F466138

General Info

Members Datasets Scaffolds Average Seq Length
582 291 582 103

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_101686299|Ga0070661_1016862991
Length 115
Sequence VARGGGPGGFDVNALMKQAQQMQADMLEAQEKLKDEVVEASAGGGMVKVKMGGDLTLREIVIDPEAVDPEEAEMLAEMVQAAVNEGLRAAQELAAARMGGLTGGMDLGGLGLPGF

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 10.14
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008002 3300001979 Bacteria 4251
2 JGI24748J21848_1001674 3300002074 Bacteria 2470
3 JGI24034J26672_10000495 3300002239 Bacteria 5101
4 JGI24742J22300_10010085 3300002244 Bacteria 1561
5 JGI25407J50210_10056006 3300003373 Bacteria 994
6 JGI25407J50210_10103213 3300003373 Bacteria 704
7 Ga0070658_10051144 3300005327 Bacteria 3349
8 Ga0070683_100004015 3300005329 Bacteria 12046
9 Ga0070670_100191170 3300005331 Bacteria 1778
10 Ga0070677_10000013 3300005333 Bacteria 53677
11 Ga0070680_100115046 3300005336 Bacteria 2241
12 Ga0070682_100001328 3300005337 Bacteria 13995
13 Ga0068868_100000467 3300005338 Bacteria 26933
14 Ga0068868_100005792 3300005338 Bacteria 8707
15 Ga0070691_10000014 3300005341 Bacteria 50487
16 Ga0070691_10000822 3300005341 Bacteria 12463
17 Ga0070661_101686299 3300005344 Bacteria 537
18 Ga0070675_100000008 3300005354 Bacteria 250004
19 Ga0070671_100098797 3300005355 Bacteria 2448
20 Ga0070674_100000103 3300005356 Bacteria 39432
21 Ga0070674_100185884 3300005356 Bacteria 1595
22 Ga0070673_100004180 3300005364 Bacteria 9107
23 Ga0070659_102068170 3300005366 Bacteria 512
24 Ga0070667_100395819 3300005367 Bacteria 1257
25 Ga0070703_10055819 3300005406 Bacteria 1277
26 Ga0070714_100100082 3300005435 Bacteria 2552
27 Ga0070714_100151292 3300005435 Bacteria 2091
28 Ga0070714_100537636 3300005435 Bacteria 1118
29 Ga0070713_100000143 3300005436 Bacteria 47475
30 Ga0070713_100062738 3300005436 Bacteria 3113
31 Ga0070713_100127885 3300005436 Bacteria 2237
32 Ga0070713_100156215 3300005436 Bacteria 2033
33 Ga0070710_10183800 3300005437 Bacteria 1310
34 Ga0070710_10344530 3300005437 Bacteria 985
35 Ga0070710_11288732 3300005437 Bacteria 543
36 Ga0070701_10338851 3300005438 Bacteria 936
37 Ga0070711_100005366 3300005439 Bacteria 7665
38 Ga0070711_100111202 3300005439 Bacteria 2011
39 Ga0070705_100390979 3300005440 Bacteria 1027
40 Ga0070705_101201612 3300005440 Bacteria 625
41 Ga0070705_101266438 3300005440 Bacteria 610
42 Ga0070700_100024753 3300005441 Bacteria 3529
43 Ga0070700_100557734 3300005441 Bacteria 891
44 Ga0070694_100815211 3300005444 Bacteria 766
45 Ga0070708_101703830 3300005445 Bacteria 586
46 Ga0070678_100007193 3300005456 Bacteria 6586
47 Ga0070678_100120545 3300005456 Bacteria 2068
48 Ga0070678_100714791 3300005456 Bacteria 904
49 Ga0070662_100000015 3300005457 Bacteria 109379
50 Ga0070662_101165251 3300005457 Bacteria 662
51 Ga0070681_10372816 3300005458 Bacteria 1338
52 Ga0070685_10000037 3300005466 Bacteria 80557
53 Ga0070699_100329033 3300005518 Bacteria 1374
54 Ga0070679_100000069 3300005530 Bacteria 76557
55 Ga0070684_100003643 3300005535 Bacteria 11612
56 Ga0070684_100423061 3300005535 Unclassified 1230
57 Ga0070684_100868178 3300005535 Bacteria 845
58 Ga0068853_100001637 3300005539 Bacteria 16375
59 Ga0068853_100609239 3300005539 Unclassified 1037
60 Ga0070672_100000175 3300005543 Bacteria 35613
61 Ga0070695_100182208 3300005545 Bacteria 1489
62 Ga0070695_100808184 3300005545 Bacteria 752
63 Ga0070696_101062770 3300005546 Bacteria 679
64 Ga0070693_100069509 3300005547 Bacteria 2070
65 Ga0070665_100000068 3300005548 Bacteria 204531
66 Ga0070704_100166641 3300005549 Bacteria 1748
67 Ga0070704_100290823 3300005549 Bacteria 1357
68 Ga0070704_100888652 3300005549 Unclassified 801
69 Ga0068855_100122747 3300005563 Bacteria 2972
70 Ga0070664_100033581 3300005564 Bacteria 4299
71 Ga0070664_100084303 3300005564 Bacteria 2743
72 Ga0068854_100000472 3300005578 Bacteria 24819
73 Ga0068854_100006598 3300005578 Bacteria 7391
74 Ga0068856_100000210 3300005614 Bacteria 63036
75 Ga0068856_100198127 3300005614 Bacteria 2023
76 Ga0068852_100000005 3300005616 Bacteria 173127
77 Ga0068866_10000014 3300005718 Bacteria 72482
78 Ga0068866_10356661 3300005718 Bacteria 931
79 Ga0068861_100306856 3300005719 Bacteria 1377
80 Ga0068851_10008803 3300005834 Bacteria 4677
81 Ga0068851_10107455 3300005834 Bacteria 1486
82 Ga0068863_100000136 3300005841 Bacteria 78102
83 Ga0068863_101612749 3300005841 Bacteria 658
84 Ga0068858_100001203 3300005842 Bacteria 26823
85 Ga0068862_100465821 3300005844 Bacteria 1194
86 Ga0068862_100783918 3300005844 Bacteria 930
87 Ga0068862_100995203 3300005844 Bacteria 829
88 Ga0081455_10635492 3300005937 Bacteria 690
89 Ga0081538_10000117 3300005981 Bacteria 79475
90 Ga0081538_10001766 3300005981 Bacteria 21872
91 Ga0081538_10018805 3300005981 Bacteria 5167
92 Ga0081540_1000296 3300005983 Bacteria 51895
93 Ga0081540_1116131 3300005983 Bacteria 1120
94 Ga0070717_10593545 3300006028 Bacteria 1004
95 Ga0075365_10985650 3300006038 Bacteria 594
96 Ga0075363_100245526 3300006048 Bacteria 1030
97 Ga0075363_100454380 3300006048 Bacteria 757
98 Ga0070715_10000011 3300006163 Bacteria 183857
99 Ga0070715_10026203 3300006163 Bacteria 2317
100 Ga0070712_100071610 3300006175 Bacteria 2481
101 Ga0070712_100195741 3300006175 Bacteria 1585
102 Ga0075367_10371701 3300006178 Bacteria 903
103 Ga0075431_100314659 3300006847 Bacteria 1580
104 Ga0075433_10000968 3300006852 Bacteria 20370
105 Ga0075434_100018827 3300006871 Bacteria 6673
106 Ga0075434_100050514 3300006871 Bacteria 4131
107 Ga0075434_100623852 3300006871 Bacteria 1097
108 Ga0075429_101025444 3300006880 Bacteria 721
109 Ga0068865_100000019 3300006881 Bacteria 105996
110 Ga0075436_100860605 3300006914 Bacteria 677
111 Ga0075435_100369786 3300007076 Bacteria 1231
112 Ga0105240_11502154 3300009093 Bacteria 706
113 Ga0111539_11020942 3300009094 Bacteria 961
114 Ga0111539_12529594 3300009094 Bacteria 595
115 Ga0105245_10000012 3300009098 Bacteria 267151
116 Ga0105245_10000667 3300009098 Bacteria 31104
117 Ga0105245_10001759 3300009098 Bacteria 19752
118 Ga0105245_10030985 3300009098 Bacteria 4731
119 Ga0105245_10573452 3300009098 Bacteria 1152
120 Ga0105245_11221967 3300009098 Bacteria 800
121 Ga0105247_10000204 3300009101 Bacteria 58153
122 Ga0105247_11519502 3300009101 Bacteria 547
123 Ga0114129_10327426 3300009147 Bacteria 2035
124 Ga0114129_10853789 3300009147 Bacteria 1157
125 Ga0114129_12164329 3300009147 Bacteria 670
126 Ga0114129_13087777 3300009147 Bacteria 545
127 Ga0105243_10016685 3300009148 Bacteria 5552
128 Ga0105243_10268359 3300009148 Bacteria 1531
129 Ga0105243_10816183 3300009148 Bacteria 921
130 Ga0105243_10865630 3300009148 Bacteria 896
131 Ga0105242_10002841 3300009176 Bacteria 13567
132 Ga0105242_10156325 3300009176 Bacteria 1992
133 Ga0105242_10283626 3300009176 Bacteria 1505
134 Ga0105242_10412992 3300009176 Bacteria 1263
135 Ga0105242_10772199 3300009176 Bacteria 948
136 Ga0105242_10996001 3300009176 Bacteria 845
137 Ga0105242_11546418 3300009176 Bacteria 695
138 Ga0105248_10000126 3300009177 Bacteria 88461
139 Ga0105237_11558407 3300009545 Bacteria 668
140 Ga0105238_10000172 3300009551 Bacteria 70799
141 Ga0105238_10509577 3300009551 Bacteria 1205
142 Ga0105249_10000235 3300009553 Bacteria 62630
143 Ga0105249_10213855 3300009553 Bacteria 1893
144 Ga0105249_10658074 3300009553 Bacteria 1105
145 Ga0105239_10190013 3300010375 Bacteria 2299
146 Ga0105239_10308314 3300010375 Bacteria 1784
147 Ga0105239_12273443 3300010375 Unclassified 631
148 Ga0105246_10599369 3300011119 Bacteria 952
149 Ga0157335_1033844 3300012492 Bacteria 548
150 Ga0157370_10447022 3300013104 Bacteria 1188
151 Ga0157369_10000135 3300013105 Bacteria 105364
152 Ga0157374_10006572 3300013296 Bacteria 9872
153 Ga0157374_10412766 3300013296 Bacteria 1348
154 Ga0157374_10815831 3300013296 Bacteria 949
155 Ga0157378_10039519 3300013297 Bacteria 4185
156 Ga0157378_10403833 3300013297 Bacteria 1347
157 Ga0163162_12915588 3300013306 Bacteria 550
158 Ga0157372_11005891 3300013307 Bacteria 965
159 Ga0157372_11092036 3300013307 Bacteria 923
160 Ga0157375_10028002 3300013308 Bacteria 5275
161 Ga0157375_10225641 3300013308 Bacteria 2032
162 Ga0157375_10470767 3300013308 Unclassified 1422
163 Ga0163163_10140552 3300014325 Bacteria 2457
164 Ga0157380_10000009 3300014326 Bacteria 142155
165 Ga0157380_10000550 3300014326 Bacteria 23107
166 Ga0157379_10011591 3300014968 Bacteria 7698
167 Ga0157379_10368454 3300014968 Bacteria 1317
168 Ga0157376_11778251 3300014969 Bacteria 652
169 Ga0163161_10000018 3300017792 Bacteria 228801
170 Ga0163161_10201205 3300017792 Bacteria 1535
171 Ga0163161_10370902 3300017792 Bacteria 1142
172 Ga0206351_10054906 3300020077 Bacteria 652
173 Ga0206351_10998395 3300020077 Bacteria 854
174 Ga0206354_10737789 3300020081 Bacteria 2004
175 Ga0206353_11079496 3300020082 Unclassified 1218
176 Ga0213876_10024920 3300021384 Bacteria 3159
177 Ga0224712_10101873 3300022467 Unclassified 1219
178 Ga0207656_10000105 3300025321 Bacteria 31356
179 Ga0207656_10024930 3300025321 Bacteria 2424
180 Ga0207653_10038166 3300025885 Bacteria 1569
181 Ga0207682_10000038 3300025893 Bacteria 53885
182 Ga0207692_10217280 3300025898 Bacteria 1131
183 Ga0207692_10421453 3300025898 Bacteria 836
184 Ga0207642_10000001 3300025899 Bacteria 714030
185 Ga0207642_10361158 3300025899 Bacteria 859
186 Ga0207710_10000779 3300025900 Bacteria 17364
187 Ga0207685_10000001 3300025905 Bacteria 604473
188 Ga0207685_10017389 3300025905 Bacteria 2323
189 Ga0207643_10644403 3300025908 Unclassified 683
190 Ga0207705_10041343 3300025909 Bacteria 3308
191 Ga0207707_10051034 3300025912 Bacteria 3602
192 Ga0207695_11220675 3300025913 Bacteria 632
193 Ga0207693_10012806 3300025915 Bacteria 6766
194 Ga0207693_10081364 3300025915 Bacteria 2535
195 Ga0207693_10323798 3300025915 Bacteria 1207
196 Ga0207693_10674134 3300025915 Bacteria 802
197 Ga0207663_10000854 3300025916 Bacteria 13844
198 Ga0207663_10061520 3300025916 Bacteria 2383
199 Ga0207663_10078734 3300025916 Bacteria 2150
200 Ga0207663_10080907 3300025916 Bacteria 2126
201 Ga0207663_10150273 3300025916 Bacteria 1633
202 Ga0207660_10097128 3300025917 Bacteria 2194
203 Ga0207652_10000142 3300025921 Bacteria 76696
204 Ga0207681_10116366 3300025923 Bacteria 1953
205 Ga0207694_10000004 3300025924 Bacteria 967075
206 Ga0207650_10082055 3300025925 Bacteria 2447
207 Ga0207659_10000014 3300025926 Bacteria 168481
208 Ga0207687_10000011 3300025927 Bacteria 388349
209 Ga0207687_10000037 3300025927 Bacteria 120493
210 Ga0207687_10000133 3300025927 Bacteria 49874
211 Ga0207687_10021630 3300025927 Bacteria 4275
212 Ga0207687_10309073 3300025927 Bacteria 1276
213 Ga0207687_11024762 3300025927 Bacteria 708
214 Ga0207700_10000008 3300025928 Bacteria 341717
215 Ga0207700_11657082 3300025928 Bacteria 565
216 Ga0207700_11807639 3300025928 Bacteria 537
217 Ga0207664_10078184 3300025929 Bacteria 2683
218 Ga0207664_10082112 3300025929 Bacteria 2624
219 Ga0207664_11078611 3300025929 Unclassified 718
220 Ga0207664_11995040 3300025929 Bacteria 503
221 Ga0207690_10440488 3300025932 Bacteria 1045
222 Ga0207706_10000062 3300025933 Bacteria 109344
223 Ga0207686_10003650 3300025934 Bacteria 8248
224 Ga0207686_10047518 3300025934 Bacteria 2654
225 Ga0207686_10349399 3300025934 Bacteria 1113
226 Ga0207686_10427879 3300025934 Bacteria 1014
227 Ga0207709_10011143 3300025935 Bacteria 4958
228 Ga0207709_10258576 3300025935 Bacteria 1275
229 Ga0207709_10619629 3300025935 Bacteria 858
230 Ga0207669_10000115 3300025937 Bacteria 40041
231 Ga0207669_11049011 3300025937 Bacteria 686
232 Ga0207669_11842249 3300025937 Bacteria 517
233 Ga0207704_10000009 3300025938 Bacteria 198266
234 Ga0207704_10315989 3300025938 Bacteria 1203
235 Ga0207665_10374127 3300025939 Bacteria 1080
236 Ga0207665_10396645 3300025939 Bacteria 1050
237 Ga0207691_10000609 3300025940 Bacteria 35618
238 Ga0207711_10000024 3300025941 Bacteria 293596
239 Ga0207661_10001063 3300025944 Bacteria 18265
240 Ga0207661_10811227 3300025944 Bacteria 861
241 Ga0207679_10025338 3300025945 Bacteria 4077
242 Ga0207679_10246740 3300025945 Bacteria 1516
243 Ga0207667_11041123 3300025949 Bacteria 804
244 Ga0207651_10001295 3300025960 Bacteria 11260
245 Ga0207651_11226127 3300025960 Bacteria 674
246 Ga0207712_10000037 3300025961 Bacteria 195906
247 Ga0207712_10214096 3300025961 Bacteria 1536
248 Ga0207712_10596440 3300025961 Bacteria 955
249 Ga0207668_10040497 3300025972 Bacteria 3144
250 Ga0207668_10906109 3300025972 Bacteria 785
251 Ga0207640_10000125 3300025981 Bacteria 58750
252 Ga0207640_10052356 3300025981 Bacteria 2659
253 Ga0207658_10151095 3300025986 Bacteria 1892
254 Ga0207677_10000464 3300026023 Bacteria 27017
255 Ga0207677_10012618 3300026023 Bacteria 4866
256 Ga0207703_10000128 3300026035 Bacteria 91359
257 Ga0207703_10000237 3300026035 Bacteria 62874
258 Ga0207639_10003793 3300026041 Bacteria 10171
259 Ga0207708_10013078 3300026075 Bacteria 6194
260 Ga0207708_10551197 3300026075 Bacteria 972
261 Ga0207702_10001764 3300026078 Bacteria 21273
262 Ga0207702_10025507 3300026078 Bacteria 4906
263 Ga0207702_10053419 3300026078 Bacteria 3420
264 Ga0207702_10737985 3300026078 Bacteria 972
265 Ga0207702_11427537 3300026078 Bacteria 686
266 Ga0207641_10000265 3300026088 Bacteria 66346
267 Ga0207676_10000048 3300026095 Bacteria 147853
268 Ga0207675_100481936 3300026118 Bacteria 1233
269 Ga0207675_101817799 3300026118 Bacteria 628
270 Ga0207683_10027288 3300026121 Bacteria 4934
271 Ga0207683_10118949 3300026121 Bacteria 2370
272 Ga0207698_10000038 3300026142 Bacteria 101918
273 Ga0207428_10053357 3300027907 Bacteria 3224
274 Ga0268266_10000020 3300028379 Bacteria 527065
275 Ga0268266_11006555 3300028379 Bacteria 806
276 Ga0268265_10746971 3300028380 Bacteria 949
277 Ga0268265_11367494 3300028380 Bacteria 709
278 Ga0268264_10013507 3300028381 Bacteria 6725
279 Ga0268264_11827001 3300028381 Bacteria 618
280 Ga0307511_10082567 3300030521 Bacteria 2246
281 Ga0265327_10157893 3300031251 Bacteria 1050
282 Ga0307410_11005653 3300031852 Bacteria 719
283 Ga0307406_10021145 3300031901 Bacteria 3845
284 Ga0307409_100190126 3300031995 Bacteria 1827
285 Ga0307409_102834841 3300031995 Bacteria 512
286 Ga0307416_100468343 3300032002 Bacteria 1317
287 Ga0307415_100273051 3300032126 Bacteria 1386
288 Ga0307415_101001235 3300032126 Bacteria 777
289 Ga0373949_0107428 3300035090 Bacteria 771
290 Ga0373957_0155927 3300035120 Bacteria 939
291 Ga0373935_0426195 3300035692 Bacteria 956
292 Ga0373933_0294494 3300035724 Bacteria 1050
293 Ga0373933_0638816 3300035724 Bacteria 699
294 Ga0373933_1011580 3300035724 Bacteria 547
295 Ga0373937_0342658 3300036401 Bacteria 1415
296 Ga0373937_0515277 3300036401 Bacteria 1136
297 Ga0373937_0724274 3300036401 Bacteria 942
298 Ga0373937_1970998 3300036401 Bacteria 530
299 Ga0395900_0951222 3300037418 Unclassified 780
300 Ga0395898_0018653 3300037466 Bacteria 7072
301 Ga0395898_0918307 3300037466 Bacteria 813
302 Ga0395905_0036867 3300037471 Bacteria 4592
303 Ga0436364_0072171 3300037853 Bacteria 1468
304 Ga0436364_0139100 3300037853 Bacteria 1395
305 Ga0436364_0167671 3300037853 Bacteria 7029
306 Ga0395901_0205495 3300038443 Bacteria 2063
307 Ga0436365_0105231 3300039437 Bacteria 1490
308 Ga0436365_0332771 3300039437 Bacteria 1862
309 Ga0436365_0342589 3300039437 Bacteria 1955
310 Ga0436365_0924437 3300039437 Bacteria 1280
311 Ga0436365_0969934 3300039437 Bacteria 6774
312 Ga0436365_1481750 3300039437 Bacteria 1227
313 Ga0436365_1607371 3300039437 Bacteria 2478
314 Ga0436365_1934953 3300039437 Bacteria 742
315 Ga0436363_1638120 3300039450 Bacteria 1010
316 Ga0436362_0120799 3300039453 Bacteria 885
317 Ga0436362_0337191 3300039453 Bacteria 874
318 Ga0436362_0451879 3300039453 Bacteria 776
319 Ga0451791_1132480 3300041451 Bacteria 670
320 Ga0466966_0046490 3300044684 Bacteria 2771
321 Ga0466961_0141061 3300044693 Bacteria 1509
322 Ga0466963_0000585 3300044694 Bacteria 17350
323 Ga0466963_1011281 3300044694 Bacteria 585
324 Ga0466957_0493651 3300044842 Bacteria 848
325 Ga0466959_0084849 3300045049 Bacteria 2280
326 Ga0466959_0323584 3300045049 Bacteria 1054
327 Ga0466958_0036126 3300045836 Bacteria 2956
328 Ga0466958_0380464 3300045836 Bacteria 910
329 Ga0466967_0000005 3300045976 Bacteria 149543
330 Ga0466967_0566402 3300045976 Bacteria 1119
331 Ga0466967_0579352 3300045976 Bacteria 1106
332 Ga0466967_0803306 3300045976 Bacteria 934
333 Ga0466967_2009051 3300045976 Unclassified 575
334 Ga0495592_0000600 3300046454 Bacteria 25385
335 Ga0495592_0623949 3300046454 Unclassified 655
336 Ga0495592_0626723 3300046454 Bacteria 653
337 Ga0495603_0001152 3300046455 Bacteria 15404
338 Ga0495603_0007750 3300046455 Bacteria 6471
339 Ga0495629_0000055 3300046459 Bacteria 105268
340 Ga0495629_0096664 3300046459 Bacteria 2060
341 Ga0495638_0008356 3300046460 Bacteria 7342
342 Ga0495641_0000020 3300046461 Bacteria 115404
343 Ga0495641_0110749 3300046461 Bacteria 1225
344 Ga0495641_0142995 3300046461 Bacteria 1069
345 Ga0495641_0147257 3300046461 Bacteria 1052
346 Ga0495641_0161307 3300046461 Bacteria 1003
347 Ga0495651_0094152 3300046462 Bacteria 2242
348 Ga0495653_0147655 3300046463 Bacteria 1646
349 Ga0495653_0190870 3300046463 Bacteria 1398
350 Ga0495653_0237721 3300046463 Bacteria 1216
351 Ga0495653_0240166 3300046463 Bacteria 1208
352 Ga0495653_0279029 3300046463 Bacteria 1097
353 Ga0495653_0326368 3300046463 Bacteria 993
354 Ga0495582_0000013 3300046473 Bacteria 110372
355 Ga0495582_0199127 3300046473 Bacteria 1144
356 Ga0495639_0647172 3300046475 Bacteria 545
357 Ga0495662_0000021 3300046476 Bacteria 54969
358 Ga0495594_0100615 3300046499 Bacteria 1626
359 Ga0495606_0000057 3300046507 Bacteria 197956
360 Ga0495608_0003895 3300046511 Bacteria 10729
361 Ga0495608_0199396 3300046511 Bacteria 1261
362 Ga0495608_0232570 3300046511 Bacteria 1153
363 Ga0495608_0272156 3300046511 Bacteria 1053
364 Ga0495618_0000058 3300046514 Bacteria 79638
365 Ga0495618_0368346 3300046514 Bacteria 883
366 Ga0495620_0002330 3300046515 Bacteria 11010
367 Ga0495620_0357101 3300046515 Bacteria 554
368 Ga0495628_0004164 3300046516 Bacteria 12871
369 Ga0495628_0318871 3300046516 Unclassified 1147
370 Ga0495628_0441424 3300046516 Bacteria 946
371 Ga0495628_0711775 3300046516 Unclassified 708
372 Ga0495630_0001432 3300046517 Bacteria 16529
373 Ga0495630_0002139 3300046517 Bacteria 13744
374 Ga0495630_0039472 3300046517 Bacteria 3529
375 Ga0495630_0319808 3300046517 Bacteria 1186
376 Ga0495637_0188004 3300046520 Bacteria 763
377 Ga0495644_0000693 3300046523 Bacteria 13956
378 Ga0495644_0052692 3300046523 Bacteria 1528
379 Ga0495652_0017506 3300046529 Bacteria 6394
380 Ga0495652_0052526 3300046529 Bacteria 3476
381 Ga0495665_0531549 3300046531 Bacteria 591
382 Ga0495640_0054649 3300046533 Bacteria 2734
383 Ga0495640_0231582 3300046533 Bacteria 1162
384 Ga0495586_0004843 3300046535 Bacteria 7199
385 Ga0495586_0837277 3300046535 Bacteria 530
386 Ga0495587_0025864 3300046536 Bacteria 3583
387 Ga0495587_0070521 3300046536 Bacteria 2034
388 Ga0495598_0030761 3300046537 Bacteria 1506
389 Ga0495621_0002316 3300046539 Bacteria 5108
390 Ga0495621_0180503 3300046539 Bacteria 842
391 Ga0495645_0078054 3300046543 Bacteria 2380
392 Ga0495667_0267512 3300046559 Bacteria 1086
393 Ga0495634_0000601 3300046642 Bacteria 34818
394 Ga0495634_0050593 3300046642 Bacteria 2789
395 Ga0495634_0142741 3300046642 Bacteria 1519
396 Ga0495634_0184236 3300046642 Bacteria 1306
397 Ga0495634_0199482 3300046642 Bacteria 1243
398 Ga0495634_0352161 3300046642 Bacteria 881
399 Ga0495635_0000026 3300046663 Bacteria 142517
400 Ga0495635_0155880 3300046663 Bacteria 1554
401 Ga0495635_0246643 3300046663 Bacteria 1204
402 Ga0495588_0097004 3300046674 Bacteria 1547
403 Ga0495657_0024223 3300046675 Bacteria 4326
404 Ga0495657_0043883 3300046675 Bacteria 3045
405 Ga0495657_0102165 3300046675 Bacteria 1825
406 Ga0495599_0014958 3300046678 Bacteria 4809
407 Ga0495623_0499592 3300046679 Bacteria 642
408 Ga0495646_0443048 3300046680 Bacteria 671
409 Ga0495646_0524932 3300046680 Bacteria 606
410 Ga0495647_0000027 3300046681 Bacteria 58315
411 Ga0495647_0030918 3300046681 Bacteria 1989
412 Ga0495647_0032972 3300046681 Bacteria 1934
413 Ga0495647_0224784 3300046681 Bacteria 829
414 Ga0495658_0000009 3300046683 Bacteria 110421
415 Ga0495658_0092210 3300046683 Bacteria 1795
416 Ga0495658_0235027 3300046683 Bacteria 1150
417 Ga0495669_0000083 3300046684 Bacteria 62876
418 Ga0495669_0000823 3300046684 Bacteria 13221
419 Ga0495613_0000364 3300046689 Bacteria 39475
420 Ga0495613_0099944 3300046689 Bacteria 2096
421 Ga0495613_0497443 3300046689 Bacteria 821
422 Ga0495624_0000012 3300046690 Bacteria 124128
423 Ga0495624_0430041 3300046690 Bacteria 791
424 Ga0495624_0701847 3300046690 Bacteria 601
425 Ga0495670_0162571 3300046691 Unclassified 1173
426 Ga0495649_0000587 3300046694 Bacteria 30555
427 Ga0495600_0023432 3300046809 Bacteria 3972
428 Ga0495600_0832962 3300046809 Bacteria 548
429 Ga0495581_0392992 3300047315 Bacteria 809
430 Ga0495604_0000413 3300047317 Bacteria 38567
431 Ga0495604_0141086 3300047317 Bacteria 1721
432 Ga0495604_0550801 3300047317 Bacteria 744
433 Ga0495674_0687050 3300047319 Unclassified 804
434 Ga0495674_0823518 3300047319 Unclassified 721
435 Ga0495672_0100485 3300047320 Bacteria 1570
436 Ga0495672_0125181 3300047320 Unclassified 1360
437 Ga0495676_0001347 3300047321 Bacteria 21095
438 Ga0495676_0356953 3300047321 Bacteria 976
439 Ga0495680_0000407 3300047322 Bacteria 48143
440 Ga0495680_0000671 3300047322 Bacteria 38307
441 Ga0495680_0033973 3300047322 Bacteria 4126
442 Ga0495680_0190588 3300047322 Bacteria 1475
443 Ga0495680_0599018 3300047322 Bacteria 738
444 Ga0495675_0082909 3300047444 Bacteria 2019
445 Ga0495675_0231539 3300047444 Bacteria 1115
446 Ga0495673_0120790 3300047469 Bacteria 1038
447 Ga0495684_0289152 3300047471 Bacteria 1180
448 Ga0495593_0067439 3300047673 Bacteria 1863
449 Ga0495593_0083427 3300047673 Bacteria 1651
450 Ga0495593_0141678 3300047673 Bacteria 1218
451 Ga0495593_0170552 3300047673 Bacteria 1097
452 Ga0495593_0374253 3300047673 Bacteria 712
453 Ga0495602_0320781 3300048088 Bacteria 1127
454 Ga0496100_0000007 3300048903 Bacteria 261266
455 Ga0496100_0008714 3300048903 Bacteria 5667
456 Ga0496100_1409212 3300048903 Bacteria 550
457 Ga0496101_0000013 3300048904 Bacteria 261266
458 Ga0496101_0011624 3300048904 Bacteria 5847
459 Ga0496101_1503897 3300048904 Bacteria 524
460 Ga0496102_0853204 3300048905 Unclassified 833
461 Ga0496102_0963234 3300048905 Bacteria 774
462 Ga0496102_1485839 3300048905 Bacteria 596
463 Ga0496104_0000002 3300048907 Bacteria 686017
464 Ga0496104_0000013 3300048907 Bacteria 397163
465 Ga0496104_0002173 3300048907 Bacteria 17015
466 Ga0496104_0340318 3300048907 Bacteria 1413
467 Ga0496104_0376206 3300048907 Bacteria 1333
468 Ga0496105_0000001 3300048908 Bacteria 1328178
469 Ga0496105_0000006 3300048908 Bacteria 393578
470 Ga0496105_0029466 3300048908 Bacteria 4492
471 Ga0496105_0093363 3300048908 Bacteria 2485
472 Ga0496105_0127713 3300048908 Bacteria 2096
473 Ga0496105_0890830 3300048908 Bacteria 671
474 Ga0496106_0000006 3300048909 Bacteria 251855
475 Ga0496106_0000174 3300048909 Bacteria 46312
476 Ga0496106_0723823 3300048909 Bacteria 792
477 Ga0496107_0000007 3300048910 Bacteria 257113
478 Ga0496107_0200961 3300048910 Bacteria 1481
479 Ga0496107_0366400 3300048910 Bacteria 1072
480 Ga0496107_0930233 3300048910 Bacteria 633
481 Ga0496108_0000001 3300048911 Bacteria 919044
482 Ga0496108_0000080 3300048911 Bacteria 102267
483 Ga0496109_0000006 3300048912 Bacteria 325513
484 Ga0496109_0000024 3300048912 Bacteria 174723
485 Ga0496109_0231309 3300048912 Bacteria 1739
486 Ga0496109_0681031 3300048912 Bacteria 966
487 Ga0496110_0004843 3300048913 Bacteria 10494
488 Ga0496110_0043093 3300048913 Bacteria 3940
489 Ga0496110_0148516 3300048913 Bacteria 2121
490 Ga0496110_0345073 3300048913 Bacteria 1356
491 Ga0496110_0614598 3300048913 Unclassified 985
492 Ga0496110_0933214 3300048913 Bacteria 774
493 Ga0496110_1017693 3300048913 Bacteria 736
494 Ga0496111_0002803 3300048914 Bacteria 10617
495 Ga0496111_0387065 3300048914 Bacteria 1034
496 Ga0496111_0517110 3300048914 Bacteria 878
497 Ga0496111_0691935 3300048914 Bacteria 742
498 Ga0496111_0721111 3300048914 Bacteria 724
499 Ga0496111_1170358 3300048914 Bacteria 546
500 Ga0496112_0000003 3300048915 Bacteria 660147
501 Ga0496112_0000857 3300048915 Bacteria 21732
502 Ga0496112_0658969 3300048915 Bacteria 976
503 Ga0496112_0814475 3300048915 Bacteria 858
504 Ga0496112_1752647 3300048915 Bacteria 533
505 Ga0496113_0129070 3300048916 Bacteria 1982
506 Ga0496113_0321739 3300048916 Bacteria 1240
507 Ga0496114_0000003 3300048917 Bacteria 630981
508 Ga0496115_0000034 3300048918 Bacteria 135380
509 Ga0496115_0000071 3300048918 Bacteria 91922
510 Ga0496115_0326693 3300048918 Bacteria 1254
511 Ga0496115_0857334 3300048918 Unclassified 703
512 Ga0496119_0055607 3300048922 Bacteria 2403
513 Ga0496120_0057798 3300048923 Bacteria 2181
514 Ga0496123_0230959 3300048926 Bacteria 926
515 Ga0496124_0198356 3300048927 Bacteria 1529
516 Ga0496125_0082765 3300048928 Bacteria 2445
517 Ga0501039_0579492 3300049575 Bacteria 880
518 Ga0501039_1030687 3300049575 Bacteria 639
519 Ga0501041_0174114 3300049577 Bacteria 1347
520 Ga0501042_0033618 3300049578 Bacteria 3635
521 Ga0501067_0507740 3300049583 Bacteria 674
522 Ga0501069_0354333 3300049585 Bacteria 865
523 Ga0501070_0061389 3300049586 Bacteria 3114
524 Ga0501071_0473303 3300049587 Bacteria 960
525 Ga0501071_0589524 3300049587 Bacteria 854
526 Ga0501071_0655002 3300049587 Bacteria 808
527 Ga0501072_0102580 3300049588 Bacteria 2274
528 Ga0501072_0641590 3300049588 Bacteria 836
529 Ga0501074_0082466 3300049590 Bacteria 2306
530 Ga0501075_0213138 3300049591 Bacteria 1473
531 Ga0501076_1489937 3300049592 Bacteria 556
532 Ga0501077_0198381 3300049593 Bacteria 1275
533 Ga0501079_0307560 3300049741 Bacteria 1240
534 Ga0501079_1044261 3300049741 Bacteria 644
535 Ga0501079_1230804 3300049741 Unclassified 590
536 Ga0501081_0452393 3300049743 Bacteria 954
537 nmdc:mga00v17_334606_c1 3300050491 Bacteria 984
538 nmdc:mga06z11_535025_c1 3300050494 Bacteria 711
539 nmdc:mga05p37_1891672_c1 3300050507 Bacteria 570
540 nmdc:mga05p37_556183_c1 3300050507 Bacteria 1305
541 nmdc:mga05p37_73843_c1 3300050507 Bacteria 2435
542 nmdc:mga05p37_8570_c1 3300050507 Bacteria 12088
543 nmdc:mga09592_345171_c1 3300050508 Bacteria 1289
544 nmdc:mga0qj67_848261_c1 3300050509 Bacteria 722
545 nmdc:mga06r32_173360_c1 3300050510 Bacteria 2141
546 nmdc:mga06r32_49041_c1 3300050510 Bacteria 4038
547 nmdc:mga08y16_1891251_c1 3300050511 Bacteria 548
548 nmdc:mga08y16_64266_c1 3300050511 Bacteria 3832
549 nmdc:mga0n895_810688_c1 3300050512 Bacteria 926
550 nmdc:mga0rr50_384975_c1 3300050513 Bacteria 1183
551 nmdc:mga0a205_1066_c1 3300050515 Bacteria 22781
552 nmdc:mga0a205_339441_c1 3300050515 Bacteria 1371
553 nmdc:mga0a205_57697_c1 3300050515 Bacteria 3748
554 nmdc:mga0a205_58968_c1 3300050515 Bacteria 3708
555 Ga0495601_0000196 3300053077 Bacteria 32072
556 Ga0495601_0003093 3300053077 Bacteria 9498
557 Ga0495601_0006808 3300053077 Bacteria 6695
558 Ga0495601_0087988 3300053077 Bacteria 1997
559 Ga0495601_0167900 3300053077 Bacteria 1434
560 Ga0495601_0216189 3300053077 Bacteria 1252
561 Ga0495612_0010132 3300053078 Bacteria 3812
562 Ga0495612_0019089 3300053078 Bacteria 2746
563 Ga0495612_0026255 3300053078 Bacteria 2340
564 Ga0495612_0183550 3300053078 Bacteria 919
565 Ga0495612_0193799 3300053078 Bacteria 895
566 Ga0495612_0246064 3300053078 Unclassified 795
567 Ga0495655_0000904 3300053083 Bacteria 4625
568 Ga0495595_0000167 3300053084 Bacteria 25731
569 Ga0495595_0118423 3300053084 Bacteria 1289
570 Ga0495619_0000042 3300053085 Bacteria 112453
571 Ga0495619_0000098 3300053085 Bacteria 64979
572 Ga0495619_0000327 3300053085 Bacteria 33238
573 Ga0495619_0010227 3300053085 Bacteria 5909
574 Ga0495619_0013246 3300053085 Bacteria 5198
575 Ga0495619_0123869 3300053085 Bacteria 1773
576 Ga0500614_000095 3300053123 Bacteria 20668
577 Ga0500636_0378333 3300053177 Bacteria 665
578 Ga0501084_0320743 3300054114 Bacteria 1309
579 Ga0501084_0773370 3300054114 Bacteria 809
580 Ga0501082_0455877 3300060353 Bacteria 1117
581 Ga0530510_0449863 3300061734 Bacteria 974
582 Ga0530510_0738456 3300061734 Bacteria 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100329033 Ga0070699_1003290332 79
2 3300005545 Ga0070695_100182208 Ga0070695_1001822082 79
3 3300009147 Ga0114129_13087777 Ga0114129_130877771 79
4 3300009148 Ga0105243_10865630 Ga0105243_108656301 79
5 3300009176 Ga0105242_10772199 Ga0105242_107721992 79
6 3300025935 Ga0207709_10619629 Ga0207709_106196291 79
7 3300005564 Ga0070664_100084303 Ga0070664_1000843033 89
8 3300025945 Ga0207679_10246740 Ga0207679_102467402 89
9 3300035724 Ga0373933_1011580 Ga0373933_1011580_145_495 89
10 3300048918 Ga0496115_0000034 Ga0496115_0000034_107480_107830 89
11 3300025928 Ga0207700_11807639 Ga0207700_118076391 90
12 3300025929 Ga0207664_11078611 Ga0207664_110786112 90
13 3300044684 Ga0466966_0046490 Ga0466966_0046490_793_1101 90
14 3300044693 Ga0466961_0141061 Ga0466961_0141061_955_1263 90
15 3300045049 Ga0466959_0323584 Ga0466959_0323584_303_611 90
16 3300045836 Ga0466958_0380464 Ga0466958_0380464_193_501 90
17 3300005440 Ga0070705_101266438 Ga0070705_1012664382 91
18 3300005457 Ga0070662_101165251 Ga0070662_1011652512 91
19 3300005549 Ga0070704_100166641 Ga0070704_1001666411 91
20 3300005981 Ga0081538_10000117 Ga0081538_1000011778 91
21 3300009094 Ga0111539_11020942 Ga0111539_110209421 91
22 3300009148 Ga0105243_10016685 Ga0105243_100166852 91
23 3300028381 Ga0268264_11827001 Ga0268264_118270012 91
24 3300039437 Ga0436365_1607371 Ga0436365_1607371_438_758 91
25 3300048927 Ga0496124_0198356 Ga0496124_0198356_31_372 91
26 3300050511 nmdc:mga08y16_1891251_c1 nmdc:mga08y16_1891251_c1_116_451 91
27 3300003373 JGI25407J50210_10103213 JGI25407J50210_101032132 92
28 3300005981 Ga0081538_10001766 Ga0081538_100017669 92
29 3300006048 Ga0075363_100454380 Ga0075363_1004543802 92
30 3300006852 Ga0075433_10000968 Ga0075433_100009684 92
31 3300013296 Ga0157374_10412766 Ga0157374_104127662 92
32 3300013306 Ga0163162_12915588 Ga0163162_129155882 92
33 3300037853 Ga0436364_0072171 Ga0436364_0072171_744_1064 92
34 3300039437 Ga0436365_0332771 Ga0436365_0332771_500_820 92
35 3300039437 Ga0436365_1481750 Ga0436365_1481750_309_617 92
36 3300053078 Ga0495612_0193799 Ga0495612_0193799_172_483 92
37 3300060353 Ga0501082_0455877 Ga0501082_0455877_243_584 92
38 3300031995 Ga0307409_100190126 Ga0307409_1001901262 93
39 3300035090 Ga0373949_0107428 Ga0373949_0107428_252_575 93
40 3300048917 Ga0496114_0000003 Ga0496114_0000003_101351_101638 93
41 3300048918 Ga0496115_0000071 Ga0496115_0000071_22654_22941 93
42 3300050491 nmdc:mga00v17_334606_c1 nmdc:mga00v17_334606_c1_645_968 93
43 3300050515 nmdc:mga0a205_1066_c1 nmdc:mga0a205_1066_c1_11255_11596 93
44 3300005331 Ga0070670_100191170 Ga0070670_1001911701 94
45 3300005406 Ga0070703_10055819 Ga0070703_100558192 94
46 3300009177 Ga0105248_10000126 Ga0105248_1000012676 94
47 3300009545 Ga0105237_11558407 Ga0105237_115584072 94
48 3300009551 Ga0105238_10509577 Ga0105238_105095772 94
49 3300013105 Ga0157369_10000135 Ga0157369_1000013596 94
50 3300013297 Ga0157378_10039519 Ga0157378_100395192 94
51 3300013308 Ga0157375_10470767 Ga0157375_104707672 94
52 3300014326 Ga0157380_10000009 Ga0157380_1000000918 94
53 3300014968 Ga0157379_10368454 Ga0157379_103684542 94
54 3300025885 Ga0207653_10038166 Ga0207653_100381662 94
55 3300045976 Ga0466967_0000005 Ga0466967_0000005_55895_56197 94
56 3300046459 Ga0495629_0000055 Ga0495629_0000055_96129_96428 94
57 3300046463 Ga0495653_0147655 Ga0495653_0147655_134_421 94
58 3300046507 Ga0495606_0000057 Ga0495606_0000057_147750_148049 94
59 3300046683 Ga0495658_0092210 Ga0495658_0092210_988_1290 94
60 3300047320 Ga0495672_0125181 Ga0495672_0125181_333_632 94
61 3300047673 Ga0495593_0083427 Ga0495593_0083427_757_1059 94
62 3300048905 Ga0496102_0963234 Ga0496102_0963234_421_708 94
63 3300048911 Ga0496108_0000080 Ga0496108_0000080_100526_100828 94
64 3300048912 Ga0496109_0000024 Ga0496109_0000024_100526_100828 94
65 3300048913 Ga0496110_0004843 Ga0496110_0004843_9700_9999 94
66 3300048914 Ga0496111_0002803 Ga0496111_0002803_9647_9946 94
67 3300048915 Ga0496112_0000003 Ga0496112_0000003_402177_402464 94
68 3300049577 Ga0501041_0174114 Ga0501041_0174114_678_1001 94
69 3300049586 Ga0501070_0061389 Ga0501070_0061389_2704_3006 94
70 3300049588 Ga0501072_0102580 Ga0501072_0102580_1935_2252 94
71 3300049741 Ga0501079_0307560 Ga0501079_0307560_900_1217 94
72 3300053078 Ga0495612_0010132 Ga0495612_0010132_2549_2848 94
73 3300053085 Ga0495619_0000098 Ga0495619_0000098_38412_38711 94
74 3300005549 Ga0070704_100888652 Ga0070704_1008886521 95
75 3300005718 Ga0068866_10356661 Ga0068866_103566612 95
76 3300006175 Ga0070712_100071610 Ga0070712_1000716102 95
77 3300006871 Ga0075434_100623852 Ga0075434_1006238522 95
78 3300009094 Ga0111539_12529594 Ga0111539_125295942 95
79 3300009098 Ga0105245_10573452 Ga0105245_105734522 95
80 3300009101 Ga0105247_10000204 Ga0105247_1000020448 95
81 3300009147 Ga0114129_12164329 Ga0114129_121643291 95
82 3300009176 Ga0105242_10002841 Ga0105242_100028418 95
83 3300009553 Ga0105249_10000235 Ga0105249_1000023553 95
84 3300010375 Ga0105239_10308314 Ga0105239_103083142 95
85 3300013296 Ga0157374_10815831 Ga0157374_108158312 95
86 3300013297 Ga0157378_10403833 Ga0157378_104038332 95
87 3300013308 Ga0157375_10225641 Ga0157375_102256412 95
88 3300014968 Ga0157379_10011591 Ga0157379_100115917 95
89 3300022467 Ga0224712_10101873 Ga0224712_101018732 95
90 3300025898 Ga0207692_10217280 Ga0207692_102172802 95
91 3300025899 Ga0207642_10361158 Ga0207642_103611581 95
92 3300025915 Ga0207693_10081364 Ga0207693_100813642 95
93 3300025916 Ga0207663_10061520 Ga0207663_100615202 95
94 3300025939 Ga0207665_10374127 Ga0207665_103741273 95
95 3300025961 Ga0207712_10000037 Ga0207712_10000037138 95
96 3300027907 Ga0207428_10053357 Ga0207428_100533571 95
97 3300031901 Ga0307406_10021145 Ga0307406_100211454 95
98 3300032126 Ga0307415_100273051 Ga0307415_1002730512 95
99 3300032126 Ga0307415_101001235 Ga0307415_1010012351 95
100 3300036401 Ga0373937_1970998 Ga0373937_1970998_48_338 95
101 3300037418 Ga0395900_0951222 Ga0395900_0951222_404_724 95
102 3300037466 Ga0395898_0018653 Ga0395898_0018653_4822_5142 95
103 3300037471 Ga0395905_0036867 Ga0395905_0036867_1051_1371 95
104 3300038443 Ga0395901_0205495 Ga0395901_0205495_1536_1856 95
105 3300044694 Ga0466963_0000585 Ga0466963_0000585_16430_16720 95
106 3300046454 Ga0495592_0626723 Ga0495592_0626723_19_309 95
107 3300046455 Ga0495603_0007750 Ga0495603_0007750_4562_4852 95
108 3300046515 Ga0495620_0002330 Ga0495620_0002330_8727_9017 95
109 3300046516 Ga0495628_0711775 Ga0495628_0711775_362_652 95
110 3300046539 Ga0495621_0002316 Ga0495621_0002316_4296_4586 95
111 3300046663 Ga0495635_0000026 Ga0495635_0000026_98987_99277 95
112 3300046674 Ga0495588_0097004 Ga0495588_0097004_485_775 95
113 3300046680 Ga0495646_0524932 Ga0495646_0524932_201_491 95
114 3300046691 Ga0495670_0162571 Ga0495670_0162571_482_772 95
115 3300047317 Ga0495604_0000413 Ga0495604_0000413_25850_26140 95
116 3300047319 Ga0495674_0823518 Ga0495674_0823518_82_429 95
117 3300047321 Ga0495676_0001347 Ga0495676_0001347_20213_20503 95
118 3300048907 Ga0496104_0000002 Ga0496104_0000002_435270_435557 95
119 3300048908 Ga0496105_0000001 Ga0496105_0000001_892622_892909 95
120 3300048911 Ga0496108_0000001 Ga0496108_0000001_91892_92182 95
121 3300048912 Ga0496109_0000006 Ga0496109_0000006_91892_92182 95
122 3300048914 Ga0496111_1170358 Ga0496111_1170358_11_301 95
123 3300048922 Ga0496119_0055607 Ga0496119_0055607_1268_1555 95
124 3300048923 Ga0496120_0057798 Ga0496120_0057798_628_915 95
125 3300048928 Ga0496125_0082765 Ga0496125_0082765_1784_2074 95
126 3300050510 nmdc:mga06r32_49041_c1 nmdc:mga06r32_49041_c1_2848_3162 95
127 3300050511 nmdc:mga08y16_64266_c1 nmdc:mga08y16_64266_c1_3366_3680 95
128 3300050515 nmdc:mga0a205_339441_c1 nmdc:mga0a205_339441_c1_75_389 95
129 3300053078 Ga0495612_0026255 Ga0495612_0026255_1847_2194 95
130 3300053078 Ga0495612_0246064 Ga0495612_0246064_274_576 95
131 3300054114 Ga0501084_0320743 Ga0501084_0320743_950_1243 95
132 3300005535 Ga0070684_100423061 Ga0070684_1004230612 96
133 3300011119 Ga0105246_10599369 Ga0105246_105993692 96
134 3300021384 Ga0213876_10024920 Ga0213876_100249202 96
135 3300025944 Ga0207661_10811227 Ga0207661_108112272 96
136 3300028381 Ga0268264_10013507 Ga0268264_100135075 96
137 3300046523 Ga0495644_0052692 Ga0495644_0052692_37_354 96
138 3300046539 Ga0495621_0180503 Ga0495621_0180503_435_752 96
139 3300048918 Ga0496115_0857334 Ga0496115_0857334_174_482 96
140 3300050512 nmdc:mga0n895_810688_c1 nmdc:mga0n895_810688_c1_186_518 96
141 3300061734 Ga0530510_0738456 Ga0530510_0738456_86_409 96
142 3300005435 Ga0070714_100100082 Ga0070714_1001000823 97
143 3300005435 Ga0070714_100537636 Ga0070714_1005376362 97
144 3300005436 Ga0070713_100062738 Ga0070713_1000627382 97
145 3300005436 Ga0070713_100127885 Ga0070713_1001278853 97
146 3300005436 Ga0070713_100156215 Ga0070713_1001562152 97
147 3300005437 Ga0070710_10183800 Ga0070710_101838002 97
148 3300005437 Ga0070710_10344530 Ga0070710_103445302 97
149 3300006028 Ga0070717_10593545 Ga0070717_105935452 97
150 3300006175 Ga0070712_100195741 Ga0070712_1001957412 97
151 3300013307 Ga0157372_11092036 Ga0157372_110920362 97
152 3300017792 Ga0163161_10370902 Ga0163161_103709022 97
153 3300025898 Ga0207692_10421453 Ga0207692_104214532 97
154 3300025915 Ga0207693_10012806 Ga0207693_100128069 97
155 3300025916 Ga0207663_10080907 Ga0207663_100809073 97
156 3300025916 Ga0207663_10150273 Ga0207663_101502732 97
157 3300025929 Ga0207664_10082112 Ga0207664_100821122 97
158 3300025929 Ga0207664_11995040 Ga0207664_119950402 97
159 3300031852 Ga0307410_11005653 Ga0307410_110056532 97
160 3300031995 Ga0307409_102834841 Ga0307409_1028348412 97
161 3300032002 Ga0307416_100468343 Ga0307416_1004683432 97
162 3300035692 Ga0373935_0426195 Ga0373935_0426195_199_525 97
163 3300035724 Ga0373933_0638816 Ga0373933_0638816_281_607 97
164 3300036401 Ga0373937_0342658 Ga0373937_0342658_299_625 97
165 3300036401 Ga0373937_0724274 Ga0373937_0724274_94_420 97
166 3300037466 Ga0395898_0918307 Ga0395898_0918307_447_773 97
167 3300045049 Ga0466959_0084849 Ga0466959_0084849_1663_1983 97
168 3300046462 Ga0495651_0094152 Ga0495651_0094152_914_1240 97
169 3300046463 Ga0495653_0326368 Ga0495653_0326368_297_623 97
170 3300046473 Ga0495582_0199127 Ga0495582_0199127_400_726 97
171 3300046511 Ga0495608_0199396 Ga0495608_0199396_150_476 97
172 3300046511 Ga0495608_0272156 Ga0495608_0272156_94_420 97
173 3300046515 Ga0495620_0357101 Ga0495620_0357101_122_448 97
174 3300046533 Ga0495640_0231582 Ga0495640_0231582_605_931 97
175 3300046536 Ga0495587_0070521 Ga0495587_0070521_346_672 97
176 3300046559 Ga0495667_0267512 Ga0495667_0267512_662_988 97
177 3300046642 Ga0495634_0184236 Ga0495634_0184236_495_821 97
178 3300046663 Ga0495635_0246643 Ga0495635_0246643_748_1074 97
179 3300046675 Ga0495657_0102165 Ga0495657_0102165_872_1198 97
180 3300046679 Ga0495623_0499592 Ga0495623_0499592_268_594 97
181 3300046680 Ga0495646_0443048 Ga0495646_0443048_229_555 97
182 3300046689 Ga0495613_0497443 Ga0495613_0497443_333_659 97
183 3300047315 Ga0495581_0392992 Ga0495581_0392992_43_369 97
184 3300047317 Ga0495604_0141086 Ga0495604_0141086_957_1283 97
185 3300047317 Ga0495604_0550801 Ga0495604_0550801_373_699 97
186 3300047322 Ga0495680_0033973 Ga0495680_0033973_1034_1360 97
187 3300047322 Ga0495680_0599018 Ga0495680_0599018_116_442 97
188 3300047444 Ga0495675_0082909 Ga0495675_0082909_818_1144 97
189 3300047673 Ga0495593_0141678 Ga0495593_0141678_370_696 97
190 3300048903 Ga0496100_0008714 Ga0496100_0008714_4709_5050 97
191 3300048904 Ga0496101_0011624 Ga0496101_0011624_428_769 97
192 3300048905 Ga0496102_1485839 Ga0496102_1485839_130_456 97
193 3300048910 Ga0496107_0930233 Ga0496107_0930233_169_495 97
194 3300048913 Ga0496110_0148516 Ga0496110_0148516_824_1150 97
195 3300048913 Ga0496110_0345073 Ga0496110_0345073_792_1133 97
196 3300048914 Ga0496111_0387065 Ga0496111_0387065_28_369 97
197 3300048914 Ga0496111_0691935 Ga0496111_0691935_286_612 97
198 3300048915 Ga0496112_0000857 Ga0496112_0000857_16455_16787 97
199 3300048915 Ga0496112_1752647 Ga0496112_1752647_113_439 97
200 3300048916 Ga0496113_0321739 Ga0496113_0321739_394_720 97
201 3300050507 nmdc:mga05p37_8570_c1 nmdc:mga05p37_8570_c1_319_660 97
202 3300050508 nmdc:mga09592_345171_c1 nmdc:mga09592_345171_c1_932_1273 97
203 3300050509 nmdc:mga0qj67_848261_c1 nmdc:mga0qj67_848261_c1_109_450 97
204 3300050510 nmdc:mga06r32_173360_c1 nmdc:mga06r32_173360_c1_875_1216 97
205 3300053077 Ga0495601_0216189 Ga0495601_0216189_633_959 97
206 3300053084 Ga0495595_0118423 Ga0495595_0118423_157_483 97
207 3300053085 Ga0495619_0123869 Ga0495619_0123869_1002_1328 97
208 3300003373 JGI25407J50210_10056006 JGI25407J50210_100560062 98
209 3300005937 Ga0081455_10635492 Ga0081455_106354922 98
210 3300012492 Ga0157335_1033844 Ga0157335_10338442 98
211 3300037853 Ga0436364_0167671 Ga0436364_0167671_5504_5821 98
212 3300039437 Ga0436365_0924437 Ga0436365_0924437_303_620 98
213 3300039437 Ga0436365_0969934 Ga0436365_0969934_751_1059 98
214 3300039437 Ga0436365_1934953 Ga0436365_1934953_235_543 98
215 3300039450 Ga0436363_1638120 Ga0436363_1638120_455_763 98
216 3300039453 Ga0436362_0120799 Ga0436362_0120799_403_717 98
217 3300039453 Ga0436362_0451879 Ga0436362_0451879_156_473 98
218 3300041451 Ga0451791_1132480 Ga0451791_1132480_236_538 98
219 3300044842 Ga0466957_0493651 Ga0466957_0493651_319_627 98
220 3300045976 Ga0466967_0803306 Ga0466967_0803306_15_314 98
221 3300046459 Ga0495629_0096664 Ga0495629_0096664_1721_2023 98
222 3300046461 Ga0495641_0147257 Ga0495641_0147257_209_517 98
223 3300046475 Ga0495639_0647172 Ga0495639_0647172_92_400 98
224 3300046517 Ga0495630_0319808 Ga0495630_0319808_801_1103 98
225 3300046531 Ga0495665_0531549 Ga0495665_0531549_77_385 98
226 3300046689 Ga0495613_0099944 Ga0495613_0099944_1728_2036 98
227 3300047471 Ga0495684_0289152 Ga0495684_0289152_58_366 98
228 3300048907 Ga0496104_0340318 Ga0496104_0340318_165_473 98
229 3300048908 Ga0496105_0127713 Ga0496105_0127713_1291_1599 98
230 3300048912 Ga0496109_0681031 Ga0496109_0681031_499_807 98
231 3300048915 Ga0496112_0814475 Ga0496112_0814475_349_657 98
232 3300005354 Ga0070675_100000008 Ga0070675_100000008221 99
233 3300006847 Ga0075431_100314659 Ga0075431_1003146592 99
234 3300009176 Ga0105242_10156325 Ga0105242_101563252 99
235 3300013307 Ga0157372_11005891 Ga0157372_110058912 99
236 3300020077 Ga0206351_10054906 Ga0206351_100549062 99
237 3300025915 Ga0207693_10323798 Ga0207693_103237982 99
238 3300025934 Ga0207686_10047518 Ga0207686_100475182 99
239 3300025939 Ga0207665_10396645 Ga0207665_103966452 99
240 3300026035 Ga0207703_10000237 Ga0207703_1000023729 99
241 3300030521 Ga0307511_10082567 Ga0307511_100825673 99
242 3300037853 Ga0436364_0139100 Ga0436364_0139100_59_379 99
243 3300039437 Ga0436365_0342589 Ga0436365_0342589_969_1289 99
244 3300039453 Ga0436362_0337191 Ga0436362_0337191_110_436 99
245 3300045836 Ga0466958_0036126 Ga0466958_0036126_46_387 99
246 3300045976 Ga0466967_0566402 Ga0466967_0566402_220_543 99
247 3300046454 Ga0495592_0000600 Ga0495592_0000600_17412_17714 99
248 3300046455 Ga0495603_0001152 Ga0495603_0001152_13248_13547 99
249 3300046461 Ga0495641_0161307 Ga0495641_0161307_685_987 99
250 3300046463 Ga0495653_0240166 Ga0495653_0240166_496_798 99
251 3300046463 Ga0495653_0279029 Ga0495653_0279029_385_687 99
252 3300046476 Ga0495662_0000021 Ga0495662_0000021_26228_26530 99
253 3300046511 Ga0495608_0003895 Ga0495608_0003895_7674_7976 99
254 3300046514 Ga0495618_0000058 Ga0495618_0000058_33972_34274 99
255 3300046516 Ga0495628_0004164 Ga0495628_0004164_11969_12271 99
256 3300046516 Ga0495628_0441424 Ga0495628_0441424_247_549 99
257 3300046517 Ga0495630_0002139 Ga0495630_0002139_461_763 99
258 3300046533 Ga0495640_0054649 Ga0495640_0054649_2284_2586 99
259 3300046675 Ga0495657_0043883 Ga0495657_0043883_2268_2570 99
260 3300046681 Ga0495647_0030918 Ga0495647_0030918_746_1045 99
261 3300046681 Ga0495647_0032972 Ga0495647_0032972_684_986 99
262 3300046689 Ga0495613_0000364 Ga0495613_0000364_6845_7147 99
263 3300046690 Ga0495624_0701847 Ga0495624_0701847_52_351 99
264 3300046809 Ga0495600_0023432 Ga0495600_0023432_871_1173 99
265 3300047319 Ga0495674_0687050 Ga0495674_0687050_485_787 99
266 3300047322 Ga0495680_0000407 Ga0495680_0000407_38050_38352 99
267 3300048904 Ga0496101_1503897 Ga0496101_1503897_51_353 99
268 3300048907 Ga0496104_0000013 Ga0496104_0000013_55756_56088 99
269 3300048908 Ga0496105_0000006 Ga0496105_0000006_341076_341408 99
270 3300053078 Ga0495612_0183550 Ga0495612_0183550_481_801 99
271 3300053084 Ga0495595_0000167 Ga0495595_0000167_23425_23727 99
272 3300053085 Ga0495619_0000042 Ga0495619_0000042_44153_44494 99
273 3300005338 Ga0068868_100005792 Ga0068868_1000057923 100
274 3300005341 Ga0070691_10000014 Ga0070691_1000001418 100
275 3300005436 Ga0070713_100000143 Ga0070713_10000014331 100
276 3300005981 Ga0081538_10018805 Ga0081538_100188052 100
277 3300009176 Ga0105242_11546418 Ga0105242_115464181 100
278 3300020077 Ga0206351_10998395 Ga0206351_109983951 100
279 3300025926 Ga0207659_10000014 Ga0207659_1000001492 100
280 3300026023 Ga0207677_10012618 Ga0207677_100126185 100
281 3300046460 Ga0495638_0008356 Ga0495638_0008356_400_744 100
282 3300046461 Ga0495641_0142995 Ga0495641_0142995_509_814 100
283 3300048908 Ga0496105_0890830 Ga0496105_0890830_218_568 100
284 3300048909 Ga0496106_0723823 Ga0496106_0723823_24_335 100
285 3300048918 Ga0496115_0326693 Ga0496115_0326693_280_630 100
286 3300049583 Ga0501067_0507740 Ga0501067_0507740_321_632 100
287 3300049585 Ga0501069_0354333 Ga0501069_0354333_35_346 100
288 3300049587 Ga0501071_0473303 Ga0501071_0473303_268_609 100
289 3300053083 Ga0495655_0000904 Ga0495655_0000904_330_677 100
290 3300005341 Ga0070691_10000822 Ga0070691_100008229 101
291 3300005356 Ga0070674_100000103 Ga0070674_10000010312 101
292 3300005364 Ga0070673_100004180 Ga0070673_1000041809 101
293 3300005435 Ga0070714_100151292 Ga0070714_1001512923 101
294 3300005437 Ga0070710_11288732 Ga0070710_112887321 101
295 3300005439 Ga0070711_100111202 Ga0070711_1001112021 101
296 3300005445 Ga0070708_101703830 Ga0070708_1017038302 101
297 3300005456 Ga0070678_100120545 Ga0070678_1001205452 101
298 3300005456 Ga0070678_100714791 Ga0070678_1007147912 101
299 3300005614 Ga0068856_100198127 Ga0068856_1001981272 101
300 3300005616 Ga0068852_100000005 Ga0068852_100000005159 101
301 3300005718 Ga0068866_10000014 Ga0068866_1000001468 101
302 3300005844 Ga0068862_100995203 Ga0068862_1009952032 101
303 3300006163 Ga0070715_10000011 Ga0070715_1000001169 101
304 3300025899 Ga0207642_10000001 Ga0207642_10000001748 101
305 3300025905 Ga0207685_10000001 Ga0207685_10000001118 101
306 3300025923 Ga0207681_10116366 Ga0207681_101163662 101
307 3300025925 Ga0207650_10082055 Ga0207650_100820552 101
308 3300025928 Ga0207700_10000008 Ga0207700_1000000821 101
309 3300025929 Ga0207664_10078184 Ga0207664_100781842 101
310 3300025935 Ga0207709_10011143 Ga0207709_100111436 101
311 3300025937 Ga0207669_10000115 Ga0207669_1000011530 101
312 3300025941 Ga0207711_10000024 Ga0207711_10000024188 101
313 3300025960 Ga0207651_10001295 Ga0207651_1000129511 101
314 3300025972 Ga0207668_10040497 Ga0207668_100404974 101
315 3300026078 Ga0207702_10053419 Ga0207702_100534193 101
316 3300026078 Ga0207702_11427537 Ga0207702_114275372 101
317 3300026121 Ga0207683_10118949 Ga0207683_101189492 101
318 3300026142 Ga0207698_10000038 Ga0207698_1000003880 101
319 3300028380 Ga0268265_10746971 Ga0268265_107469712 101
320 3300044694 Ga0466963_1011281 Ga0466963_1011281_177_515 101
321 3300046642 Ga0495634_0000601 Ga0495634_0000601_31988_32332 101
322 3300049592 Ga0501076_1489937 Ga0501076_1489937_187_546 101
323 3300005356 Ga0070674_100185884 Ga0070674_1001858842 102
324 3300005366 Ga0070659_102068170 Ga0070659_1020681701 102
325 3300005367 Ga0070667_100395819 Ga0070667_1003958192 102
326 3300005440 Ga0070705_100390979 Ga0070705_1003909792 102
327 3300005444 Ga0070694_100815211 Ga0070694_1008152112 102
328 3300005539 Ga0068853_100001637 Ga0068853_1000016378 102
329 3300005545 Ga0070695_100808184 Ga0070695_1008081842 102
330 3300005549 Ga0070704_100290823 Ga0070704_1002908232 102
331 3300005719 Ga0068861_100306856 Ga0068861_1003068562 102
332 3300005841 Ga0068863_101612749 Ga0068863_1016127492 102
333 3300006048 Ga0075363_100245526 Ga0075363_1002455262 102
334 3300009098 Ga0105245_10000667 Ga0105245_1000066723 102
335 3300009148 Ga0105243_10268359 Ga0105243_102683593 102
336 3300009176 Ga0105242_10283626 Ga0105242_102836262 102
337 3300009553 Ga0105249_10658074 Ga0105249_106580742 102
338 3300013104 Ga0157370_10447022 Ga0157370_104470222 102
339 3300025916 Ga0207663_10078734 Ga0207663_100787342 102
340 3300025927 Ga0207687_10000037 Ga0207687_1000003714 102
341 3300025927 Ga0207687_10309073 Ga0207687_103090732 102
342 3300025928 Ga0207700_11657082 Ga0207700_116570822 102
343 3300025934 Ga0207686_10427879 Ga0207686_104278792 102
344 3300025937 Ga0207669_11842249 Ga0207669_118422491 102
345 3300025960 Ga0207651_11226127 Ga0207651_112261272 102
346 3300025961 Ga0207712_10596440 Ga0207712_105964402 102
347 3300025972 Ga0207668_10906109 Ga0207668_109061092 102
348 3300025986 Ga0207658_10151095 Ga0207658_101510952 102
349 3300026041 Ga0207639_10003793 Ga0207639_100037935 102
350 3300026118 Ga0207675_100481936 Ga0207675_1004819362 102
351 3300047673 Ga0495593_0374253 Ga0495593_0374253_304_621 102
352 3300048905 Ga0496102_0853204 Ga0496102_0853204_52_378 102
353 3300048908 Ga0496105_0093363 Ga0496105_0093363_1164_1481 102
354 3300005543 Ga0070672_100000175 Ga0070672_10000017527 103
355 3300025940 Ga0207691_10000609 Ga0207691_1000060910 103
356 3300039437 Ga0436365_0105231 Ga0436365_0105231_713_1042 103
357 3300048926 Ga0496123_0230959 Ga0496123_0230959_79_465 103
358 3300049575 Ga0501039_1030687 Ga0501039_1030687_217_585 103
359 3300049587 Ga0501071_0589524 Ga0501071_0589524_222_590 103
360 3300049588 Ga0501072_0641590 Ga0501072_0641590_405_773 103
361 3300049590 Ga0501074_0082466 Ga0501074_0082466_393_761 103
362 3300049591 Ga0501075_0213138 Ga0501075_0213138_289_657 103
363 3300049593 Ga0501077_0198381 Ga0501077_0198381_399_767 103
364 3300061734 Ga0530510_0449863 Ga0530510_0449863_429_797 103
365 3300005338 Ga0068868_100000467 Ga0068868_10000046718 104
366 3300005438 Ga0070701_10338851 Ga0070701_103388512 104
367 3300005457 Ga0070662_100000015 Ga0070662_10000001592 104
368 3300005547 Ga0070693_100069509 Ga0070693_1000695093 104
369 3300005983 Ga0081540_1116131 Ga0081540_11161312 104
370 3300006871 Ga0075434_100018827 Ga0075434_1000188274 104
371 3300009147 Ga0114129_10853789 Ga0114129_108537892 104
372 3300014325 Ga0163163_10140552 Ga0163163_101405523 104
373 3300025915 Ga0207693_10674134 Ga0207693_106741341 104
374 3300025933 Ga0207706_10000062 Ga0207706_1000006217 104
375 3300026023 Ga0207677_10000464 Ga0207677_100004649 104
376 3300046454 Ga0495592_0623949 Ga0495592_0623949_241_585 104
377 3300046473 Ga0495582_0000013 Ga0495582_0000013_20042_20359 104
378 3300046499 Ga0495594_0100615 Ga0495594_0100615_827_1144 104
379 3300046535 Ga0495586_0837277 Ga0495586_0837277_18_335 104
380 3300046536 Ga0495587_0025864 Ga0495587_0025864_1609_1926 104
381 3300046642 Ga0495634_0352161 Ga0495634_0352161_120_437 104
382 3300046683 Ga0495658_0000009 Ga0495658_0000009_90023_90340 104
383 3300047469 Ga0495673_0120790 Ga0495673_0120790_174_491 104
384 3300048907 Ga0496104_0376206 Ga0496104_0376206_235_564 104
385 3300048910 Ga0496107_0366400 Ga0496107_0366400_291_608 104
386 3300048913 Ga0496110_0933214 Ga0496110_0933214_119_448 104
387 3300048914 Ga0496111_0517110 Ga0496111_0517110_331_660 104
388 3300048916 Ga0496113_0129070 Ga0496113_0129070_445_774 104
389 3300049578 Ga0501042_0033618 Ga0501042_0033618_736_1053 104
390 3300049587 Ga0501071_0655002 Ga0501071_0655002_136_468 104
391 3300050507 nmdc:mga05p37_556183_c1 nmdc:mga05p37_556183_c1_63_392 104
392 3300050515 nmdc:mga0a205_58968_c1 nmdc:mga0a205_58968_c1_2782_3111 104
393 3300053085 Ga0495619_0013246 Ga0495619_0013246_1536_1853 104
394 3300005546 Ga0070696_101062770 Ga0070696_1010627701 105
395 3300005564 Ga0070664_100033581 Ga0070664_1000335814 105
396 3300005841 Ga0068863_100000136 Ga0068863_10000013627 105
397 3300006038 Ga0075365_10985650 Ga0075365_109856502 105
398 3300006880 Ga0075429_101025444 Ga0075429_1010254442 105
399 3300009098 Ga0105245_11221967 Ga0105245_112219672 105
400 3300009101 Ga0105247_11519502 Ga0105247_115195022 105
401 3300009147 Ga0114129_10327426 Ga0114129_103274262 105
402 3300009148 Ga0105243_10816183 Ga0105243_108161832 105
403 3300009176 Ga0105242_10996001 Ga0105242_109960012 105
404 3300009551 Ga0105238_10000172 Ga0105238_1000017231 105
405 3300010375 Ga0105239_12273443 Ga0105239_122734432 105
406 3300013296 Ga0157374_10006572 Ga0157374_100065724 105
407 3300013308 Ga0157375_10028002 Ga0157375_100280023 105
408 3300014326 Ga0157380_10000550 Ga0157380_100005502 105
409 3300014969 Ga0157376_11778251 Ga0157376_117782512 105
410 3300025945 Ga0207679_10025338 Ga0207679_100253384 105
411 3300026088 Ga0207641_10000265 Ga0207641_1000026537 105
412 3300045976 Ga0466967_2009051 Ga0466967_2009051_82_402 105
413 3300046461 Ga0495641_0110749 Ga0495641_0110749_638_964 105
414 3300046463 Ga0495653_0190870 Ga0495653_0190870_474_794 105
415 3300046463 Ga0495653_0237721 Ga0495653_0237721_81_407 105
416 3300046514 Ga0495618_0368346 Ga0495618_0368346_455_781 105
417 3300046516 Ga0495628_0318871 Ga0495628_0318871_493_819 105
418 3300046517 Ga0495630_0001432 Ga0495630_0001432_14952_15278 105
419 3300046520 Ga0495637_0188004 Ga0495637_0188004_118_438 105
420 3300046523 Ga0495644_0000693 Ga0495644_0000693_11042_11362 105
421 3300046529 Ga0495652_0017506 Ga0495652_0017506_2671_2997 105
422 3300046529 Ga0495652_0052526 Ga0495652_0052526_1192_1512 105
423 3300046535 Ga0495586_0004843 Ga0495586_0004843_381_701 105
424 3300046537 Ga0495598_0030761 Ga0495598_0030761_693_1013 105
425 3300046543 Ga0495645_0078054 Ga0495645_0078054_109_435 105
426 3300046642 Ga0495634_0142741 Ga0495634_0142741_684_1010 105
427 3300046642 Ga0495634_0199482 Ga0495634_0199482_426_746 105
428 3300046663 Ga0495635_0155880 Ga0495635_0155880_738_1064 105
429 3300046675 Ga0495657_0024223 Ga0495657_0024223_3452_3778 105
430 3300046681 Ga0495647_0000027 Ga0495647_0000027_2090_2410 105
431 3300046683 Ga0495658_0235027 Ga0495658_0235027_576_902 105
432 3300046684 Ga0495669_0000823 Ga0495669_0000823_2108_2428 105
433 3300046690 Ga0495624_0000012 Ga0495624_0000012_2684_3004 105
434 3300046690 Ga0495624_0430041 Ga0495624_0430041_223_549 105
435 3300046809 Ga0495600_0832962 Ga0495600_0832962_210_530 105
436 3300047321 Ga0495676_0356953 Ga0495676_0356953_221_541 105
437 3300047322 Ga0495680_0190588 Ga0495680_0190588_18_344 105
438 3300047444 Ga0495675_0231539 Ga0495675_0231539_456_776 105
439 3300047673 Ga0495593_0067439 Ga0495593_0067439_1327_1647 105
440 3300047673 Ga0495593_0170552 Ga0495593_0170552_449_769 105
441 3300048907 Ga0496104_0002173 Ga0496104_0002173_11355_11675 105
442 3300048908 Ga0496105_0029466 Ga0496105_0029466_1579_1899 105
443 3300048909 Ga0496106_0000174 Ga0496106_0000174_29118_29438 105
444 3300048910 Ga0496107_0200961 Ga0496107_0200961_656_976 105
445 3300048912 Ga0496109_0231309 Ga0496109_0231309_136_456 105
446 3300048913 Ga0496110_0614598 Ga0496110_0614598_162_482 105
447 3300048915 Ga0496112_0658969 Ga0496112_0658969_82_402 105
448 3300049741 Ga0501079_1044261 Ga0501079_1044261_282_602 105
449 3300049743 Ga0501081_0452393 Ga0501081_0452393_471_791 105
450 3300050507 nmdc:mga05p37_73843_c1 nmdc:mga05p37_73843_c1_212_571 105
451 3300053077 Ga0495601_0003093 Ga0495601_0003093_2928_3254 105
452 3300053077 Ga0495601_0006808 Ga0495601_0006808_5908_6228 105
453 3300053077 Ga0495601_0087988 Ga0495601_0087988_74_400 105
454 3300053077 Ga0495601_0167900 Ga0495601_0167900_466_792 105
455 3300053078 Ga0495612_0019089 Ga0495612_0019089_50_376 105
456 3300053085 Ga0495619_0000327 Ga0495619_0000327_32413_32739 105
457 3300053085 Ga0495619_0010227 Ga0495619_0010227_5335_5661 105
458 3300054114 Ga0501084_0773370 Ga0501084_0773370_463_783 105
459 3300049575 Ga0501039_0579492 Ga0501039_0579492_96_425 106
460 3300049741 Ga0501079_1230804 Ga0501079_1230804_201_542 106
461 3300005327 Ga0070658_10051144 Ga0070658_100511442 108
462 3300005439 Ga0070711_100005366 Ga0070711_1000053669 108
463 3300005983 Ga0081540_1000296 Ga0081540_100029621 108
464 3300006178 Ga0075367_10371701 Ga0075367_103717012 108
465 3300006871 Ga0075434_100050514 Ga0075434_1000505143 108
466 3300006914 Ga0075436_100860605 Ga0075436_1008606052 108
467 3300007076 Ga0075435_100369786 Ga0075435_1003697862 108
468 3300025916 Ga0207663_10000854 Ga0207663_100008542 108
469 3300026095 Ga0207676_10000048 Ga0207676_10000048149 108
470 3300028379 Ga0268266_11006555 Ga0268266_110065551 108
471 3300047320 Ga0495672_0100485 Ga0495672_0100485_249_593 108
472 3300048913 Ga0496110_1017693 Ga0496110_1017693_153_491 108
473 3300050494 nmdc:mga06z11_535025_c1 nmdc:mga06z11_535025_c1_85_423 108
474 3300050507 nmdc:mga05p37_1891672_c1 nmdc:mga05p37_1891672_c1_156_494 108
475 3300050513 nmdc:mga0rr50_384975_c1 nmdc:mga0rr50_384975_c1_531_869 108
476 3300050515 nmdc:mga0a205_57697_c1 nmdc:mga0a205_57697_c1_2765_3103 108
477 3300005329 Ga0070683_100004015 Ga0070683_1000040156 109
478 3300005333 Ga0070677_10000013 Ga0070677_1000001345 109
479 3300005336 Ga0070680_100115046 Ga0070680_1001150462 109
480 3300005337 Ga0070682_100001328 Ga0070682_1000013287 109
481 3300005344 Ga0070661_101686299 Ga0070661_1016862991 109
482 3300005441 Ga0070700_100557734 Ga0070700_1005577341 109
483 3300005456 Ga0070678_100007193 Ga0070678_1000071937 109
484 3300005458 Ga0070681_10372816 Ga0070681_103728162 109
485 3300005466 Ga0070685_10000037 Ga0070685_100000372 109
486 3300005530 Ga0070679_100000069 Ga0070679_1000000697 109
487 3300005535 Ga0070684_100003643 Ga0070684_10000364312 109
488 3300005535 Ga0070684_100868178 Ga0070684_1008681782 109
489 3300005539 Ga0068853_100609239 Ga0068853_1006092392 109
490 3300005548 Ga0070665_100000068 Ga0070665_1000000689 109
491 3300005563 Ga0068855_100122747 Ga0068855_1001227472 109
492 3300005578 Ga0068854_100000472 Ga0068854_1000004728 109
493 3300005578 Ga0068854_100006598 Ga0068854_1000065987 109
494 3300005614 Ga0068856_100000210 Ga0068856_10000021025 109
495 3300005834 Ga0068851_10008803 Ga0068851_100088036 109
496 3300005834 Ga0068851_10107455 Ga0068851_101074552 109
497 3300005842 Ga0068858_100001203 Ga0068858_10000120321 109
498 3300005844 Ga0068862_100783918 Ga0068862_1007839181 109
499 3300006163 Ga0070715_10026203 Ga0070715_100262032 109
500 3300006881 Ga0068865_100000019 Ga0068865_10000001982 109
501 3300009093 Ga0105240_11502154 Ga0105240_115021542 109
502 3300009098 Ga0105245_10000012 Ga0105245_1000001244 109
503 3300009098 Ga0105245_10030985 Ga0105245_100309851 109
504 3300010375 Ga0105239_10190013 Ga0105239_101900132 109
505 3300017792 Ga0163161_10201205 Ga0163161_102012052 109
506 3300020081 Ga0206354_10737789 Ga0206354_107377894 109
507 3300020082 Ga0206353_11079496 Ga0206353_110794961 109
508 3300025321 Ga0207656_10000105 Ga0207656_1000010532 109
509 3300025321 Ga0207656_10024930 Ga0207656_100249302 109
510 3300025893 Ga0207682_10000038 Ga0207682_1000003845 109
511 3300025905 Ga0207685_10017389 Ga0207685_100173892 109
512 3300025909 Ga0207705_10041343 Ga0207705_100413432 109
513 3300025912 Ga0207707_10051034 Ga0207707_100510342 109
514 3300025913 Ga0207695_11220675 Ga0207695_112206752 109
515 3300025917 Ga0207660_10097128 Ga0207660_100971282 109
516 3300025921 Ga0207652_10000142 Ga0207652_1000014275 109
517 3300025927 Ga0207687_10000011 Ga0207687_1000001197 109
518 3300025927 Ga0207687_10021630 Ga0207687_100216304 109
519 3300025938 Ga0207704_10000009 Ga0207704_100000099 109
520 3300025944 Ga0207661_10001063 Ga0207661_100010637 109
521 3300025949 Ga0207667_11041123 Ga0207667_110411232 109
522 3300025981 Ga0207640_10000125 Ga0207640_1000012520 109
523 3300025981 Ga0207640_10052356 Ga0207640_100523562 109
524 3300026035 Ga0207703_10000128 Ga0207703_1000012868 109
525 3300026075 Ga0207708_10551197 Ga0207708_105511972 109
526 3300026078 Ga0207702_10001764 Ga0207702_100017642 109
527 3300026078 Ga0207702_10025507 Ga0207702_100255073 109
528 3300026078 Ga0207702_10737985 Ga0207702_107379852 109
529 3300026118 Ga0207675_101817799 Ga0207675_1018177992 109
530 3300026121 Ga0207683_10027288 Ga0207683_100272882 109
531 3300028379 Ga0268266_10000020 Ga0268266_10000020392 109
532 3300035120 Ga0373957_0155927 Ga0373957_0155927_59_391 109
533 3300035724 Ga0373933_0294494 Ga0373933_0294494_375_707 109
534 3300036401 Ga0373937_0515277 Ga0373937_0515277_400_732 109
535 3300046461 Ga0495641_0000020 Ga0495641_0000020_18805_19137 109
536 3300046511 Ga0495608_0232570 Ga0495608_0232570_484_816 109
537 3300046517 Ga0495630_0039472 Ga0495630_0039472_1716_2048 109
538 3300046681 Ga0495647_0224784 Ga0495647_0224784_141_473 109
539 3300046684 Ga0495669_0000083 Ga0495669_0000083_18928_19260 109
540 3300046694 Ga0495649_0000587 Ga0495649_0000587_20053_20385 109
541 3300047322 Ga0495680_0000671 Ga0495680_0000671_24652_24984 109
542 3300048903 Ga0496100_0000007 Ga0496100_0000007_218586_218918 109
543 3300048904 Ga0496101_0000013 Ga0496101_0000013_218586_218918 109
544 3300048909 Ga0496106_0000006 Ga0496106_0000006_212725_213057 109
545 3300048910 Ga0496107_0000007 Ga0496107_0000007_212727_213059 109
546 3300048914 Ga0496111_0721111 Ga0496111_0721111_113_445 109
547 3300053123 Ga0500614_000095 Ga0500614_000095_19885_20217 109
548 3300053177 Ga0500636_0378333 Ga0500636_0378333_143_475 109
549 3300001979 JGI24740J21852_10008002 JGI24740J21852_100080022 110
550 3300002074 JGI24748J21848_1001674 JGI24748J21848_10016742 110
551 3300002239 JGI24034J26672_10000495 JGI24034J26672_100004954 110
552 3300002244 JGI24742J22300_10010085 JGI24742J22300_100100852 110
553 3300005355 Ga0070671_100098797 Ga0070671_1000987973 110
554 3300005440 Ga0070705_101201612 Ga0070705_1012016122 110
555 3300005441 Ga0070700_100024753 Ga0070700_1000247533 110
556 3300005844 Ga0068862_100465821 Ga0068862_1004658212 110
557 3300009098 Ga0105245_10001759 Ga0105245_1000175921 110
558 3300009176 Ga0105242_10412992 Ga0105242_104129922 110
559 3300009553 Ga0105249_10213855 Ga0105249_102138552 110
560 3300017792 Ga0163161_10000018 Ga0163161_1000001896 110
561 3300025900 Ga0207710_10000779 Ga0207710_100007792 110
562 3300025908 Ga0207643_10644403 Ga0207643_106444032 110
563 3300025924 Ga0207694_10000004 Ga0207694_10000004915 110
564 3300025927 Ga0207687_10000133 Ga0207687_1000013330 110
565 3300025927 Ga0207687_11024762 Ga0207687_110247622 110
566 3300025932 Ga0207690_10440488 Ga0207690_104404882 110
567 3300025934 Ga0207686_10003650 Ga0207686_100036508 110
568 3300025934 Ga0207686_10349399 Ga0207686_103493992 110
569 3300025935 Ga0207709_10258576 Ga0207709_102585762 110
570 3300025937 Ga0207669_11049011 Ga0207669_110490112 110
571 3300025938 Ga0207704_10315989 Ga0207704_103159892 110
572 3300025961 Ga0207712_10214096 Ga0207712_102140962 110
573 3300026075 Ga0207708_10013078 Ga0207708_100130785 110
574 3300028380 Ga0268265_11367494 Ga0268265_113674942 110
575 3300031251 Ga0265327_10157893 Ga0265327_101578932 110
576 3300045976 Ga0466967_0579352 Ga0466967_0579352_189_524 110
577 3300046642 Ga0495634_0050593 Ga0495634_0050593_2222_2557 110
578 3300046678 Ga0495599_0014958 Ga0495599_0014958_4293_4628 110
579 3300048088 Ga0495602_0320781 Ga0495602_0320781_296_631 110
580 3300048903 Ga0496100_1409212 Ga0496100_1409212_58_393 110
581 3300048913 Ga0496110_0043093 Ga0496110_0043093_3518_3853 110
582 3300053077 Ga0495601_0000196 Ga0495601_0000196_9770_10105 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

16

106

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.875 22 100
1ybx-assembly1.cif.gz_A conserved hypothetical protein cth-383 from clostridium thermocellum 0.8687 13 101
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.8685 9 102
6r5y-assembly3.cif.gz_E 8-bladed beta-propeller formed by two 4-bladed fragments 0.8546 36 63
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.8542 27 100
ID Description Score Start End Superfamily
af_O82230_71_179_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8667 11 106 3.30.1310.10
af_P0A8B5_1_109_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8623 12 104 3.30.1310.10
1ybxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8573 13 101 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8457 28 95 3.30.1310.10
af_P9WNR9_2_108_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8365 6 104 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A832LQG7-F1-model_v4 Nucleoid-associated protein ENS20_05105 0.9867 11 106 GO:0003677
GO:0005829
GO:0043590
AF-A0A1G3CGR1-F1-model_v4 Nucleoid-associated protein, YbaB/EbfC family 0.9745 12 99 GO:0003677
GO:0005829
AF-A0A7V2KTR4-F1-model_v4 Nucleoid-associated protein G4O10_03575 0.9711 14 104 GO:0003677
GO:0005829
GO:0043590
AF-A0A6L7X336-F1-model_v4 Nucleoid-associated protein F4Y02_10920 0.9704 16 105 GO:0003677
GO:0005829
GO:0043590
AF-A0A271J7F5-F1-model_v4 Nucleoid-associated protein B1759_12995 0.9685 8 104 GO:0003677
GO:0005829
GO:0043590

Feature Viewer

pLDDT pTM Quality
82.77 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map