
| 1136 | Ga0500622_0047253 | |||
| 1137 | Ga0500627_0066990 | |||
| 1138 | Ga0500627_0184642 | |||
| 1139 | Ga0500639_131507 | |||
| 1140 | Ga0500636_0156746 | |||
| 1141 | Ga0500637_0193736 | |||
| 1142 | 2513236227 | |||
| 1143 | 2520879976 | |||
| 1144 | 2522552024 | |||
| 1145 | 2644012631 | |||
| 1146 | 2644641905 | |||
| 1147 | 2644681989 | |||
| 1148 | 2738736801 | |||
| 1149 | 2738769341 | |||
| 1150 | 2739218383 | |||
| 1151 | 2802654938 | |||
| 1152 | 2817413662 | |||
| 1153 | 2819590460 | |||
| 1154 | 2852626371 | |||
| 1155 | 2857616596 | |||
| 1156 | 2883070233 | |||
| 1157 | 2884797112 | |||
| 1158 | 2884934823 | |||
| 1159 | 2903899311 | |||
| 1160 | 2904421744 | |||
| 1161 | 2929921430 | |||
| 1162 | 2977272179 | |||
| 1163 | 8054308711 | |||
| 1164 | 8055597324 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9453 | 1 | 144 |
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9445 | 1 | 147 |
| 3ko7-assembly2.cif.gz_D | dtd from plasmodium falciparum in complex with d-lysine | 0.9433 | 1 | 148 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.94 | 1 | 145 |
| 3knf-assembly2.cif.gz_D | crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum | 0.9377 | 1 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q07648_1_150_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9551 | 1 | 148 | 3.50.80.10 |
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9464 | 1 | 145 | 3.50.80.10 |
| af_O14274_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9455 | 1 | 148 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9445 | 1 | 147 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.94 | 1 | 145 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3ENM8-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase | 0.9867 | 1 | 78 |
GO:0005737
GO:0051500 |
| AF-A0A7Y3BWC1-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase | 0.9865 | 1 | 79 |
GO:0005737
GO:0016020 GO:0051500 |
| AF-A0A7V9DD40-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.1.96) | 0.9784 | 1 | 79 |
GO:0005737
GO:0051500 |
| AF-A0A7Y3ENM8-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase | 0.9744 | 1 | 78 |
GO:0005737
GO:0051500 |
| AF-A0A2S7TKI1-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9716 | 1 | 150 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |