F466138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 291 | 582 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_101686299|Ga0070661_1016862991 |
| Length | 115 |
| Sequence | VARGGGPGGFDVNALMKQAQQMQADMLEAQEKLKDEVVEASAGGGMVKVKMGGDLTLREIVIDPEAVDPEEAEMLAEMVQAAVNEGLRAAQELAAARMGGLTGGMDLGGLGLPGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 175 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 288 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 10.14 |
| Rhizosphere | 85.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008002 | 3300001979 | Bacteria | 4251 |
| 2 | JGI24748J21848_1001674 | 3300002074 | Bacteria | 2470 |
| 3 | JGI24034J26672_10000495 | 3300002239 | Bacteria | 5101 |
| 4 | JGI24742J22300_10010085 | 3300002244 | Bacteria | 1561 |
| 5 | JGI25407J50210_10056006 | 3300003373 | Bacteria | 994 |
| 6 | JGI25407J50210_10103213 | 3300003373 | Bacteria | 704 |
| 7 | Ga0070658_10051144 | 3300005327 | Bacteria | 3349 |
| 8 | Ga0070683_100004015 | 3300005329 | Bacteria | 12046 |
| 9 | Ga0070670_100191170 | 3300005331 | Bacteria | 1778 |
| 10 | Ga0070677_10000013 | 3300005333 | Bacteria | 53677 |
| 11 | Ga0070680_100115046 | 3300005336 | Bacteria | 2241 |
| 12 | Ga0070682_100001328 | 3300005337 | Bacteria | 13995 |
| 13 | Ga0068868_100000467 | 3300005338 | Bacteria | 26933 |
| 14 | Ga0068868_100005792 | 3300005338 | Bacteria | 8707 |
| 15 | Ga0070691_10000014 | 3300005341 | Bacteria | 50487 |
| 16 | Ga0070691_10000822 | 3300005341 | Bacteria | 12463 |
| 17 | Ga0070661_101686299 | 3300005344 | Bacteria | 537 |
| 18 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 19 | Ga0070671_100098797 | 3300005355 | Bacteria | 2448 |
| 20 | Ga0070674_100000103 | 3300005356 | Bacteria | 39432 |
| 21 | Ga0070674_100185884 | 3300005356 | Bacteria | 1595 |
| 22 | Ga0070673_100004180 | 3300005364 | Bacteria | 9107 |
| 23 | Ga0070659_102068170 | 3300005366 | Bacteria | 512 |
| 24 | Ga0070667_100395819 | 3300005367 | Bacteria | 1257 |
| 25 | Ga0070703_10055819 | 3300005406 | Bacteria | 1277 |
| 26 | Ga0070714_100100082 | 3300005435 | Bacteria | 2552 |
| 27 | Ga0070714_100151292 | 3300005435 | Bacteria | 2091 |
| 28 | Ga0070714_100537636 | 3300005435 | Bacteria | 1118 |
| 29 | Ga0070713_100000143 | 3300005436 | Bacteria | 47475 |
| 30 | Ga0070713_100062738 | 3300005436 | Bacteria | 3113 |
| 31 | Ga0070713_100127885 | 3300005436 | Bacteria | 2237 |
| 32 | Ga0070713_100156215 | 3300005436 | Bacteria | 2033 |
| 33 | Ga0070710_10183800 | 3300005437 | Bacteria | 1310 |
| 34 | Ga0070710_10344530 | 3300005437 | Bacteria | 985 |
| 35 | Ga0070710_11288732 | 3300005437 | Bacteria | 543 |
| 36 | Ga0070701_10338851 | 3300005438 | Bacteria | 936 |
| 37 | Ga0070711_100005366 | 3300005439 | Bacteria | 7665 |
| 38 | Ga0070711_100111202 | 3300005439 | Bacteria | 2011 |
| 39 | Ga0070705_100390979 | 3300005440 | Bacteria | 1027 |
| 40 | Ga0070705_101201612 | 3300005440 | Bacteria | 625 |
| 41 | Ga0070705_101266438 | 3300005440 | Bacteria | 610 |
| 42 | Ga0070700_100024753 | 3300005441 | Bacteria | 3529 |
| 43 | Ga0070700_100557734 | 3300005441 | Bacteria | 891 |
| 44 | Ga0070694_100815211 | 3300005444 | Bacteria | 766 |
| 45 | Ga0070708_101703830 | 3300005445 | Bacteria | 586 |
| 46 | Ga0070678_100007193 | 3300005456 | Bacteria | 6586 |
| 47 | Ga0070678_100120545 | 3300005456 | Bacteria | 2068 |
| 48 | Ga0070678_100714791 | 3300005456 | Bacteria | 904 |
| 49 | Ga0070662_100000015 | 3300005457 | Bacteria | 109379 |
| 50 | Ga0070662_101165251 | 3300005457 | Bacteria | 662 |
| 51 | Ga0070681_10372816 | 3300005458 | Bacteria | 1338 |
| 52 | Ga0070685_10000037 | 3300005466 | Bacteria | 80557 |
| 53 | Ga0070699_100329033 | 3300005518 | Bacteria | 1374 |
| 54 | Ga0070679_100000069 | 3300005530 | Bacteria | 76557 |
| 55 | Ga0070684_100003643 | 3300005535 | Bacteria | 11612 |
| 56 | Ga0070684_100423061 | 3300005535 | Unclassified | 1230 |
| 57 | Ga0070684_100868178 | 3300005535 | Bacteria | 845 |
| 58 | Ga0068853_100001637 | 3300005539 | Bacteria | 16375 |
| 59 | Ga0068853_100609239 | 3300005539 | Unclassified | 1037 |
| 60 | Ga0070672_100000175 | 3300005543 | Bacteria | 35613 |
| 61 | Ga0070695_100182208 | 3300005545 | Bacteria | 1489 |
| 62 | Ga0070695_100808184 | 3300005545 | Bacteria | 752 |
| 63 | Ga0070696_101062770 | 3300005546 | Bacteria | 679 |
| 64 | Ga0070693_100069509 | 3300005547 | Bacteria | 2070 |
| 65 | Ga0070665_100000068 | 3300005548 | Bacteria | 204531 |
| 66 | Ga0070704_100166641 | 3300005549 | Bacteria | 1748 |
| 67 | Ga0070704_100290823 | 3300005549 | Bacteria | 1357 |
| 68 | Ga0070704_100888652 | 3300005549 | Unclassified | 801 |
| 69 | Ga0068855_100122747 | 3300005563 | Bacteria | 2972 |
| 70 | Ga0070664_100033581 | 3300005564 | Bacteria | 4299 |
| 71 | Ga0070664_100084303 | 3300005564 | Bacteria | 2743 |
| 72 | Ga0068854_100000472 | 3300005578 | Bacteria | 24819 |
| 73 | Ga0068854_100006598 | 3300005578 | Bacteria | 7391 |
| 74 | Ga0068856_100000210 | 3300005614 | Bacteria | 63036 |
| 75 | Ga0068856_100198127 | 3300005614 | Bacteria | 2023 |
| 76 | Ga0068852_100000005 | 3300005616 | Bacteria | 173127 |
| 77 | Ga0068866_10000014 | 3300005718 | Bacteria | 72482 |
| 78 | Ga0068866_10356661 | 3300005718 | Bacteria | 931 |
| 79 | Ga0068861_100306856 | 3300005719 | Bacteria | 1377 |
| 80 | Ga0068851_10008803 | 3300005834 | Bacteria | 4677 |
| 81 | Ga0068851_10107455 | 3300005834 | Bacteria | 1486 |
| 82 | Ga0068863_100000136 | 3300005841 | Bacteria | 78102 |
| 83 | Ga0068863_101612749 | 3300005841 | Bacteria | 658 |
| 84 | Ga0068858_100001203 | 3300005842 | Bacteria | 26823 |
| 85 | Ga0068862_100465821 | 3300005844 | Bacteria | 1194 |
| 86 | Ga0068862_100783918 | 3300005844 | Bacteria | 930 |
| 87 | Ga0068862_100995203 | 3300005844 | Bacteria | 829 |
| 88 | Ga0081455_10635492 | 3300005937 | Bacteria | 690 |
| 89 | Ga0081538_10000117 | 3300005981 | Bacteria | 79475 |
| 90 | Ga0081538_10001766 | 3300005981 | Bacteria | 21872 |
| 91 | Ga0081538_10018805 | 3300005981 | Bacteria | 5167 |
| 92 | Ga0081540_1000296 | 3300005983 | Bacteria | 51895 |
| 93 | Ga0081540_1116131 | 3300005983 | Bacteria | 1120 |
| 94 | Ga0070717_10593545 | 3300006028 | Bacteria | 1004 |
| 95 | Ga0075365_10985650 | 3300006038 | Bacteria | 594 |
| 96 | Ga0075363_100245526 | 3300006048 | Bacteria | 1030 |
| 97 | Ga0075363_100454380 | 3300006048 | Bacteria | 757 |
| 98 | Ga0070715_10000011 | 3300006163 | Bacteria | 183857 |
| 99 | Ga0070715_10026203 | 3300006163 | Bacteria | 2317 |
| 100 | Ga0070712_100071610 | 3300006175 | Bacteria | 2481 |
| 101 | Ga0070712_100195741 | 3300006175 | Bacteria | 1585 |
| 102 | Ga0075367_10371701 | 3300006178 | Bacteria | 903 |
| 103 | Ga0075431_100314659 | 3300006847 | Bacteria | 1580 |
| 104 | Ga0075433_10000968 | 3300006852 | Bacteria | 20370 |
| 105 | Ga0075434_100018827 | 3300006871 | Bacteria | 6673 |
| 106 | Ga0075434_100050514 | 3300006871 | Bacteria | 4131 |
| 107 | Ga0075434_100623852 | 3300006871 | Bacteria | 1097 |
| 108 | Ga0075429_101025444 | 3300006880 | Bacteria | 721 |
| 109 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 110 | Ga0075436_100860605 | 3300006914 | Bacteria | 677 |
| 111 | Ga0075435_100369786 | 3300007076 | Bacteria | 1231 |
| 112 | Ga0105240_11502154 | 3300009093 | Bacteria | 706 |
| 113 | Ga0111539_11020942 | 3300009094 | Bacteria | 961 |
| 114 | Ga0111539_12529594 | 3300009094 | Bacteria | 595 |
| 115 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 116 | Ga0105245_10000667 | 3300009098 | Bacteria | 31104 |
| 117 | Ga0105245_10001759 | 3300009098 | Bacteria | 19752 |
| 118 | Ga0105245_10030985 | 3300009098 | Bacteria | 4731 |
| 119 | Ga0105245_10573452 | 3300009098 | Bacteria | 1152 |
| 120 | Ga0105245_11221967 | 3300009098 | Bacteria | 800 |
| 121 | Ga0105247_10000204 | 3300009101 | Bacteria | 58153 |
| 122 | Ga0105247_11519502 | 3300009101 | Bacteria | 547 |
| 123 | Ga0114129_10327426 | 3300009147 | Bacteria | 2035 |
| 124 | Ga0114129_10853789 | 3300009147 | Bacteria | 1157 |
| 125 | Ga0114129_12164329 | 3300009147 | Bacteria | 670 |
| 126 | Ga0114129_13087777 | 3300009147 | Bacteria | 545 |
| 127 | Ga0105243_10016685 | 3300009148 | Bacteria | 5552 |
| 128 | Ga0105243_10268359 | 3300009148 | Bacteria | 1531 |
| 129 | Ga0105243_10816183 | 3300009148 | Bacteria | 921 |
| 130 | Ga0105243_10865630 | 3300009148 | Bacteria | 896 |
| 131 | Ga0105242_10002841 | 3300009176 | Bacteria | 13567 |
| 132 | Ga0105242_10156325 | 3300009176 | Bacteria | 1992 |
| 133 | Ga0105242_10283626 | 3300009176 | Bacteria | 1505 |
| 134 | Ga0105242_10412992 | 3300009176 | Bacteria | 1263 |
| 135 | Ga0105242_10772199 | 3300009176 | Bacteria | 948 |
| 136 | Ga0105242_10996001 | 3300009176 | Bacteria | 845 |
| 137 | Ga0105242_11546418 | 3300009176 | Bacteria | 695 |
| 138 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 139 | Ga0105237_11558407 | 3300009545 | Bacteria | 668 |
| 140 | Ga0105238_10000172 | 3300009551 | Bacteria | 70799 |
| 141 | Ga0105238_10509577 | 3300009551 | Bacteria | 1205 |
| 142 | Ga0105249_10000235 | 3300009553 | Bacteria | 62630 |
| 143 | Ga0105249_10213855 | 3300009553 | Bacteria | 1893 |
| 144 | Ga0105249_10658074 | 3300009553 | Bacteria | 1105 |
| 145 | Ga0105239_10190013 | 3300010375 | Bacteria | 2299 |
| 146 | Ga0105239_10308314 | 3300010375 | Bacteria | 1784 |
| 147 | Ga0105239_12273443 | 3300010375 | Unclassified | 631 |
| 148 | Ga0105246_10599369 | 3300011119 | Bacteria | 952 |
| 149 | Ga0157335_1033844 | 3300012492 | Bacteria | 548 |
| 150 | Ga0157370_10447022 | 3300013104 | Bacteria | 1188 |
| 151 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 152 | Ga0157374_10006572 | 3300013296 | Bacteria | 9872 |
| 153 | Ga0157374_10412766 | 3300013296 | Bacteria | 1348 |
| 154 | Ga0157374_10815831 | 3300013296 | Bacteria | 949 |
| 155 | Ga0157378_10039519 | 3300013297 | Bacteria | 4185 |
| 156 | Ga0157378_10403833 | 3300013297 | Bacteria | 1347 |
| 157 | Ga0163162_12915588 | 3300013306 | Bacteria | 550 |
| 158 | Ga0157372_11005891 | 3300013307 | Bacteria | 965 |
| 159 | Ga0157372_11092036 | 3300013307 | Bacteria | 923 |
| 160 | Ga0157375_10028002 | 3300013308 | Bacteria | 5275 |
| 161 | Ga0157375_10225641 | 3300013308 | Bacteria | 2032 |
| 162 | Ga0157375_10470767 | 3300013308 | Unclassified | 1422 |
| 163 | Ga0163163_10140552 | 3300014325 | Bacteria | 2457 |
| 164 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 165 | Ga0157380_10000550 | 3300014326 | Bacteria | 23107 |
| 166 | Ga0157379_10011591 | 3300014968 | Bacteria | 7698 |
| 167 | Ga0157379_10368454 | 3300014968 | Bacteria | 1317 |
| 168 | Ga0157376_11778251 | 3300014969 | Bacteria | 652 |
| 169 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 170 | Ga0163161_10201205 | 3300017792 | Bacteria | 1535 |
| 171 | Ga0163161_10370902 | 3300017792 | Bacteria | 1142 |
| 172 | Ga0206351_10054906 | 3300020077 | Bacteria | 652 |
| 173 | Ga0206351_10998395 | 3300020077 | Bacteria | 854 |
| 174 | Ga0206354_10737789 | 3300020081 | Bacteria | 2004 |
| 175 | Ga0206353_11079496 | 3300020082 | Unclassified | 1218 |
| 176 | Ga0213876_10024920 | 3300021384 | Bacteria | 3159 |
| 177 | Ga0224712_10101873 | 3300022467 | Unclassified | 1219 |
| 178 | Ga0207656_10000105 | 3300025321 | Bacteria | 31356 |
| 179 | Ga0207656_10024930 | 3300025321 | Bacteria | 2424 |
| 180 | Ga0207653_10038166 | 3300025885 | Bacteria | 1569 |
| 181 | Ga0207682_10000038 | 3300025893 | Bacteria | 53885 |
| 182 | Ga0207692_10217280 | 3300025898 | Bacteria | 1131 |
| 183 | Ga0207692_10421453 | 3300025898 | Bacteria | 836 |
| 184 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 185 | Ga0207642_10361158 | 3300025899 | Bacteria | 859 |
| 186 | Ga0207710_10000779 | 3300025900 | Bacteria | 17364 |
| 187 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 188 | Ga0207685_10017389 | 3300025905 | Bacteria | 2323 |
| 189 | Ga0207643_10644403 | 3300025908 | Unclassified | 683 |
| 190 | Ga0207705_10041343 | 3300025909 | Bacteria | 3308 |
| 191 | Ga0207707_10051034 | 3300025912 | Bacteria | 3602 |
| 192 | Ga0207695_11220675 | 3300025913 | Bacteria | 632 |
| 193 | Ga0207693_10012806 | 3300025915 | Bacteria | 6766 |
| 194 | Ga0207693_10081364 | 3300025915 | Bacteria | 2535 |
| 195 | Ga0207693_10323798 | 3300025915 | Bacteria | 1207 |
| 196 | Ga0207693_10674134 | 3300025915 | Bacteria | 802 |
| 197 | Ga0207663_10000854 | 3300025916 | Bacteria | 13844 |
| 198 | Ga0207663_10061520 | 3300025916 | Bacteria | 2383 |
| 199 | Ga0207663_10078734 | 3300025916 | Bacteria | 2150 |
| 200 | Ga0207663_10080907 | 3300025916 | Bacteria | 2126 |
| 201 | Ga0207663_10150273 | 3300025916 | Bacteria | 1633 |
| 202 | Ga0207660_10097128 | 3300025917 | Bacteria | 2194 |
| 203 | Ga0207652_10000142 | 3300025921 | Bacteria | 76696 |
| 204 | Ga0207681_10116366 | 3300025923 | Bacteria | 1953 |
| 205 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 206 | Ga0207650_10082055 | 3300025925 | Bacteria | 2447 |
| 207 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 208 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 209 | Ga0207687_10000037 | 3300025927 | Bacteria | 120493 |
| 210 | Ga0207687_10000133 | 3300025927 | Bacteria | 49874 |
| 211 | Ga0207687_10021630 | 3300025927 | Bacteria | 4275 |
| 212 | Ga0207687_10309073 | 3300025927 | Bacteria | 1276 |
| 213 | Ga0207687_11024762 | 3300025927 | Bacteria | 708 |
| 214 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 215 | Ga0207700_11657082 | 3300025928 | Bacteria | 565 |
| 216 | Ga0207700_11807639 | 3300025928 | Bacteria | 537 |
| 217 | Ga0207664_10078184 | 3300025929 | Bacteria | 2683 |
| 218 | Ga0207664_10082112 | 3300025929 | Bacteria | 2624 |
| 219 | Ga0207664_11078611 | 3300025929 | Unclassified | 718 |
| 220 | Ga0207664_11995040 | 3300025929 | Bacteria | 503 |
| 221 | Ga0207690_10440488 | 3300025932 | Bacteria | 1045 |
| 222 | Ga0207706_10000062 | 3300025933 | Bacteria | 109344 |
| 223 | Ga0207686_10003650 | 3300025934 | Bacteria | 8248 |
| 224 | Ga0207686_10047518 | 3300025934 | Bacteria | 2654 |
| 225 | Ga0207686_10349399 | 3300025934 | Bacteria | 1113 |
| 226 | Ga0207686_10427879 | 3300025934 | Bacteria | 1014 |
| 227 | Ga0207709_10011143 | 3300025935 | Bacteria | 4958 |
| 228 | Ga0207709_10258576 | 3300025935 | Bacteria | 1275 |
| 229 | Ga0207709_10619629 | 3300025935 | Bacteria | 858 |
| 230 | Ga0207669_10000115 | 3300025937 | Bacteria | 40041 |
| 231 | Ga0207669_11049011 | 3300025937 | Bacteria | 686 |
| 232 | Ga0207669_11842249 | 3300025937 | Bacteria | 517 |
| 233 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 234 | Ga0207704_10315989 | 3300025938 | Bacteria | 1203 |
| 235 | Ga0207665_10374127 | 3300025939 | Bacteria | 1080 |
| 236 | Ga0207665_10396645 | 3300025939 | Bacteria | 1050 |
| 237 | Ga0207691_10000609 | 3300025940 | Bacteria | 35618 |
| 238 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 239 | Ga0207661_10001063 | 3300025944 | Bacteria | 18265 |
| 240 | Ga0207661_10811227 | 3300025944 | Bacteria | 861 |
| 241 | Ga0207679_10025338 | 3300025945 | Bacteria | 4077 |
| 242 | Ga0207679_10246740 | 3300025945 | Bacteria | 1516 |
| 243 | Ga0207667_11041123 | 3300025949 | Bacteria | 804 |
| 244 | Ga0207651_10001295 | 3300025960 | Bacteria | 11260 |
| 245 | Ga0207651_11226127 | 3300025960 | Bacteria | 674 |
| 246 | Ga0207712_10000037 | 3300025961 | Bacteria | 195906 |
| 247 | Ga0207712_10214096 | 3300025961 | Bacteria | 1536 |
| 248 | Ga0207712_10596440 | 3300025961 | Bacteria | 955 |
| 249 | Ga0207668_10040497 | 3300025972 | Bacteria | 3144 |
| 250 | Ga0207668_10906109 | 3300025972 | Bacteria | 785 |
| 251 | Ga0207640_10000125 | 3300025981 | Bacteria | 58750 |
| 252 | Ga0207640_10052356 | 3300025981 | Bacteria | 2659 |
| 253 | Ga0207658_10151095 | 3300025986 | Bacteria | 1892 |
| 254 | Ga0207677_10000464 | 3300026023 | Bacteria | 27017 |
| 255 | Ga0207677_10012618 | 3300026023 | Bacteria | 4866 |
| 256 | Ga0207703_10000128 | 3300026035 | Bacteria | 91359 |
| 257 | Ga0207703_10000237 | 3300026035 | Bacteria | 62874 |
| 258 | Ga0207639_10003793 | 3300026041 | Bacteria | 10171 |
| 259 | Ga0207708_10013078 | 3300026075 | Bacteria | 6194 |
| 260 | Ga0207708_10551197 | 3300026075 | Bacteria | 972 |
| 261 | Ga0207702_10001764 | 3300026078 | Bacteria | 21273 |
| 262 | Ga0207702_10025507 | 3300026078 | Bacteria | 4906 |
| 263 | Ga0207702_10053419 | 3300026078 | Bacteria | 3420 |
| 264 | Ga0207702_10737985 | 3300026078 | Bacteria | 972 |
| 265 | Ga0207702_11427537 | 3300026078 | Bacteria | 686 |
| 266 | Ga0207641_10000265 | 3300026088 | Bacteria | 66346 |
| 267 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 268 | Ga0207675_100481936 | 3300026118 | Bacteria | 1233 |
| 269 | Ga0207675_101817799 | 3300026118 | Bacteria | 628 |
| 270 | Ga0207683_10027288 | 3300026121 | Bacteria | 4934 |
| 271 | Ga0207683_10118949 | 3300026121 | Bacteria | 2370 |
| 272 | Ga0207698_10000038 | 3300026142 | Bacteria | 101918 |
| 273 | Ga0207428_10053357 | 3300027907 | Bacteria | 3224 |
| 274 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 275 | Ga0268266_11006555 | 3300028379 | Bacteria | 806 |
| 276 | Ga0268265_10746971 | 3300028380 | Bacteria | 949 |
| 277 | Ga0268265_11367494 | 3300028380 | Bacteria | 709 |
| 278 | Ga0268264_10013507 | 3300028381 | Bacteria | 6725 |
| 279 | Ga0268264_11827001 | 3300028381 | Bacteria | 618 |
| 280 | Ga0307511_10082567 | 3300030521 | Bacteria | 2246 |
| 281 | Ga0265327_10157893 | 3300031251 | Bacteria | 1050 |
| 282 | Ga0307410_11005653 | 3300031852 | Bacteria | 719 |
| 283 | Ga0307406_10021145 | 3300031901 | Bacteria | 3845 |
| 284 | Ga0307409_100190126 | 3300031995 | Bacteria | 1827 |
| 285 | Ga0307409_102834841 | 3300031995 | Bacteria | 512 |
| 286 | Ga0307416_100468343 | 3300032002 | Bacteria | 1317 |
| 287 | Ga0307415_100273051 | 3300032126 | Bacteria | 1386 |
| 288 | Ga0307415_101001235 | 3300032126 | Bacteria | 777 |
| 289 | Ga0373949_0107428 | 3300035090 | Bacteria | 771 |
| 290 | Ga0373957_0155927 | 3300035120 | Bacteria | 939 |
| 291 | Ga0373935_0426195 | 3300035692 | Bacteria | 956 |
| 292 | Ga0373933_0294494 | 3300035724 | Bacteria | 1050 |
| 293 | Ga0373933_0638816 | 3300035724 | Bacteria | 699 |
| 294 | Ga0373933_1011580 | 3300035724 | Bacteria | 547 |
| 295 | Ga0373937_0342658 | 3300036401 | Bacteria | 1415 |
| 296 | Ga0373937_0515277 | 3300036401 | Bacteria | 1136 |
| 297 | Ga0373937_0724274 | 3300036401 | Bacteria | 942 |
| 298 | Ga0373937_1970998 | 3300036401 | Bacteria | 530 |
| 299 | Ga0395900_0951222 | 3300037418 | Unclassified | 780 |
| 300 | Ga0395898_0018653 | 3300037466 | Bacteria | 7072 |
| 301 | Ga0395898_0918307 | 3300037466 | Bacteria | 813 |
| 302 | Ga0395905_0036867 | 3300037471 | Bacteria | 4592 |
| 303 | Ga0436364_0072171 | 3300037853 | Bacteria | 1468 |
| 304 | Ga0436364_0139100 | 3300037853 | Bacteria | 1395 |
| 305 | Ga0436364_0167671 | 3300037853 | Bacteria | 7029 |
| 306 | Ga0395901_0205495 | 3300038443 | Bacteria | 2063 |
| 307 | Ga0436365_0105231 | 3300039437 | Bacteria | 1490 |
| 308 | Ga0436365_0332771 | 3300039437 | Bacteria | 1862 |
| 309 | Ga0436365_0342589 | 3300039437 | Bacteria | 1955 |
| 310 | Ga0436365_0924437 | 3300039437 | Bacteria | 1280 |
| 311 | Ga0436365_0969934 | 3300039437 | Bacteria | 6774 |
| 312 | Ga0436365_1481750 | 3300039437 | Bacteria | 1227 |
| 313 | Ga0436365_1607371 | 3300039437 | Bacteria | 2478 |
| 314 | Ga0436365_1934953 | 3300039437 | Bacteria | 742 |
| 315 | Ga0436363_1638120 | 3300039450 | Bacteria | 1010 |
| 316 | Ga0436362_0120799 | 3300039453 | Bacteria | 885 |
| 317 | Ga0436362_0337191 | 3300039453 | Bacteria | 874 |
| 318 | Ga0436362_0451879 | 3300039453 | Bacteria | 776 |
| 319 | Ga0451791_1132480 | 3300041451 | Bacteria | 670 |
| 320 | Ga0466966_0046490 | 3300044684 | Bacteria | 2771 |
| 321 | Ga0466961_0141061 | 3300044693 | Bacteria | 1509 |
| 322 | Ga0466963_0000585 | 3300044694 | Bacteria | 17350 |
| 323 | Ga0466963_1011281 | 3300044694 | Bacteria | 585 |
| 324 | Ga0466957_0493651 | 3300044842 | Bacteria | 848 |
| 325 | Ga0466959_0084849 | 3300045049 | Bacteria | 2280 |
| 326 | Ga0466959_0323584 | 3300045049 | Bacteria | 1054 |
| 327 | Ga0466958_0036126 | 3300045836 | Bacteria | 2956 |
| 328 | Ga0466958_0380464 | 3300045836 | Bacteria | 910 |
| 329 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 330 | Ga0466967_0566402 | 3300045976 | Bacteria | 1119 |
| 331 | Ga0466967_0579352 | 3300045976 | Bacteria | 1106 |
| 332 | Ga0466967_0803306 | 3300045976 | Bacteria | 934 |
| 333 | Ga0466967_2009051 | 3300045976 | Unclassified | 575 |
| 334 | Ga0495592_0000600 | 3300046454 | Bacteria | 25385 |
| 335 | Ga0495592_0623949 | 3300046454 | Unclassified | 655 |
| 336 | Ga0495592_0626723 | 3300046454 | Bacteria | 653 |
| 337 | Ga0495603_0001152 | 3300046455 | Bacteria | 15404 |
| 338 | Ga0495603_0007750 | 3300046455 | Bacteria | 6471 |
| 339 | Ga0495629_0000055 | 3300046459 | Bacteria | 105268 |
| 340 | Ga0495629_0096664 | 3300046459 | Bacteria | 2060 |
| 341 | Ga0495638_0008356 | 3300046460 | Bacteria | 7342 |
| 342 | Ga0495641_0000020 | 3300046461 | Bacteria | 115404 |
| 343 | Ga0495641_0110749 | 3300046461 | Bacteria | 1225 |
| 344 | Ga0495641_0142995 | 3300046461 | Bacteria | 1069 |
| 345 | Ga0495641_0147257 | 3300046461 | Bacteria | 1052 |
| 346 | Ga0495641_0161307 | 3300046461 | Bacteria | 1003 |
| 347 | Ga0495651_0094152 | 3300046462 | Bacteria | 2242 |
| 348 | Ga0495653_0147655 | 3300046463 | Bacteria | 1646 |
| 349 | Ga0495653_0190870 | 3300046463 | Bacteria | 1398 |
| 350 | Ga0495653_0237721 | 3300046463 | Bacteria | 1216 |
| 351 | Ga0495653_0240166 | 3300046463 | Bacteria | 1208 |
| 352 | Ga0495653_0279029 | 3300046463 | Bacteria | 1097 |
| 353 | Ga0495653_0326368 | 3300046463 | Bacteria | 993 |
| 354 | Ga0495582_0000013 | 3300046473 | Bacteria | 110372 |
| 355 | Ga0495582_0199127 | 3300046473 | Bacteria | 1144 |
| 356 | Ga0495639_0647172 | 3300046475 | Bacteria | 545 |
| 357 | Ga0495662_0000021 | 3300046476 | Bacteria | 54969 |
| 358 | Ga0495594_0100615 | 3300046499 | Bacteria | 1626 |
| 359 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 360 | Ga0495608_0003895 | 3300046511 | Bacteria | 10729 |
| 361 | Ga0495608_0199396 | 3300046511 | Bacteria | 1261 |
| 362 | Ga0495608_0232570 | 3300046511 | Bacteria | 1153 |
| 363 | Ga0495608_0272156 | 3300046511 | Bacteria | 1053 |
| 364 | Ga0495618_0000058 | 3300046514 | Bacteria | 79638 |
| 365 | Ga0495618_0368346 | 3300046514 | Bacteria | 883 |
| 366 | Ga0495620_0002330 | 3300046515 | Bacteria | 11010 |
| 367 | Ga0495620_0357101 | 3300046515 | Bacteria | 554 |
| 368 | Ga0495628_0004164 | 3300046516 | Bacteria | 12871 |
| 369 | Ga0495628_0318871 | 3300046516 | Unclassified | 1147 |
| 370 | Ga0495628_0441424 | 3300046516 | Bacteria | 946 |
| 371 | Ga0495628_0711775 | 3300046516 | Unclassified | 708 |
| 372 | Ga0495630_0001432 | 3300046517 | Bacteria | 16529 |
| 373 | Ga0495630_0002139 | 3300046517 | Bacteria | 13744 |
| 374 | Ga0495630_0039472 | 3300046517 | Bacteria | 3529 |
| 375 | Ga0495630_0319808 | 3300046517 | Bacteria | 1186 |
| 376 | Ga0495637_0188004 | 3300046520 | Bacteria | 763 |
| 377 | Ga0495644_0000693 | 3300046523 | Bacteria | 13956 |
| 378 | Ga0495644_0052692 | 3300046523 | Bacteria | 1528 |
| 379 | Ga0495652_0017506 | 3300046529 | Bacteria | 6394 |
| 380 | Ga0495652_0052526 | 3300046529 | Bacteria | 3476 |
| 381 | Ga0495665_0531549 | 3300046531 | Bacteria | 591 |
| 382 | Ga0495640_0054649 | 3300046533 | Bacteria | 2734 |
| 383 | Ga0495640_0231582 | 3300046533 | Bacteria | 1162 |
| 384 | Ga0495586_0004843 | 3300046535 | Bacteria | 7199 |
| 385 | Ga0495586_0837277 | 3300046535 | Bacteria | 530 |
| 386 | Ga0495587_0025864 | 3300046536 | Bacteria | 3583 |
| 387 | Ga0495587_0070521 | 3300046536 | Bacteria | 2034 |
| 388 | Ga0495598_0030761 | 3300046537 | Bacteria | 1506 |
| 389 | Ga0495621_0002316 | 3300046539 | Bacteria | 5108 |
| 390 | Ga0495621_0180503 | 3300046539 | Bacteria | 842 |
| 391 | Ga0495645_0078054 | 3300046543 | Bacteria | 2380 |
| 392 | Ga0495667_0267512 | 3300046559 | Bacteria | 1086 |
| 393 | Ga0495634_0000601 | 3300046642 | Bacteria | 34818 |
| 394 | Ga0495634_0050593 | 3300046642 | Bacteria | 2789 |
| 395 | Ga0495634_0142741 | 3300046642 | Bacteria | 1519 |
| 396 | Ga0495634_0184236 | 3300046642 | Bacteria | 1306 |
| 397 | Ga0495634_0199482 | 3300046642 | Bacteria | 1243 |
| 398 | Ga0495634_0352161 | 3300046642 | Bacteria | 881 |
| 399 | Ga0495635_0000026 | 3300046663 | Bacteria | 142517 |
| 400 | Ga0495635_0155880 | 3300046663 | Bacteria | 1554 |
| 401 | Ga0495635_0246643 | 3300046663 | Bacteria | 1204 |
| 402 | Ga0495588_0097004 | 3300046674 | Bacteria | 1547 |
| 403 | Ga0495657_0024223 | 3300046675 | Bacteria | 4326 |
| 404 | Ga0495657_0043883 | 3300046675 | Bacteria | 3045 |
| 405 | Ga0495657_0102165 | 3300046675 | Bacteria | 1825 |
| 406 | Ga0495599_0014958 | 3300046678 | Bacteria | 4809 |
| 407 | Ga0495623_0499592 | 3300046679 | Bacteria | 642 |
| 408 | Ga0495646_0443048 | 3300046680 | Bacteria | 671 |
| 409 | Ga0495646_0524932 | 3300046680 | Bacteria | 606 |
| 410 | Ga0495647_0000027 | 3300046681 | Bacteria | 58315 |
| 411 | Ga0495647_0030918 | 3300046681 | Bacteria | 1989 |
| 412 | Ga0495647_0032972 | 3300046681 | Bacteria | 1934 |
| 413 | Ga0495647_0224784 | 3300046681 | Bacteria | 829 |
| 414 | Ga0495658_0000009 | 3300046683 | Bacteria | 110421 |
| 415 | Ga0495658_0092210 | 3300046683 | Bacteria | 1795 |
| 416 | Ga0495658_0235027 | 3300046683 | Bacteria | 1150 |
| 417 | Ga0495669_0000083 | 3300046684 | Bacteria | 62876 |
| 418 | Ga0495669_0000823 | 3300046684 | Bacteria | 13221 |
| 419 | Ga0495613_0000364 | 3300046689 | Bacteria | 39475 |
| 420 | Ga0495613_0099944 | 3300046689 | Bacteria | 2096 |
| 421 | Ga0495613_0497443 | 3300046689 | Bacteria | 821 |
| 422 | Ga0495624_0000012 | 3300046690 | Bacteria | 124128 |
| 423 | Ga0495624_0430041 | 3300046690 | Bacteria | 791 |
| 424 | Ga0495624_0701847 | 3300046690 | Bacteria | 601 |
| 425 | Ga0495670_0162571 | 3300046691 | Unclassified | 1173 |
| 426 | Ga0495649_0000587 | 3300046694 | Bacteria | 30555 |
| 427 | Ga0495600_0023432 | 3300046809 | Bacteria | 3972 |
| 428 | Ga0495600_0832962 | 3300046809 | Bacteria | 548 |
| 429 | Ga0495581_0392992 | 3300047315 | Bacteria | 809 |
| 430 | Ga0495604_0000413 | 3300047317 | Bacteria | 38567 |
| 431 | Ga0495604_0141086 | 3300047317 | Bacteria | 1721 |
| 432 | Ga0495604_0550801 | 3300047317 | Bacteria | 744 |
| 433 | Ga0495674_0687050 | 3300047319 | Unclassified | 804 |
| 434 | Ga0495674_0823518 | 3300047319 | Unclassified | 721 |
| 435 | Ga0495672_0100485 | 3300047320 | Bacteria | 1570 |
| 436 | Ga0495672_0125181 | 3300047320 | Unclassified | 1360 |
| 437 | Ga0495676_0001347 | 3300047321 | Bacteria | 21095 |
| 438 | Ga0495676_0356953 | 3300047321 | Bacteria | 976 |
| 439 | Ga0495680_0000407 | 3300047322 | Bacteria | 48143 |
| 440 | Ga0495680_0000671 | 3300047322 | Bacteria | 38307 |
| 441 | Ga0495680_0033973 | 3300047322 | Bacteria | 4126 |
| 442 | Ga0495680_0190588 | 3300047322 | Bacteria | 1475 |
| 443 | Ga0495680_0599018 | 3300047322 | Bacteria | 738 |
| 444 | Ga0495675_0082909 | 3300047444 | Bacteria | 2019 |
| 445 | Ga0495675_0231539 | 3300047444 | Bacteria | 1115 |
| 446 | Ga0495673_0120790 | 3300047469 | Bacteria | 1038 |
| 447 | Ga0495684_0289152 | 3300047471 | Bacteria | 1180 |
| 448 | Ga0495593_0067439 | 3300047673 | Bacteria | 1863 |
| 449 | Ga0495593_0083427 | 3300047673 | Bacteria | 1651 |
| 450 | Ga0495593_0141678 | 3300047673 | Bacteria | 1218 |
| 451 | Ga0495593_0170552 | 3300047673 | Bacteria | 1097 |
| 452 | Ga0495593_0374253 | 3300047673 | Bacteria | 712 |
| 453 | Ga0495602_0320781 | 3300048088 | Bacteria | 1127 |
| 454 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 455 | Ga0496100_0008714 | 3300048903 | Bacteria | 5667 |
| 456 | Ga0496100_1409212 | 3300048903 | Bacteria | 550 |
| 457 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 458 | Ga0496101_0011624 | 3300048904 | Bacteria | 5847 |
| 459 | Ga0496101_1503897 | 3300048904 | Bacteria | 524 |
| 460 | Ga0496102_0853204 | 3300048905 | Unclassified | 833 |
| 461 | Ga0496102_0963234 | 3300048905 | Bacteria | 774 |
| 462 | Ga0496102_1485839 | 3300048905 | Bacteria | 596 |
| 463 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 464 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 465 | Ga0496104_0002173 | 3300048907 | Bacteria | 17015 |
| 466 | Ga0496104_0340318 | 3300048907 | Bacteria | 1413 |
| 467 | Ga0496104_0376206 | 3300048907 | Bacteria | 1333 |
| 468 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 469 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 470 | Ga0496105_0029466 | 3300048908 | Bacteria | 4492 |
| 471 | Ga0496105_0093363 | 3300048908 | Bacteria | 2485 |
| 472 | Ga0496105_0127713 | 3300048908 | Bacteria | 2096 |
| 473 | Ga0496105_0890830 | 3300048908 | Bacteria | 671 |
| 474 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 475 | Ga0496106_0000174 | 3300048909 | Bacteria | 46312 |
| 476 | Ga0496106_0723823 | 3300048909 | Bacteria | 792 |
| 477 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 478 | Ga0496107_0200961 | 3300048910 | Bacteria | 1481 |
| 479 | Ga0496107_0366400 | 3300048910 | Bacteria | 1072 |
| 480 | Ga0496107_0930233 | 3300048910 | Bacteria | 633 |
| 481 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 482 | Ga0496108_0000080 | 3300048911 | Bacteria | 102267 |
| 483 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 484 | Ga0496109_0000024 | 3300048912 | Bacteria | 174723 |
| 485 | Ga0496109_0231309 | 3300048912 | Bacteria | 1739 |
| 486 | Ga0496109_0681031 | 3300048912 | Bacteria | 966 |
| 487 | Ga0496110_0004843 | 3300048913 | Bacteria | 10494 |
| 488 | Ga0496110_0043093 | 3300048913 | Bacteria | 3940 |
| 489 | Ga0496110_0148516 | 3300048913 | Bacteria | 2121 |
| 490 | Ga0496110_0345073 | 3300048913 | Bacteria | 1356 |
| 491 | Ga0496110_0614598 | 3300048913 | Unclassified | 985 |
| 492 | Ga0496110_0933214 | 3300048913 | Bacteria | 774 |
| 493 | Ga0496110_1017693 | 3300048913 | Bacteria | 736 |
| 494 | Ga0496111_0002803 | 3300048914 | Bacteria | 10617 |
| 495 | Ga0496111_0387065 | 3300048914 | Bacteria | 1034 |
| 496 | Ga0496111_0517110 | 3300048914 | Bacteria | 878 |
| 497 | Ga0496111_0691935 | 3300048914 | Bacteria | 742 |
| 498 | Ga0496111_0721111 | 3300048914 | Bacteria | 724 |
| 499 | Ga0496111_1170358 | 3300048914 | Bacteria | 546 |
| 500 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 501 | Ga0496112_0000857 | 3300048915 | Bacteria | 21732 |
| 502 | Ga0496112_0658969 | 3300048915 | Bacteria | 976 |
| 503 | Ga0496112_0814475 | 3300048915 | Bacteria | 858 |
| 504 | Ga0496112_1752647 | 3300048915 | Bacteria | 533 |
| 505 | Ga0496113_0129070 | 3300048916 | Bacteria | 1982 |
| 506 | Ga0496113_0321739 | 3300048916 | Bacteria | 1240 |
| 507 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 508 | Ga0496115_0000034 | 3300048918 | Bacteria | 135380 |
| 509 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 510 | Ga0496115_0326693 | 3300048918 | Bacteria | 1254 |
| 511 | Ga0496115_0857334 | 3300048918 | Unclassified | 703 |
| 512 | Ga0496119_0055607 | 3300048922 | Bacteria | 2403 |
| 513 | Ga0496120_0057798 | 3300048923 | Bacteria | 2181 |
| 514 | Ga0496123_0230959 | 3300048926 | Bacteria | 926 |
| 515 | Ga0496124_0198356 | 3300048927 | Bacteria | 1529 |
| 516 | Ga0496125_0082765 | 3300048928 | Bacteria | 2445 |
| 517 | Ga0501039_0579492 | 3300049575 | Bacteria | 880 |
| 518 | Ga0501039_1030687 | 3300049575 | Bacteria | 639 |
| 519 | Ga0501041_0174114 | 3300049577 | Bacteria | 1347 |
| 520 | Ga0501042_0033618 | 3300049578 | Bacteria | 3635 |
| 521 | Ga0501067_0507740 | 3300049583 | Bacteria | 674 |
| 522 | Ga0501069_0354333 | 3300049585 | Bacteria | 865 |
| 523 | Ga0501070_0061389 | 3300049586 | Bacteria | 3114 |
| 524 | Ga0501071_0473303 | 3300049587 | Bacteria | 960 |
| 525 | Ga0501071_0589524 | 3300049587 | Bacteria | 854 |
| 526 | Ga0501071_0655002 | 3300049587 | Bacteria | 808 |
| 527 | Ga0501072_0102580 | 3300049588 | Bacteria | 2274 |
| 528 | Ga0501072_0641590 | 3300049588 | Bacteria | 836 |
| 529 | Ga0501074_0082466 | 3300049590 | Bacteria | 2306 |
| 530 | Ga0501075_0213138 | 3300049591 | Bacteria | 1473 |
| 531 | Ga0501076_1489937 | 3300049592 | Bacteria | 556 |
| 532 | Ga0501077_0198381 | 3300049593 | Bacteria | 1275 |
| 533 | Ga0501079_0307560 | 3300049741 | Bacteria | 1240 |
| 534 | Ga0501079_1044261 | 3300049741 | Bacteria | 644 |
| 535 | Ga0501079_1230804 | 3300049741 | Unclassified | 590 |
| 536 | Ga0501081_0452393 | 3300049743 | Bacteria | 954 |
| 537 | nmdc:mga00v17_334606_c1 | 3300050491 | Bacteria | 984 |
| 538 | nmdc:mga06z11_535025_c1 | 3300050494 | Bacteria | 711 |
| 539 | nmdc:mga05p37_1891672_c1 | 3300050507 | Bacteria | 570 |
| 540 | nmdc:mga05p37_556183_c1 | 3300050507 | Bacteria | 1305 |
| 541 | nmdc:mga05p37_73843_c1 | 3300050507 | Bacteria | 2435 |
| 542 | nmdc:mga05p37_8570_c1 | 3300050507 | Bacteria | 12088 |
| 543 | nmdc:mga09592_345171_c1 | 3300050508 | Bacteria | 1289 |
| 544 | nmdc:mga0qj67_848261_c1 | 3300050509 | Bacteria | 722 |
| 545 | nmdc:mga06r32_173360_c1 | 3300050510 | Bacteria | 2141 |
| 546 | nmdc:mga06r32_49041_c1 | 3300050510 | Bacteria | 4038 |
| 547 | nmdc:mga08y16_1891251_c1 | 3300050511 | Bacteria | 548 |
| 548 | nmdc:mga08y16_64266_c1 | 3300050511 | Bacteria | 3832 |
| 549 | nmdc:mga0n895_810688_c1 | 3300050512 | Bacteria | 926 |
| 550 | nmdc:mga0rr50_384975_c1 | 3300050513 | Bacteria | 1183 |
| 551 | nmdc:mga0a205_1066_c1 | 3300050515 | Bacteria | 22781 |
| 552 | nmdc:mga0a205_339441_c1 | 3300050515 | Bacteria | 1371 |
| 553 | nmdc:mga0a205_57697_c1 | 3300050515 | Bacteria | 3748 |
| 554 | nmdc:mga0a205_58968_c1 | 3300050515 | Bacteria | 3708 |
| 555 | Ga0495601_0000196 | 3300053077 | Bacteria | 32072 |
| 556 | Ga0495601_0003093 | 3300053077 | Bacteria | 9498 |
| 557 | Ga0495601_0006808 | 3300053077 | Bacteria | 6695 |
| 558 | Ga0495601_0087988 | 3300053077 | Bacteria | 1997 |
| 559 | Ga0495601_0167900 | 3300053077 | Bacteria | 1434 |
| 560 | Ga0495601_0216189 | 3300053077 | Bacteria | 1252 |
| 561 | Ga0495612_0010132 | 3300053078 | Bacteria | 3812 |
| 562 | Ga0495612_0019089 | 3300053078 | Bacteria | 2746 |
| 563 | Ga0495612_0026255 | 3300053078 | Bacteria | 2340 |
| 564 | Ga0495612_0183550 | 3300053078 | Bacteria | 919 |
| 565 | Ga0495612_0193799 | 3300053078 | Bacteria | 895 |
| 566 | Ga0495612_0246064 | 3300053078 | Unclassified | 795 |
| 567 | Ga0495655_0000904 | 3300053083 | Bacteria | 4625 |
| 568 | Ga0495595_0000167 | 3300053084 | Bacteria | 25731 |
| 569 | Ga0495595_0118423 | 3300053084 | Bacteria | 1289 |
| 570 | Ga0495619_0000042 | 3300053085 | Bacteria | 112453 |
| 571 | Ga0495619_0000098 | 3300053085 | Bacteria | 64979 |
| 572 | Ga0495619_0000327 | 3300053085 | Bacteria | 33238 |
| 573 | Ga0495619_0010227 | 3300053085 | Bacteria | 5909 |
| 574 | Ga0495619_0013246 | 3300053085 | Bacteria | 5198 |
| 575 | Ga0495619_0123869 | 3300053085 | Bacteria | 1773 |
| 576 | Ga0500614_000095 | 3300053123 | Bacteria | 20668 |
| 577 | Ga0500636_0378333 | 3300053177 | Bacteria | 665 |
| 578 | Ga0501084_0320743 | 3300054114 | Bacteria | 1309 |
| 579 | Ga0501084_0773370 | 3300054114 | Bacteria | 809 |
| 580 | Ga0501082_0455877 | 3300060353 | Bacteria | 1117 |
| 581 | Ga0530510_0449863 | 3300061734 | Bacteria | 974 |
| 582 | Ga0530510_0738456 | 3300061734 | Bacteria | 751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100329033 | Ga0070699_1003290332 | 79 |
| 2 | 3300005545 | Ga0070695_100182208 | Ga0070695_1001822082 | 79 |
| 3 | 3300009147 | Ga0114129_13087777 | Ga0114129_130877771 | 79 |
| 4 | 3300009148 | Ga0105243_10865630 | Ga0105243_108656301 | 79 |
| 5 | 3300009176 | Ga0105242_10772199 | Ga0105242_107721992 | 79 |
| 6 | 3300025935 | Ga0207709_10619629 | Ga0207709_106196291 | 79 |
| 7 | 3300005564 | Ga0070664_100084303 | Ga0070664_1000843033 | 89 |
| 8 | 3300025945 | Ga0207679_10246740 | Ga0207679_102467402 | 89 |
| 9 | 3300035724 | Ga0373933_1011580 | Ga0373933_1011580_145_495 | 89 |
| 10 | 3300048918 | Ga0496115_0000034 | Ga0496115_0000034_107480_107830 | 89 |
| 11 | 3300025928 | Ga0207700_11807639 | Ga0207700_118076391 | 90 |
| 12 | 3300025929 | Ga0207664_11078611 | Ga0207664_110786112 | 90 |
| 13 | 3300044684 | Ga0466966_0046490 | Ga0466966_0046490_793_1101 | 90 |
| 14 | 3300044693 | Ga0466961_0141061 | Ga0466961_0141061_955_1263 | 90 |
| 15 | 3300045049 | Ga0466959_0323584 | Ga0466959_0323584_303_611 | 90 |
| 16 | 3300045836 | Ga0466958_0380464 | Ga0466958_0380464_193_501 | 90 |
| 17 | 3300005440 | Ga0070705_101266438 | Ga0070705_1012664382 | 91 |
| 18 | 3300005457 | Ga0070662_101165251 | Ga0070662_1011652512 | 91 |
| 19 | 3300005549 | Ga0070704_100166641 | Ga0070704_1001666411 | 91 |
| 20 | 3300005981 | Ga0081538_10000117 | Ga0081538_1000011778 | 91 |
| 21 | 3300009094 | Ga0111539_11020942 | Ga0111539_110209421 | 91 |
| 22 | 3300009148 | Ga0105243_10016685 | Ga0105243_100166852 | 91 |
| 23 | 3300028381 | Ga0268264_11827001 | Ga0268264_118270012 | 91 |
| 24 | 3300039437 | Ga0436365_1607371 | Ga0436365_1607371_438_758 | 91 |
| 25 | 3300048927 | Ga0496124_0198356 | Ga0496124_0198356_31_372 | 91 |
| 26 | 3300050511 | nmdc:mga08y16_1891251_c1 | nmdc:mga08y16_1891251_c1_116_451 | 91 |
| 27 | 3300003373 | JGI25407J50210_10103213 | JGI25407J50210_101032132 | 92 |
| 28 | 3300005981 | Ga0081538_10001766 | Ga0081538_100017669 | 92 |
| 29 | 3300006048 | Ga0075363_100454380 | Ga0075363_1004543802 | 92 |
| 30 | 3300006852 | Ga0075433_10000968 | Ga0075433_100009684 | 92 |
| 31 | 3300013296 | Ga0157374_10412766 | Ga0157374_104127662 | 92 |
| 32 | 3300013306 | Ga0163162_12915588 | Ga0163162_129155882 | 92 |
| 33 | 3300037853 | Ga0436364_0072171 | Ga0436364_0072171_744_1064 | 92 |
| 34 | 3300039437 | Ga0436365_0332771 | Ga0436365_0332771_500_820 | 92 |
| 35 | 3300039437 | Ga0436365_1481750 | Ga0436365_1481750_309_617 | 92 |
| 36 | 3300053078 | Ga0495612_0193799 | Ga0495612_0193799_172_483 | 92 |
| 37 | 3300060353 | Ga0501082_0455877 | Ga0501082_0455877_243_584 | 92 |
| 38 | 3300031995 | Ga0307409_100190126 | Ga0307409_1001901262 | 93 |
| 39 | 3300035090 | Ga0373949_0107428 | Ga0373949_0107428_252_575 | 93 |
| 40 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_101351_101638 | 93 |
| 41 | 3300048918 | Ga0496115_0000071 | Ga0496115_0000071_22654_22941 | 93 |
| 42 | 3300050491 | nmdc:mga00v17_334606_c1 | nmdc:mga00v17_334606_c1_645_968 | 93 |
| 43 | 3300050515 | nmdc:mga0a205_1066_c1 | nmdc:mga0a205_1066_c1_11255_11596 | 93 |
| 44 | 3300005331 | Ga0070670_100191170 | Ga0070670_1001911701 | 94 |
| 45 | 3300005406 | Ga0070703_10055819 | Ga0070703_100558192 | 94 |
| 46 | 3300009177 | Ga0105248_10000126 | Ga0105248_1000012676 | 94 |
| 47 | 3300009545 | Ga0105237_11558407 | Ga0105237_115584072 | 94 |
| 48 | 3300009551 | Ga0105238_10509577 | Ga0105238_105095772 | 94 |
| 49 | 3300013105 | Ga0157369_10000135 | Ga0157369_1000013596 | 94 |
| 50 | 3300013297 | Ga0157378_10039519 | Ga0157378_100395192 | 94 |
| 51 | 3300013308 | Ga0157375_10470767 | Ga0157375_104707672 | 94 |
| 52 | 3300014326 | Ga0157380_10000009 | Ga0157380_1000000918 | 94 |
| 53 | 3300014968 | Ga0157379_10368454 | Ga0157379_103684542 | 94 |
| 54 | 3300025885 | Ga0207653_10038166 | Ga0207653_100381662 | 94 |
| 55 | 3300045976 | Ga0466967_0000005 | Ga0466967_0000005_55895_56197 | 94 |
| 56 | 3300046459 | Ga0495629_0000055 | Ga0495629_0000055_96129_96428 | 94 |
| 57 | 3300046463 | Ga0495653_0147655 | Ga0495653_0147655_134_421 | 94 |
| 58 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_147750_148049 | 94 |
| 59 | 3300046683 | Ga0495658_0092210 | Ga0495658_0092210_988_1290 | 94 |
| 60 | 3300047320 | Ga0495672_0125181 | Ga0495672_0125181_333_632 | 94 |
| 61 | 3300047673 | Ga0495593_0083427 | Ga0495593_0083427_757_1059 | 94 |
| 62 | 3300048905 | Ga0496102_0963234 | Ga0496102_0963234_421_708 | 94 |
| 63 | 3300048911 | Ga0496108_0000080 | Ga0496108_0000080_100526_100828 | 94 |
| 64 | 3300048912 | Ga0496109_0000024 | Ga0496109_0000024_100526_100828 | 94 |
| 65 | 3300048913 | Ga0496110_0004843 | Ga0496110_0004843_9700_9999 | 94 |
| 66 | 3300048914 | Ga0496111_0002803 | Ga0496111_0002803_9647_9946 | 94 |
| 67 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_402177_402464 | 94 |
| 68 | 3300049577 | Ga0501041_0174114 | Ga0501041_0174114_678_1001 | 94 |
| 69 | 3300049586 | Ga0501070_0061389 | Ga0501070_0061389_2704_3006 | 94 |
| 70 | 3300049588 | Ga0501072_0102580 | Ga0501072_0102580_1935_2252 | 94 |
| 71 | 3300049741 | Ga0501079_0307560 | Ga0501079_0307560_900_1217 | 94 |
| 72 | 3300053078 | Ga0495612_0010132 | Ga0495612_0010132_2549_2848 | 94 |
| 73 | 3300053085 | Ga0495619_0000098 | Ga0495619_0000098_38412_38711 | 94 |
| 74 | 3300005549 | Ga0070704_100888652 | Ga0070704_1008886521 | 95 |
| 75 | 3300005718 | Ga0068866_10356661 | Ga0068866_103566612 | 95 |
| 76 | 3300006175 | Ga0070712_100071610 | Ga0070712_1000716102 | 95 |
| 77 | 3300006871 | Ga0075434_100623852 | Ga0075434_1006238522 | 95 |
| 78 | 3300009094 | Ga0111539_12529594 | Ga0111539_125295942 | 95 |
| 79 | 3300009098 | Ga0105245_10573452 | Ga0105245_105734522 | 95 |
| 80 | 3300009101 | Ga0105247_10000204 | Ga0105247_1000020448 | 95 |
| 81 | 3300009147 | Ga0114129_12164329 | Ga0114129_121643291 | 95 |
| 82 | 3300009176 | Ga0105242_10002841 | Ga0105242_100028418 | 95 |
| 83 | 3300009553 | Ga0105249_10000235 | Ga0105249_1000023553 | 95 |
| 84 | 3300010375 | Ga0105239_10308314 | Ga0105239_103083142 | 95 |
| 85 | 3300013296 | Ga0157374_10815831 | Ga0157374_108158312 | 95 |
| 86 | 3300013297 | Ga0157378_10403833 | Ga0157378_104038332 | 95 |
| 87 | 3300013308 | Ga0157375_10225641 | Ga0157375_102256412 | 95 |
| 88 | 3300014968 | Ga0157379_10011591 | Ga0157379_100115917 | 95 |
| 89 | 3300022467 | Ga0224712_10101873 | Ga0224712_101018732 | 95 |
| 90 | 3300025898 | Ga0207692_10217280 | Ga0207692_102172802 | 95 |
| 91 | 3300025899 | Ga0207642_10361158 | Ga0207642_103611581 | 95 |
| 92 | 3300025915 | Ga0207693_10081364 | Ga0207693_100813642 | 95 |
| 93 | 3300025916 | Ga0207663_10061520 | Ga0207663_100615202 | 95 |
| 94 | 3300025939 | Ga0207665_10374127 | Ga0207665_103741273 | 95 |
| 95 | 3300025961 | Ga0207712_10000037 | Ga0207712_10000037138 | 95 |
| 96 | 3300027907 | Ga0207428_10053357 | Ga0207428_100533571 | 95 |
| 97 | 3300031901 | Ga0307406_10021145 | Ga0307406_100211454 | 95 |
| 98 | 3300032126 | Ga0307415_100273051 | Ga0307415_1002730512 | 95 |
| 99 | 3300032126 | Ga0307415_101001235 | Ga0307415_1010012351 | 95 |
| 100 | 3300036401 | Ga0373937_1970998 | Ga0373937_1970998_48_338 | 95 |
| 101 | 3300037418 | Ga0395900_0951222 | Ga0395900_0951222_404_724 | 95 |
| 102 | 3300037466 | Ga0395898_0018653 | Ga0395898_0018653_4822_5142 | 95 |
| 103 | 3300037471 | Ga0395905_0036867 | Ga0395905_0036867_1051_1371 | 95 |
| 104 | 3300038443 | Ga0395901_0205495 | Ga0395901_0205495_1536_1856 | 95 |
| 105 | 3300044694 | Ga0466963_0000585 | Ga0466963_0000585_16430_16720 | 95 |
| 106 | 3300046454 | Ga0495592_0626723 | Ga0495592_0626723_19_309 | 95 |
| 107 | 3300046455 | Ga0495603_0007750 | Ga0495603_0007750_4562_4852 | 95 |
| 108 | 3300046515 | Ga0495620_0002330 | Ga0495620_0002330_8727_9017 | 95 |
| 109 | 3300046516 | Ga0495628_0711775 | Ga0495628_0711775_362_652 | 95 |
| 110 | 3300046539 | Ga0495621_0002316 | Ga0495621_0002316_4296_4586 | 95 |
| 111 | 3300046663 | Ga0495635_0000026 | Ga0495635_0000026_98987_99277 | 95 |
| 112 | 3300046674 | Ga0495588_0097004 | Ga0495588_0097004_485_775 | 95 |
| 113 | 3300046680 | Ga0495646_0524932 | Ga0495646_0524932_201_491 | 95 |
| 114 | 3300046691 | Ga0495670_0162571 | Ga0495670_0162571_482_772 | 95 |
| 115 | 3300047317 | Ga0495604_0000413 | Ga0495604_0000413_25850_26140 | 95 |
| 116 | 3300047319 | Ga0495674_0823518 | Ga0495674_0823518_82_429 | 95 |
| 117 | 3300047321 | Ga0495676_0001347 | Ga0495676_0001347_20213_20503 | 95 |
| 118 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_435270_435557 | 95 |
| 119 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_892622_892909 | 95 |
| 120 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_91892_92182 | 95 |
| 121 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_91892_92182 | 95 |
| 122 | 3300048914 | Ga0496111_1170358 | Ga0496111_1170358_11_301 | 95 |
| 123 | 3300048922 | Ga0496119_0055607 | Ga0496119_0055607_1268_1555 | 95 |
| 124 | 3300048923 | Ga0496120_0057798 | Ga0496120_0057798_628_915 | 95 |
| 125 | 3300048928 | Ga0496125_0082765 | Ga0496125_0082765_1784_2074 | 95 |
| 126 | 3300050510 | nmdc:mga06r32_49041_c1 | nmdc:mga06r32_49041_c1_2848_3162 | 95 |
| 127 | 3300050511 | nmdc:mga08y16_64266_c1 | nmdc:mga08y16_64266_c1_3366_3680 | 95 |
| 128 | 3300050515 | nmdc:mga0a205_339441_c1 | nmdc:mga0a205_339441_c1_75_389 | 95 |
| 129 | 3300053078 | Ga0495612_0026255 | Ga0495612_0026255_1847_2194 | 95 |
| 130 | 3300053078 | Ga0495612_0246064 | Ga0495612_0246064_274_576 | 95 |
| 131 | 3300054114 | Ga0501084_0320743 | Ga0501084_0320743_950_1243 | 95 |
| 132 | 3300005535 | Ga0070684_100423061 | Ga0070684_1004230612 | 96 |
| 133 | 3300011119 | Ga0105246_10599369 | Ga0105246_105993692 | 96 |
| 134 | 3300021384 | Ga0213876_10024920 | Ga0213876_100249202 | 96 |
| 135 | 3300025944 | Ga0207661_10811227 | Ga0207661_108112272 | 96 |
| 136 | 3300028381 | Ga0268264_10013507 | Ga0268264_100135075 | 96 |
| 137 | 3300046523 | Ga0495644_0052692 | Ga0495644_0052692_37_354 | 96 |
| 138 | 3300046539 | Ga0495621_0180503 | Ga0495621_0180503_435_752 | 96 |
| 139 | 3300048918 | Ga0496115_0857334 | Ga0496115_0857334_174_482 | 96 |
| 140 | 3300050512 | nmdc:mga0n895_810688_c1 | nmdc:mga0n895_810688_c1_186_518 | 96 |
| 141 | 3300061734 | Ga0530510_0738456 | Ga0530510_0738456_86_409 | 96 |
| 142 | 3300005435 | Ga0070714_100100082 | Ga0070714_1001000823 | 97 |
| 143 | 3300005435 | Ga0070714_100537636 | Ga0070714_1005376362 | 97 |
| 144 | 3300005436 | Ga0070713_100062738 | Ga0070713_1000627382 | 97 |
| 145 | 3300005436 | Ga0070713_100127885 | Ga0070713_1001278853 | 97 |
| 146 | 3300005436 | Ga0070713_100156215 | Ga0070713_1001562152 | 97 |
| 147 | 3300005437 | Ga0070710_10183800 | Ga0070710_101838002 | 97 |
| 148 | 3300005437 | Ga0070710_10344530 | Ga0070710_103445302 | 97 |
| 149 | 3300006028 | Ga0070717_10593545 | Ga0070717_105935452 | 97 |
| 150 | 3300006175 | Ga0070712_100195741 | Ga0070712_1001957412 | 97 |
| 151 | 3300013307 | Ga0157372_11092036 | Ga0157372_110920362 | 97 |
| 152 | 3300017792 | Ga0163161_10370902 | Ga0163161_103709022 | 97 |
| 153 | 3300025898 | Ga0207692_10421453 | Ga0207692_104214532 | 97 |
| 154 | 3300025915 | Ga0207693_10012806 | Ga0207693_100128069 | 97 |
| 155 | 3300025916 | Ga0207663_10080907 | Ga0207663_100809073 | 97 |
| 156 | 3300025916 | Ga0207663_10150273 | Ga0207663_101502732 | 97 |
| 157 | 3300025929 | Ga0207664_10082112 | Ga0207664_100821122 | 97 |
| 158 | 3300025929 | Ga0207664_11995040 | Ga0207664_119950402 | 97 |
| 159 | 3300031852 | Ga0307410_11005653 | Ga0307410_110056532 | 97 |
| 160 | 3300031995 | Ga0307409_102834841 | Ga0307409_1028348412 | 97 |
| 161 | 3300032002 | Ga0307416_100468343 | Ga0307416_1004683432 | 97 |
| 162 | 3300035692 | Ga0373935_0426195 | Ga0373935_0426195_199_525 | 97 |
| 163 | 3300035724 | Ga0373933_0638816 | Ga0373933_0638816_281_607 | 97 |
| 164 | 3300036401 | Ga0373937_0342658 | Ga0373937_0342658_299_625 | 97 |
| 165 | 3300036401 | Ga0373937_0724274 | Ga0373937_0724274_94_420 | 97 |
| 166 | 3300037466 | Ga0395898_0918307 | Ga0395898_0918307_447_773 | 97 |
| 167 | 3300045049 | Ga0466959_0084849 | Ga0466959_0084849_1663_1983 | 97 |
| 168 | 3300046462 | Ga0495651_0094152 | Ga0495651_0094152_914_1240 | 97 |
| 169 | 3300046463 | Ga0495653_0326368 | Ga0495653_0326368_297_623 | 97 |
| 170 | 3300046473 | Ga0495582_0199127 | Ga0495582_0199127_400_726 | 97 |
| 171 | 3300046511 | Ga0495608_0199396 | Ga0495608_0199396_150_476 | 97 |
| 172 | 3300046511 | Ga0495608_0272156 | Ga0495608_0272156_94_420 | 97 |
| 173 | 3300046515 | Ga0495620_0357101 | Ga0495620_0357101_122_448 | 97 |
| 174 | 3300046533 | Ga0495640_0231582 | Ga0495640_0231582_605_931 | 97 |
| 175 | 3300046536 | Ga0495587_0070521 | Ga0495587_0070521_346_672 | 97 |
| 176 | 3300046559 | Ga0495667_0267512 | Ga0495667_0267512_662_988 | 97 |
| 177 | 3300046642 | Ga0495634_0184236 | Ga0495634_0184236_495_821 | 97 |
| 178 | 3300046663 | Ga0495635_0246643 | Ga0495635_0246643_748_1074 | 97 |
| 179 | 3300046675 | Ga0495657_0102165 | Ga0495657_0102165_872_1198 | 97 |
| 180 | 3300046679 | Ga0495623_0499592 | Ga0495623_0499592_268_594 | 97 |
| 181 | 3300046680 | Ga0495646_0443048 | Ga0495646_0443048_229_555 | 97 |
| 182 | 3300046689 | Ga0495613_0497443 | Ga0495613_0497443_333_659 | 97 |
| 183 | 3300047315 | Ga0495581_0392992 | Ga0495581_0392992_43_369 | 97 |
| 184 | 3300047317 | Ga0495604_0141086 | Ga0495604_0141086_957_1283 | 97 |
| 185 | 3300047317 | Ga0495604_0550801 | Ga0495604_0550801_373_699 | 97 |
| 186 | 3300047322 | Ga0495680_0033973 | Ga0495680_0033973_1034_1360 | 97 |
| 187 | 3300047322 | Ga0495680_0599018 | Ga0495680_0599018_116_442 | 97 |
| 188 | 3300047444 | Ga0495675_0082909 | Ga0495675_0082909_818_1144 | 97 |
| 189 | 3300047673 | Ga0495593_0141678 | Ga0495593_0141678_370_696 | 97 |
| 190 | 3300048903 | Ga0496100_0008714 | Ga0496100_0008714_4709_5050 | 97 |
| 191 | 3300048904 | Ga0496101_0011624 | Ga0496101_0011624_428_769 | 97 |
| 192 | 3300048905 | Ga0496102_1485839 | Ga0496102_1485839_130_456 | 97 |
| 193 | 3300048910 | Ga0496107_0930233 | Ga0496107_0930233_169_495 | 97 |
| 194 | 3300048913 | Ga0496110_0148516 | Ga0496110_0148516_824_1150 | 97 |
| 195 | 3300048913 | Ga0496110_0345073 | Ga0496110_0345073_792_1133 | 97 |
| 196 | 3300048914 | Ga0496111_0387065 | Ga0496111_0387065_28_369 | 97 |
| 197 | 3300048914 | Ga0496111_0691935 | Ga0496111_0691935_286_612 | 97 |
| 198 | 3300048915 | Ga0496112_0000857 | Ga0496112_0000857_16455_16787 | 97 |
| 199 | 3300048915 | Ga0496112_1752647 | Ga0496112_1752647_113_439 | 97 |
| 200 | 3300048916 | Ga0496113_0321739 | Ga0496113_0321739_394_720 | 97 |
| 201 | 3300050507 | nmdc:mga05p37_8570_c1 | nmdc:mga05p37_8570_c1_319_660 | 97 |
| 202 | 3300050508 | nmdc:mga09592_345171_c1 | nmdc:mga09592_345171_c1_932_1273 | 97 |
| 203 | 3300050509 | nmdc:mga0qj67_848261_c1 | nmdc:mga0qj67_848261_c1_109_450 | 97 |
| 204 | 3300050510 | nmdc:mga06r32_173360_c1 | nmdc:mga06r32_173360_c1_875_1216 | 97 |
| 205 | 3300053077 | Ga0495601_0216189 | Ga0495601_0216189_633_959 | 97 |
| 206 | 3300053084 | Ga0495595_0118423 | Ga0495595_0118423_157_483 | 97 |
| 207 | 3300053085 | Ga0495619_0123869 | Ga0495619_0123869_1002_1328 | 97 |
| 208 | 3300003373 | JGI25407J50210_10056006 | JGI25407J50210_100560062 | 98 |
| 209 | 3300005937 | Ga0081455_10635492 | Ga0081455_106354922 | 98 |
| 210 | 3300012492 | Ga0157335_1033844 | Ga0157335_10338442 | 98 |
| 211 | 3300037853 | Ga0436364_0167671 | Ga0436364_0167671_5504_5821 | 98 |
| 212 | 3300039437 | Ga0436365_0924437 | Ga0436365_0924437_303_620 | 98 |
| 213 | 3300039437 | Ga0436365_0969934 | Ga0436365_0969934_751_1059 | 98 |
| 214 | 3300039437 | Ga0436365_1934953 | Ga0436365_1934953_235_543 | 98 |
| 215 | 3300039450 | Ga0436363_1638120 | Ga0436363_1638120_455_763 | 98 |
| 216 | 3300039453 | Ga0436362_0120799 | Ga0436362_0120799_403_717 | 98 |
| 217 | 3300039453 | Ga0436362_0451879 | Ga0436362_0451879_156_473 | 98 |
| 218 | 3300041451 | Ga0451791_1132480 | Ga0451791_1132480_236_538 | 98 |
| 219 | 3300044842 | Ga0466957_0493651 | Ga0466957_0493651_319_627 | 98 |
| 220 | 3300045976 | Ga0466967_0803306 | Ga0466967_0803306_15_314 | 98 |
| 221 | 3300046459 | Ga0495629_0096664 | Ga0495629_0096664_1721_2023 | 98 |
| 222 | 3300046461 | Ga0495641_0147257 | Ga0495641_0147257_209_517 | 98 |
| 223 | 3300046475 | Ga0495639_0647172 | Ga0495639_0647172_92_400 | 98 |
| 224 | 3300046517 | Ga0495630_0319808 | Ga0495630_0319808_801_1103 | 98 |
| 225 | 3300046531 | Ga0495665_0531549 | Ga0495665_0531549_77_385 | 98 |
| 226 | 3300046689 | Ga0495613_0099944 | Ga0495613_0099944_1728_2036 | 98 |
| 227 | 3300047471 | Ga0495684_0289152 | Ga0495684_0289152_58_366 | 98 |
| 228 | 3300048907 | Ga0496104_0340318 | Ga0496104_0340318_165_473 | 98 |
| 229 | 3300048908 | Ga0496105_0127713 | Ga0496105_0127713_1291_1599 | 98 |
| 230 | 3300048912 | Ga0496109_0681031 | Ga0496109_0681031_499_807 | 98 |
| 231 | 3300048915 | Ga0496112_0814475 | Ga0496112_0814475_349_657 | 98 |
| 232 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008221 | 99 |
| 233 | 3300006847 | Ga0075431_100314659 | Ga0075431_1003146592 | 99 |
| 234 | 3300009176 | Ga0105242_10156325 | Ga0105242_101563252 | 99 |
| 235 | 3300013307 | Ga0157372_11005891 | Ga0157372_110058912 | 99 |
| 236 | 3300020077 | Ga0206351_10054906 | Ga0206351_100549062 | 99 |
| 237 | 3300025915 | Ga0207693_10323798 | Ga0207693_103237982 | 99 |
| 238 | 3300025934 | Ga0207686_10047518 | Ga0207686_100475182 | 99 |
| 239 | 3300025939 | Ga0207665_10396645 | Ga0207665_103966452 | 99 |
| 240 | 3300026035 | Ga0207703_10000237 | Ga0207703_1000023729 | 99 |
| 241 | 3300030521 | Ga0307511_10082567 | Ga0307511_100825673 | 99 |
| 242 | 3300037853 | Ga0436364_0139100 | Ga0436364_0139100_59_379 | 99 |
| 243 | 3300039437 | Ga0436365_0342589 | Ga0436365_0342589_969_1289 | 99 |
| 244 | 3300039453 | Ga0436362_0337191 | Ga0436362_0337191_110_436 | 99 |
| 245 | 3300045836 | Ga0466958_0036126 | Ga0466958_0036126_46_387 | 99 |
| 246 | 3300045976 | Ga0466967_0566402 | Ga0466967_0566402_220_543 | 99 |
| 247 | 3300046454 | Ga0495592_0000600 | Ga0495592_0000600_17412_17714 | 99 |
| 248 | 3300046455 | Ga0495603_0001152 | Ga0495603_0001152_13248_13547 | 99 |
| 249 | 3300046461 | Ga0495641_0161307 | Ga0495641_0161307_685_987 | 99 |
| 250 | 3300046463 | Ga0495653_0240166 | Ga0495653_0240166_496_798 | 99 |
| 251 | 3300046463 | Ga0495653_0279029 | Ga0495653_0279029_385_687 | 99 |
| 252 | 3300046476 | Ga0495662_0000021 | Ga0495662_0000021_26228_26530 | 99 |
| 253 | 3300046511 | Ga0495608_0003895 | Ga0495608_0003895_7674_7976 | 99 |
| 254 | 3300046514 | Ga0495618_0000058 | Ga0495618_0000058_33972_34274 | 99 |
| 255 | 3300046516 | Ga0495628_0004164 | Ga0495628_0004164_11969_12271 | 99 |
| 256 | 3300046516 | Ga0495628_0441424 | Ga0495628_0441424_247_549 | 99 |
| 257 | 3300046517 | Ga0495630_0002139 | Ga0495630_0002139_461_763 | 99 |
| 258 | 3300046533 | Ga0495640_0054649 | Ga0495640_0054649_2284_2586 | 99 |
| 259 | 3300046675 | Ga0495657_0043883 | Ga0495657_0043883_2268_2570 | 99 |
| 260 | 3300046681 | Ga0495647_0030918 | Ga0495647_0030918_746_1045 | 99 |
| 261 | 3300046681 | Ga0495647_0032972 | Ga0495647_0032972_684_986 | 99 |
| 262 | 3300046689 | Ga0495613_0000364 | Ga0495613_0000364_6845_7147 | 99 |
| 263 | 3300046690 | Ga0495624_0701847 | Ga0495624_0701847_52_351 | 99 |
| 264 | 3300046809 | Ga0495600_0023432 | Ga0495600_0023432_871_1173 | 99 |
| 265 | 3300047319 | Ga0495674_0687050 | Ga0495674_0687050_485_787 | 99 |
| 266 | 3300047322 | Ga0495680_0000407 | Ga0495680_0000407_38050_38352 | 99 |
| 267 | 3300048904 | Ga0496101_1503897 | Ga0496101_1503897_51_353 | 99 |
| 268 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_55756_56088 | 99 |
| 269 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_341076_341408 | 99 |
| 270 | 3300053078 | Ga0495612_0183550 | Ga0495612_0183550_481_801 | 99 |
| 271 | 3300053084 | Ga0495595_0000167 | Ga0495595_0000167_23425_23727 | 99 |
| 272 | 3300053085 | Ga0495619_0000042 | Ga0495619_0000042_44153_44494 | 99 |
| 273 | 3300005338 | Ga0068868_100005792 | Ga0068868_1000057923 | 100 |
| 274 | 3300005341 | Ga0070691_10000014 | Ga0070691_1000001418 | 100 |
| 275 | 3300005436 | Ga0070713_100000143 | Ga0070713_10000014331 | 100 |
| 276 | 3300005981 | Ga0081538_10018805 | Ga0081538_100188052 | 100 |
| 277 | 3300009176 | Ga0105242_11546418 | Ga0105242_115464181 | 100 |
| 278 | 3300020077 | Ga0206351_10998395 | Ga0206351_109983951 | 100 |
| 279 | 3300025926 | Ga0207659_10000014 | Ga0207659_1000001492 | 100 |
| 280 | 3300026023 | Ga0207677_10012618 | Ga0207677_100126185 | 100 |
| 281 | 3300046460 | Ga0495638_0008356 | Ga0495638_0008356_400_744 | 100 |
| 282 | 3300046461 | Ga0495641_0142995 | Ga0495641_0142995_509_814 | 100 |
| 283 | 3300048908 | Ga0496105_0890830 | Ga0496105_0890830_218_568 | 100 |
| 284 | 3300048909 | Ga0496106_0723823 | Ga0496106_0723823_24_335 | 100 |
| 285 | 3300048918 | Ga0496115_0326693 | Ga0496115_0326693_280_630 | 100 |
| 286 | 3300049583 | Ga0501067_0507740 | Ga0501067_0507740_321_632 | 100 |
| 287 | 3300049585 | Ga0501069_0354333 | Ga0501069_0354333_35_346 | 100 |
| 288 | 3300049587 | Ga0501071_0473303 | Ga0501071_0473303_268_609 | 100 |
| 289 | 3300053083 | Ga0495655_0000904 | Ga0495655_0000904_330_677 | 100 |
| 290 | 3300005341 | Ga0070691_10000822 | Ga0070691_100008229 | 101 |
| 291 | 3300005356 | Ga0070674_100000103 | Ga0070674_10000010312 | 101 |
| 292 | 3300005364 | Ga0070673_100004180 | Ga0070673_1000041809 | 101 |
| 293 | 3300005435 | Ga0070714_100151292 | Ga0070714_1001512923 | 101 |
| 294 | 3300005437 | Ga0070710_11288732 | Ga0070710_112887321 | 101 |
| 295 | 3300005439 | Ga0070711_100111202 | Ga0070711_1001112021 | 101 |
| 296 | 3300005445 | Ga0070708_101703830 | Ga0070708_1017038302 | 101 |
| 297 | 3300005456 | Ga0070678_100120545 | Ga0070678_1001205452 | 101 |
| 298 | 3300005456 | Ga0070678_100714791 | Ga0070678_1007147912 | 101 |
| 299 | 3300005614 | Ga0068856_100198127 | Ga0068856_1001981272 | 101 |
| 300 | 3300005616 | Ga0068852_100000005 | Ga0068852_100000005159 | 101 |
| 301 | 3300005718 | Ga0068866_10000014 | Ga0068866_1000001468 | 101 |
| 302 | 3300005844 | Ga0068862_100995203 | Ga0068862_1009952032 | 101 |
| 303 | 3300006163 | Ga0070715_10000011 | Ga0070715_1000001169 | 101 |
| 304 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001748 | 101 |
| 305 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001118 | 101 |
| 306 | 3300025923 | Ga0207681_10116366 | Ga0207681_101163662 | 101 |
| 307 | 3300025925 | Ga0207650_10082055 | Ga0207650_100820552 | 101 |
| 308 | 3300025928 | Ga0207700_10000008 | Ga0207700_1000000821 | 101 |
| 309 | 3300025929 | Ga0207664_10078184 | Ga0207664_100781842 | 101 |
| 310 | 3300025935 | Ga0207709_10011143 | Ga0207709_100111436 | 101 |
| 311 | 3300025937 | Ga0207669_10000115 | Ga0207669_1000011530 | 101 |
| 312 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024188 | 101 |
| 313 | 3300025960 | Ga0207651_10001295 | Ga0207651_1000129511 | 101 |
| 314 | 3300025972 | Ga0207668_10040497 | Ga0207668_100404974 | 101 |
| 315 | 3300026078 | Ga0207702_10053419 | Ga0207702_100534193 | 101 |
| 316 | 3300026078 | Ga0207702_11427537 | Ga0207702_114275372 | 101 |
| 317 | 3300026121 | Ga0207683_10118949 | Ga0207683_101189492 | 101 |
| 318 | 3300026142 | Ga0207698_10000038 | Ga0207698_1000003880 | 101 |
| 319 | 3300028380 | Ga0268265_10746971 | Ga0268265_107469712 | 101 |
| 320 | 3300044694 | Ga0466963_1011281 | Ga0466963_1011281_177_515 | 101 |
| 321 | 3300046642 | Ga0495634_0000601 | Ga0495634_0000601_31988_32332 | 101 |
| 322 | 3300049592 | Ga0501076_1489937 | Ga0501076_1489937_187_546 | 101 |
| 323 | 3300005356 | Ga0070674_100185884 | Ga0070674_1001858842 | 102 |
| 324 | 3300005366 | Ga0070659_102068170 | Ga0070659_1020681701 | 102 |
| 325 | 3300005367 | Ga0070667_100395819 | Ga0070667_1003958192 | 102 |
| 326 | 3300005440 | Ga0070705_100390979 | Ga0070705_1003909792 | 102 |
| 327 | 3300005444 | Ga0070694_100815211 | Ga0070694_1008152112 | 102 |
| 328 | 3300005539 | Ga0068853_100001637 | Ga0068853_1000016378 | 102 |
| 329 | 3300005545 | Ga0070695_100808184 | Ga0070695_1008081842 | 102 |
| 330 | 3300005549 | Ga0070704_100290823 | Ga0070704_1002908232 | 102 |
| 331 | 3300005719 | Ga0068861_100306856 | Ga0068861_1003068562 | 102 |
| 332 | 3300005841 | Ga0068863_101612749 | Ga0068863_1016127492 | 102 |
| 333 | 3300006048 | Ga0075363_100245526 | Ga0075363_1002455262 | 102 |
| 334 | 3300009098 | Ga0105245_10000667 | Ga0105245_1000066723 | 102 |
| 335 | 3300009148 | Ga0105243_10268359 | Ga0105243_102683593 | 102 |
| 336 | 3300009176 | Ga0105242_10283626 | Ga0105242_102836262 | 102 |
| 337 | 3300009553 | Ga0105249_10658074 | Ga0105249_106580742 | 102 |
| 338 | 3300013104 | Ga0157370_10447022 | Ga0157370_104470222 | 102 |
| 339 | 3300025916 | Ga0207663_10078734 | Ga0207663_100787342 | 102 |
| 340 | 3300025927 | Ga0207687_10000037 | Ga0207687_1000003714 | 102 |
| 341 | 3300025927 | Ga0207687_10309073 | Ga0207687_103090732 | 102 |
| 342 | 3300025928 | Ga0207700_11657082 | Ga0207700_116570822 | 102 |
| 343 | 3300025934 | Ga0207686_10427879 | Ga0207686_104278792 | 102 |
| 344 | 3300025937 | Ga0207669_11842249 | Ga0207669_118422491 | 102 |
| 345 | 3300025960 | Ga0207651_11226127 | Ga0207651_112261272 | 102 |
| 346 | 3300025961 | Ga0207712_10596440 | Ga0207712_105964402 | 102 |
| 347 | 3300025972 | Ga0207668_10906109 | Ga0207668_109061092 | 102 |
| 348 | 3300025986 | Ga0207658_10151095 | Ga0207658_101510952 | 102 |
| 349 | 3300026041 | Ga0207639_10003793 | Ga0207639_100037935 | 102 |
| 350 | 3300026118 | Ga0207675_100481936 | Ga0207675_1004819362 | 102 |
| 351 | 3300047673 | Ga0495593_0374253 | Ga0495593_0374253_304_621 | 102 |
| 352 | 3300048905 | Ga0496102_0853204 | Ga0496102_0853204_52_378 | 102 |
| 353 | 3300048908 | Ga0496105_0093363 | Ga0496105_0093363_1164_1481 | 102 |
| 354 | 3300005543 | Ga0070672_100000175 | Ga0070672_10000017527 | 103 |
| 355 | 3300025940 | Ga0207691_10000609 | Ga0207691_1000060910 | 103 |
| 356 | 3300039437 | Ga0436365_0105231 | Ga0436365_0105231_713_1042 | 103 |
| 357 | 3300048926 | Ga0496123_0230959 | Ga0496123_0230959_79_465 | 103 |
| 358 | 3300049575 | Ga0501039_1030687 | Ga0501039_1030687_217_585 | 103 |
| 359 | 3300049587 | Ga0501071_0589524 | Ga0501071_0589524_222_590 | 103 |
| 360 | 3300049588 | Ga0501072_0641590 | Ga0501072_0641590_405_773 | 103 |
| 361 | 3300049590 | Ga0501074_0082466 | Ga0501074_0082466_393_761 | 103 |
| 362 | 3300049591 | Ga0501075_0213138 | Ga0501075_0213138_289_657 | 103 |
| 363 | 3300049593 | Ga0501077_0198381 | Ga0501077_0198381_399_767 | 103 |
| 364 | 3300061734 | Ga0530510_0449863 | Ga0530510_0449863_429_797 | 103 |
| 365 | 3300005338 | Ga0068868_100000467 | Ga0068868_10000046718 | 104 |
| 366 | 3300005438 | Ga0070701_10338851 | Ga0070701_103388512 | 104 |
| 367 | 3300005457 | Ga0070662_100000015 | Ga0070662_10000001592 | 104 |
| 368 | 3300005547 | Ga0070693_100069509 | Ga0070693_1000695093 | 104 |
| 369 | 3300005983 | Ga0081540_1116131 | Ga0081540_11161312 | 104 |
| 370 | 3300006871 | Ga0075434_100018827 | Ga0075434_1000188274 | 104 |
| 371 | 3300009147 | Ga0114129_10853789 | Ga0114129_108537892 | 104 |
| 372 | 3300014325 | Ga0163163_10140552 | Ga0163163_101405523 | 104 |
| 373 | 3300025915 | Ga0207693_10674134 | Ga0207693_106741341 | 104 |
| 374 | 3300025933 | Ga0207706_10000062 | Ga0207706_1000006217 | 104 |
| 375 | 3300026023 | Ga0207677_10000464 | Ga0207677_100004649 | 104 |
| 376 | 3300046454 | Ga0495592_0623949 | Ga0495592_0623949_241_585 | 104 |
| 377 | 3300046473 | Ga0495582_0000013 | Ga0495582_0000013_20042_20359 | 104 |
| 378 | 3300046499 | Ga0495594_0100615 | Ga0495594_0100615_827_1144 | 104 |
| 379 | 3300046535 | Ga0495586_0837277 | Ga0495586_0837277_18_335 | 104 |
| 380 | 3300046536 | Ga0495587_0025864 | Ga0495587_0025864_1609_1926 | 104 |
| 381 | 3300046642 | Ga0495634_0352161 | Ga0495634_0352161_120_437 | 104 |
| 382 | 3300046683 | Ga0495658_0000009 | Ga0495658_0000009_90023_90340 | 104 |
| 383 | 3300047469 | Ga0495673_0120790 | Ga0495673_0120790_174_491 | 104 |
| 384 | 3300048907 | Ga0496104_0376206 | Ga0496104_0376206_235_564 | 104 |
| 385 | 3300048910 | Ga0496107_0366400 | Ga0496107_0366400_291_608 | 104 |
| 386 | 3300048913 | Ga0496110_0933214 | Ga0496110_0933214_119_448 | 104 |
| 387 | 3300048914 | Ga0496111_0517110 | Ga0496111_0517110_331_660 | 104 |
| 388 | 3300048916 | Ga0496113_0129070 | Ga0496113_0129070_445_774 | 104 |
| 389 | 3300049578 | Ga0501042_0033618 | Ga0501042_0033618_736_1053 | 104 |
| 390 | 3300049587 | Ga0501071_0655002 | Ga0501071_0655002_136_468 | 104 |
| 391 | 3300050507 | nmdc:mga05p37_556183_c1 | nmdc:mga05p37_556183_c1_63_392 | 104 |
| 392 | 3300050515 | nmdc:mga0a205_58968_c1 | nmdc:mga0a205_58968_c1_2782_3111 | 104 |
| 393 | 3300053085 | Ga0495619_0013246 | Ga0495619_0013246_1536_1853 | 104 |
| 394 | 3300005546 | Ga0070696_101062770 | Ga0070696_1010627701 | 105 |
| 395 | 3300005564 | Ga0070664_100033581 | Ga0070664_1000335814 | 105 |
| 396 | 3300005841 | Ga0068863_100000136 | Ga0068863_10000013627 | 105 |
| 397 | 3300006038 | Ga0075365_10985650 | Ga0075365_109856502 | 105 |
| 398 | 3300006880 | Ga0075429_101025444 | Ga0075429_1010254442 | 105 |
| 399 | 3300009098 | Ga0105245_11221967 | Ga0105245_112219672 | 105 |
| 400 | 3300009101 | Ga0105247_11519502 | Ga0105247_115195022 | 105 |
| 401 | 3300009147 | Ga0114129_10327426 | Ga0114129_103274262 | 105 |
| 402 | 3300009148 | Ga0105243_10816183 | Ga0105243_108161832 | 105 |
| 403 | 3300009176 | Ga0105242_10996001 | Ga0105242_109960012 | 105 |
| 404 | 3300009551 | Ga0105238_10000172 | Ga0105238_1000017231 | 105 |
| 405 | 3300010375 | Ga0105239_12273443 | Ga0105239_122734432 | 105 |
| 406 | 3300013296 | Ga0157374_10006572 | Ga0157374_100065724 | 105 |
| 407 | 3300013308 | Ga0157375_10028002 | Ga0157375_100280023 | 105 |
| 408 | 3300014326 | Ga0157380_10000550 | Ga0157380_100005502 | 105 |
| 409 | 3300014969 | Ga0157376_11778251 | Ga0157376_117782512 | 105 |
| 410 | 3300025945 | Ga0207679_10025338 | Ga0207679_100253384 | 105 |
| 411 | 3300026088 | Ga0207641_10000265 | Ga0207641_1000026537 | 105 |
| 412 | 3300045976 | Ga0466967_2009051 | Ga0466967_2009051_82_402 | 105 |
| 413 | 3300046461 | Ga0495641_0110749 | Ga0495641_0110749_638_964 | 105 |
| 414 | 3300046463 | Ga0495653_0190870 | Ga0495653_0190870_474_794 | 105 |
| 415 | 3300046463 | Ga0495653_0237721 | Ga0495653_0237721_81_407 | 105 |
| 416 | 3300046514 | Ga0495618_0368346 | Ga0495618_0368346_455_781 | 105 |
| 417 | 3300046516 | Ga0495628_0318871 | Ga0495628_0318871_493_819 | 105 |
| 418 | 3300046517 | Ga0495630_0001432 | Ga0495630_0001432_14952_15278 | 105 |
| 419 | 3300046520 | Ga0495637_0188004 | Ga0495637_0188004_118_438 | 105 |
| 420 | 3300046523 | Ga0495644_0000693 | Ga0495644_0000693_11042_11362 | 105 |
| 421 | 3300046529 | Ga0495652_0017506 | Ga0495652_0017506_2671_2997 | 105 |
| 422 | 3300046529 | Ga0495652_0052526 | Ga0495652_0052526_1192_1512 | 105 |
| 423 | 3300046535 | Ga0495586_0004843 | Ga0495586_0004843_381_701 | 105 |
| 424 | 3300046537 | Ga0495598_0030761 | Ga0495598_0030761_693_1013 | 105 |
| 425 | 3300046543 | Ga0495645_0078054 | Ga0495645_0078054_109_435 | 105 |
| 426 | 3300046642 | Ga0495634_0142741 | Ga0495634_0142741_684_1010 | 105 |
| 427 | 3300046642 | Ga0495634_0199482 | Ga0495634_0199482_426_746 | 105 |
| 428 | 3300046663 | Ga0495635_0155880 | Ga0495635_0155880_738_1064 | 105 |
| 429 | 3300046675 | Ga0495657_0024223 | Ga0495657_0024223_3452_3778 | 105 |
| 430 | 3300046681 | Ga0495647_0000027 | Ga0495647_0000027_2090_2410 | 105 |
| 431 | 3300046683 | Ga0495658_0235027 | Ga0495658_0235027_576_902 | 105 |
| 432 | 3300046684 | Ga0495669_0000823 | Ga0495669_0000823_2108_2428 | 105 |
| 433 | 3300046690 | Ga0495624_0000012 | Ga0495624_0000012_2684_3004 | 105 |
| 434 | 3300046690 | Ga0495624_0430041 | Ga0495624_0430041_223_549 | 105 |
| 435 | 3300046809 | Ga0495600_0832962 | Ga0495600_0832962_210_530 | 105 |
| 436 | 3300047321 | Ga0495676_0356953 | Ga0495676_0356953_221_541 | 105 |
| 437 | 3300047322 | Ga0495680_0190588 | Ga0495680_0190588_18_344 | 105 |
| 438 | 3300047444 | Ga0495675_0231539 | Ga0495675_0231539_456_776 | 105 |
| 439 | 3300047673 | Ga0495593_0067439 | Ga0495593_0067439_1327_1647 | 105 |
| 440 | 3300047673 | Ga0495593_0170552 | Ga0495593_0170552_449_769 | 105 |
| 441 | 3300048907 | Ga0496104_0002173 | Ga0496104_0002173_11355_11675 | 105 |
| 442 | 3300048908 | Ga0496105_0029466 | Ga0496105_0029466_1579_1899 | 105 |
| 443 | 3300048909 | Ga0496106_0000174 | Ga0496106_0000174_29118_29438 | 105 |
| 444 | 3300048910 | Ga0496107_0200961 | Ga0496107_0200961_656_976 | 105 |
| 445 | 3300048912 | Ga0496109_0231309 | Ga0496109_0231309_136_456 | 105 |
| 446 | 3300048913 | Ga0496110_0614598 | Ga0496110_0614598_162_482 | 105 |
| 447 | 3300048915 | Ga0496112_0658969 | Ga0496112_0658969_82_402 | 105 |
| 448 | 3300049741 | Ga0501079_1044261 | Ga0501079_1044261_282_602 | 105 |
| 449 | 3300049743 | Ga0501081_0452393 | Ga0501081_0452393_471_791 | 105 |
| 450 | 3300050507 | nmdc:mga05p37_73843_c1 | nmdc:mga05p37_73843_c1_212_571 | 105 |
| 451 | 3300053077 | Ga0495601_0003093 | Ga0495601_0003093_2928_3254 | 105 |
| 452 | 3300053077 | Ga0495601_0006808 | Ga0495601_0006808_5908_6228 | 105 |
| 453 | 3300053077 | Ga0495601_0087988 | Ga0495601_0087988_74_400 | 105 |
| 454 | 3300053077 | Ga0495601_0167900 | Ga0495601_0167900_466_792 | 105 |
| 455 | 3300053078 | Ga0495612_0019089 | Ga0495612_0019089_50_376 | 105 |
| 456 | 3300053085 | Ga0495619_0000327 | Ga0495619_0000327_32413_32739 | 105 |
| 457 | 3300053085 | Ga0495619_0010227 | Ga0495619_0010227_5335_5661 | 105 |
| 458 | 3300054114 | Ga0501084_0773370 | Ga0501084_0773370_463_783 | 105 |
| 459 | 3300049575 | Ga0501039_0579492 | Ga0501039_0579492_96_425 | 106 |
| 460 | 3300049741 | Ga0501079_1230804 | Ga0501079_1230804_201_542 | 106 |
| 461 | 3300005327 | Ga0070658_10051144 | Ga0070658_100511442 | 108 |
| 462 | 3300005439 | Ga0070711_100005366 | Ga0070711_1000053669 | 108 |
| 463 | 3300005983 | Ga0081540_1000296 | Ga0081540_100029621 | 108 |
| 464 | 3300006178 | Ga0075367_10371701 | Ga0075367_103717012 | 108 |
| 465 | 3300006871 | Ga0075434_100050514 | Ga0075434_1000505143 | 108 |
| 466 | 3300006914 | Ga0075436_100860605 | Ga0075436_1008606052 | 108 |
| 467 | 3300007076 | Ga0075435_100369786 | Ga0075435_1003697862 | 108 |
| 468 | 3300025916 | Ga0207663_10000854 | Ga0207663_100008542 | 108 |
| 469 | 3300026095 | Ga0207676_10000048 | Ga0207676_10000048149 | 108 |
| 470 | 3300028379 | Ga0268266_11006555 | Ga0268266_110065551 | 108 |
| 471 | 3300047320 | Ga0495672_0100485 | Ga0495672_0100485_249_593 | 108 |
| 472 | 3300048913 | Ga0496110_1017693 | Ga0496110_1017693_153_491 | 108 |
| 473 | 3300050494 | nmdc:mga06z11_535025_c1 | nmdc:mga06z11_535025_c1_85_423 | 108 |
| 474 | 3300050507 | nmdc:mga05p37_1891672_c1 | nmdc:mga05p37_1891672_c1_156_494 | 108 |
| 475 | 3300050513 | nmdc:mga0rr50_384975_c1 | nmdc:mga0rr50_384975_c1_531_869 | 108 |
| 476 | 3300050515 | nmdc:mga0a205_57697_c1 | nmdc:mga0a205_57697_c1_2765_3103 | 108 |
| 477 | 3300005329 | Ga0070683_100004015 | Ga0070683_1000040156 | 109 |
| 478 | 3300005333 | Ga0070677_10000013 | Ga0070677_1000001345 | 109 |
| 479 | 3300005336 | Ga0070680_100115046 | Ga0070680_1001150462 | 109 |
| 480 | 3300005337 | Ga0070682_100001328 | Ga0070682_1000013287 | 109 |
| 481 | 3300005344 | Ga0070661_101686299 | Ga0070661_1016862991 | 109 |
| 482 | 3300005441 | Ga0070700_100557734 | Ga0070700_1005577341 | 109 |
| 483 | 3300005456 | Ga0070678_100007193 | Ga0070678_1000071937 | 109 |
| 484 | 3300005458 | Ga0070681_10372816 | Ga0070681_103728162 | 109 |
| 485 | 3300005466 | Ga0070685_10000037 | Ga0070685_100000372 | 109 |
| 486 | 3300005530 | Ga0070679_100000069 | Ga0070679_1000000697 | 109 |
| 487 | 3300005535 | Ga0070684_100003643 | Ga0070684_10000364312 | 109 |
| 488 | 3300005535 | Ga0070684_100868178 | Ga0070684_1008681782 | 109 |
| 489 | 3300005539 | Ga0068853_100609239 | Ga0068853_1006092392 | 109 |
| 490 | 3300005548 | Ga0070665_100000068 | Ga0070665_1000000689 | 109 |
| 491 | 3300005563 | Ga0068855_100122747 | Ga0068855_1001227472 | 109 |
| 492 | 3300005578 | Ga0068854_100000472 | Ga0068854_1000004728 | 109 |
| 493 | 3300005578 | Ga0068854_100006598 | Ga0068854_1000065987 | 109 |
| 494 | 3300005614 | Ga0068856_100000210 | Ga0068856_10000021025 | 109 |
| 495 | 3300005834 | Ga0068851_10008803 | Ga0068851_100088036 | 109 |
| 496 | 3300005834 | Ga0068851_10107455 | Ga0068851_101074552 | 109 |
| 497 | 3300005842 | Ga0068858_100001203 | Ga0068858_10000120321 | 109 |
| 498 | 3300005844 | Ga0068862_100783918 | Ga0068862_1007839181 | 109 |
| 499 | 3300006163 | Ga0070715_10026203 | Ga0070715_100262032 | 109 |
| 500 | 3300006881 | Ga0068865_100000019 | Ga0068865_10000001982 | 109 |
| 501 | 3300009093 | Ga0105240_11502154 | Ga0105240_115021542 | 109 |
| 502 | 3300009098 | Ga0105245_10000012 | Ga0105245_1000001244 | 109 |
| 503 | 3300009098 | Ga0105245_10030985 | Ga0105245_100309851 | 109 |
| 504 | 3300010375 | Ga0105239_10190013 | Ga0105239_101900132 | 109 |
| 505 | 3300017792 | Ga0163161_10201205 | Ga0163161_102012052 | 109 |
| 506 | 3300020081 | Ga0206354_10737789 | Ga0206354_107377894 | 109 |
| 507 | 3300020082 | Ga0206353_11079496 | Ga0206353_110794961 | 109 |
| 508 | 3300025321 | Ga0207656_10000105 | Ga0207656_1000010532 | 109 |
| 509 | 3300025321 | Ga0207656_10024930 | Ga0207656_100249302 | 109 |
| 510 | 3300025893 | Ga0207682_10000038 | Ga0207682_1000003845 | 109 |
| 511 | 3300025905 | Ga0207685_10017389 | Ga0207685_100173892 | 109 |
| 512 | 3300025909 | Ga0207705_10041343 | Ga0207705_100413432 | 109 |
| 513 | 3300025912 | Ga0207707_10051034 | Ga0207707_100510342 | 109 |
| 514 | 3300025913 | Ga0207695_11220675 | Ga0207695_112206752 | 109 |
| 515 | 3300025917 | Ga0207660_10097128 | Ga0207660_100971282 | 109 |
| 516 | 3300025921 | Ga0207652_10000142 | Ga0207652_1000014275 | 109 |
| 517 | 3300025927 | Ga0207687_10000011 | Ga0207687_1000001197 | 109 |
| 518 | 3300025927 | Ga0207687_10021630 | Ga0207687_100216304 | 109 |
| 519 | 3300025938 | Ga0207704_10000009 | Ga0207704_100000099 | 109 |
| 520 | 3300025944 | Ga0207661_10001063 | Ga0207661_100010637 | 109 |
| 521 | 3300025949 | Ga0207667_11041123 | Ga0207667_110411232 | 109 |
| 522 | 3300025981 | Ga0207640_10000125 | Ga0207640_1000012520 | 109 |
| 523 | 3300025981 | Ga0207640_10052356 | Ga0207640_100523562 | 109 |
| 524 | 3300026035 | Ga0207703_10000128 | Ga0207703_1000012868 | 109 |
| 525 | 3300026075 | Ga0207708_10551197 | Ga0207708_105511972 | 109 |
| 526 | 3300026078 | Ga0207702_10001764 | Ga0207702_100017642 | 109 |
| 527 | 3300026078 | Ga0207702_10025507 | Ga0207702_100255073 | 109 |
| 528 | 3300026078 | Ga0207702_10737985 | Ga0207702_107379852 | 109 |
| 529 | 3300026118 | Ga0207675_101817799 | Ga0207675_1018177992 | 109 |
| 530 | 3300026121 | Ga0207683_10027288 | Ga0207683_100272882 | 109 |
| 531 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020392 | 109 |
| 532 | 3300035120 | Ga0373957_0155927 | Ga0373957_0155927_59_391 | 109 |
| 533 | 3300035724 | Ga0373933_0294494 | Ga0373933_0294494_375_707 | 109 |
| 534 | 3300036401 | Ga0373937_0515277 | Ga0373937_0515277_400_732 | 109 |
| 535 | 3300046461 | Ga0495641_0000020 | Ga0495641_0000020_18805_19137 | 109 |
| 536 | 3300046511 | Ga0495608_0232570 | Ga0495608_0232570_484_816 | 109 |
| 537 | 3300046517 | Ga0495630_0039472 | Ga0495630_0039472_1716_2048 | 109 |
| 538 | 3300046681 | Ga0495647_0224784 | Ga0495647_0224784_141_473 | 109 |
| 539 | 3300046684 | Ga0495669_0000083 | Ga0495669_0000083_18928_19260 | 109 |
| 540 | 3300046694 | Ga0495649_0000587 | Ga0495649_0000587_20053_20385 | 109 |
| 541 | 3300047322 | Ga0495680_0000671 | Ga0495680_0000671_24652_24984 | 109 |
| 542 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_218586_218918 | 109 |
| 543 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_218586_218918 | 109 |
| 544 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_212725_213057 | 109 |
| 545 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_212727_213059 | 109 |
| 546 | 3300048914 | Ga0496111_0721111 | Ga0496111_0721111_113_445 | 109 |
| 547 | 3300053123 | Ga0500614_000095 | Ga0500614_000095_19885_20217 | 109 |
| 548 | 3300053177 | Ga0500636_0378333 | Ga0500636_0378333_143_475 | 109 |
| 549 | 3300001979 | JGI24740J21852_10008002 | JGI24740J21852_100080022 | 110 |
| 550 | 3300002074 | JGI24748J21848_1001674 | JGI24748J21848_10016742 | 110 |
| 551 | 3300002239 | JGI24034J26672_10000495 | JGI24034J26672_100004954 | 110 |
| 552 | 3300002244 | JGI24742J22300_10010085 | JGI24742J22300_100100852 | 110 |
| 553 | 3300005355 | Ga0070671_100098797 | Ga0070671_1000987973 | 110 |
| 554 | 3300005440 | Ga0070705_101201612 | Ga0070705_1012016122 | 110 |
| 555 | 3300005441 | Ga0070700_100024753 | Ga0070700_1000247533 | 110 |
| 556 | 3300005844 | Ga0068862_100465821 | Ga0068862_1004658212 | 110 |
| 557 | 3300009098 | Ga0105245_10001759 | Ga0105245_1000175921 | 110 |
| 558 | 3300009176 | Ga0105242_10412992 | Ga0105242_104129922 | 110 |
| 559 | 3300009553 | Ga0105249_10213855 | Ga0105249_102138552 | 110 |
| 560 | 3300017792 | Ga0163161_10000018 | Ga0163161_1000001896 | 110 |
| 561 | 3300025900 | Ga0207710_10000779 | Ga0207710_100007792 | 110 |
| 562 | 3300025908 | Ga0207643_10644403 | Ga0207643_106444032 | 110 |
| 563 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004915 | 110 |
| 564 | 3300025927 | Ga0207687_10000133 | Ga0207687_1000013330 | 110 |
| 565 | 3300025927 | Ga0207687_11024762 | Ga0207687_110247622 | 110 |
| 566 | 3300025932 | Ga0207690_10440488 | Ga0207690_104404882 | 110 |
| 567 | 3300025934 | Ga0207686_10003650 | Ga0207686_100036508 | 110 |
| 568 | 3300025934 | Ga0207686_10349399 | Ga0207686_103493992 | 110 |
| 569 | 3300025935 | Ga0207709_10258576 | Ga0207709_102585762 | 110 |
| 570 | 3300025937 | Ga0207669_11049011 | Ga0207669_110490112 | 110 |
| 571 | 3300025938 | Ga0207704_10315989 | Ga0207704_103159892 | 110 |
| 572 | 3300025961 | Ga0207712_10214096 | Ga0207712_102140962 | 110 |
| 573 | 3300026075 | Ga0207708_10013078 | Ga0207708_100130785 | 110 |
| 574 | 3300028380 | Ga0268265_11367494 | Ga0268265_113674942 | 110 |
| 575 | 3300031251 | Ga0265327_10157893 | Ga0265327_101578932 | 110 |
| 576 | 3300045976 | Ga0466967_0579352 | Ga0466967_0579352_189_524 | 110 |
| 577 | 3300046642 | Ga0495634_0050593 | Ga0495634_0050593_2222_2557 | 110 |
| 578 | 3300046678 | Ga0495599_0014958 | Ga0495599_0014958_4293_4628 | 110 |
| 579 | 3300048088 | Ga0495602_0320781 | Ga0495602_0320781_296_631 | 110 |
| 580 | 3300048903 | Ga0496100_1409212 | Ga0496100_1409212_58_393 | 110 |
| 581 | 3300048913 | Ga0496110_0043093 | Ga0496110_0043093_3518_3853 | 110 |
| 582 | 3300053077 | Ga0495601_0000196 | Ga0495601_0000196_9770_10105 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pug-assembly2.cif.gz_C | structure of e. coli ybab | 0.875 | 22 | 100 |
| 1ybx-assembly1.cif.gz_A | conserved hypothetical protein cth-383 from clostridium thermocellum | 0.8687 | 13 | 101 |
| 3f42-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein hp0035 from helicobacter pylori | 0.8685 | 9 | 102 |
| 6r5y-assembly3.cif.gz_E | 8-bladed beta-propeller formed by two 4-bladed fragments | 0.8546 | 36 | 63 |
| 1pug-assembly2.cif.gz_D | structure of e. coli ybab | 0.8542 | 27 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O82230_71_179_3.30.1310.10 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8667 | 11 | 106 | 3.30.1310.10 |
| af_P0A8B5_1_109_3.30.1310.10 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8623 | 12 | 104 | 3.30.1310.10 |
| 1ybxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8573 | 13 | 101 | 3.30.1310.10 |
| 5yrxA00 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8457 | 28 | 95 | 3.30.1310.10 |
| af_P9WNR9_2_108_3.30.1310.10 | Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain | 0.8365 | 6 | 104 | 3.30.1310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832LQG7-F1-model_v4 | Nucleoid-associated protein ENS20_05105 | 0.9867 | 11 | 106 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A1G3CGR1-F1-model_v4 | Nucleoid-associated protein, YbaB/EbfC family | 0.9745 | 12 | 99 |
GO:0003677
GO:0005829 |
| AF-A0A7V2KTR4-F1-model_v4 | Nucleoid-associated protein G4O10_03575 | 0.9711 | 14 | 104 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A6L7X336-F1-model_v4 | Nucleoid-associated protein F4Y02_10920 | 0.9704 | 16 | 105 |
GO:0003677
GO:0005829 GO:0043590 |
| AF-A0A271J7F5-F1-model_v4 | Nucleoid-associated protein B1759_12995 | 0.9685 | 8 | 104 |
GO:0003677
GO:0005829 GO:0043590 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar