F466147

General Info

Members Datasets Scaffolds Average Seq Length
582 268 1164 318

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100106204|Ga0070684_1001062042
Length 334
Sequence MNATRKTIGIVGARGHAGAELIRLIAVHPALELTYVSSREWAGQRVDSHLPEFRGDLRYSAPAHEDLPGLGADIVVLALPNGKAAACVAAFDAAGADPLIVDLSADYRFDAHWYYGLPELTRERWRGERRIANPGCYATAMALAISPLKDLLAAPPVCFGVSGYSGAGTTPSERNDPDKLHDNLMPYALIGHLHEKEAAYRLGVPVDFMPHVAPHFRGLTVTSNLYLARGLKRDEVLARFRHAYADEPLVSLVDDAPWVSRIAGRHHAEIGGITVSPDGKRVVVVATLDNLLKGAATQALQNINRAIGVDEFTAIPLPPSPTTDVHAPAGSGHD

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
83 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
240 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
241 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
242 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
243 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
244 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
245 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
246 2739367700 Dyella sp. YR388 Isolate Unclassified
247 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
248 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
249 2818991457 Xanthomonas translucens 569 Isolate Unclassified
250 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
251 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
252 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
253 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
254 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
255 2884411467 Dyella sp. AD56 Isolate Rhizosphere
256 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
257 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
258 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
259 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
260 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
261 2919085039 Luteibacter sp. 1214 Isolate Unclassified
262 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
263 2919404418 Luteibacter sp. 3190 Isolate Unclassified
264 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
265 2928963466 Dyella japonica 1073 Isolate Unclassified
266 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
267 2941471342 Luteibacter sp. 621 Isolate Unclassified
268 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0.52
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.37
Nodule 0
Rhizoplane 3.09
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100106204 3300005535 Bacteria 2513
2 SwRhRL2b_contig_723762 2162886007 Bacteria 4988
3 JGI24741J21665_1004716 3300001915 Bacteria 2966
4 JGI24740J21852_10003993 3300001979 Bacteria 6403
5 JGI24737J22298_10009376 3300001990 Bacteria 3259
6 JGI24735J21928_10002797 3300002067 Bacteria 6021
7 JGI25156J39149_1000463 3300002705 Bacteria 24552
8 JGI25156J39149_1013681 3300002705 Bacteria 1709
9 JGI25156J39149_1013976 3300002705 Bacteria 1676
10 JGI25162J39368_1000163 3300002737 Bacteria 74121
11 JGI25162J39368_1000895 3300002737 Bacteria 19431
12 JGI25162J39368_1001323 3300002737 Bacteria 13849
13 JGI25162J39368_1001410 3300002737 Bacteria 13098
14 JGI25157J39369_1000229 3300002741 Bacteria 43921
15 JGI25157J39369_1000575 3300002741 Bacteria 21822
16 JGI25157J39369_1000654 3300002741 Bacteria 19192
17 JGI25157J39369_1004101 3300002741 Bacteria 2735
18 JGI25163J39215_1000538 3300002771 Bacteria 11102
19 JGI25164J39214_1000045 3300002772 Bacteria 125909
20 JGI25164J39214_1000285 3300002772 Bacteria 35663
21 JGI25164J39214_1000485 3300002772 Bacteria 19655
22 JGI25164J39214_1000690 3300002772 Bacteria 13175
23 JGI25165J46597_1000072 3300003214 Bacteria 192184
24 JGI25165J46597_1000215 3300003214 Bacteria 81941
25 JGI25165J46597_1000812 3300003214 Bacteria 23523
26 rootH1_10025459 3300003316 Bacteria 4344
27 rootH2_10012587 3300003320 Bacteria 26291
28 Ga0055538_1001046 3300003751 Bacteria 6219
29 Ga0055527_1000209 3300003760 Bacteria 37913
30 Ga0055527_1001498 3300003760 Bacteria 4837
31 Ga0055535_1000124 3300003761 Bacteria 81941
32 Ga0055535_1000451 3300003761 Bacteria 37913
33 Ga0055535_1000831 3300003761 Bacteria 22164
34 Ga0055535_1008706 3300003761 Bacteria 1804
35 Ga0055542_1000197 3300003762 Bacteria 74121
36 Ga0055542_1000242 3300003762 Bacteria 62798
37 Ga0055542_1000349 3300003762 Bacteria 48521
38 Ga0055542_1000466 3300003762 Bacteria 37913
39 Ga0055529_1000197 3300003763 Bacteria 81941
40 Ga0055529_1000204 3300003763 Bacteria 78293
41 Ga0055529_1000671 3300003763 Bacteria 23784
42 Ga0055536_1002005 3300003781 Bacteria 11676
43 Ga0058692_1000006 3300003856 Bacteria 398109
44 Ga0058692_1000012 3300003856 Bacteria 318930
45 Ga0065165_1000118 3300005262 Bacteria 134488
46 Ga0065704_10070476 3300005289 Bacteria 23424
47 Ga0065704_10070915 3300005289 Bacteria 14696
48 Ga0070658_10020563 3300005327 Bacteria 5291
49 Ga0070658_10094950 3300005327 Bacteria 2461
50 Ga0070666_10000005 3300005335 Bacteria 343092
51 Ga0070680_100001147 3300005336 Bacteria 18999
52 Ga0070680_100054615 3300005336 Bacteria 3262
53 Ga0070680_100101701 3300005336 Bacteria 2386
54 Ga0070682_100005899 3300005337 Bacteria 6848
55 Ga0070660_100010300 3300005339 Bacteria 6601
56 Ga0070660_100019495 3300005339 Bacteria 4972
57 Ga0070691_10011407 3300005341 Bacteria 4058
58 Ga0070661_100006026 3300005344 Bacteria 8341
59 Ga0070661_100083337 3300005344 Bacteria 2362
60 Ga0070661_100122322 3300005344 Bacteria 1950
61 Ga0070692_10000760 3300005345 Bacteria 10573
62 Ga0070668_100269442 3300005347 Bacteria 1419
63 Ga0070671_100313027 3300005355 Bacteria 1337
64 Ga0070659_100359423 3300005366 Bacteria 1223
65 Ga0070667_100000061 3300005367 Bacteria 143754
66 Ga0070667_100130011 3300005367 Bacteria 2197
67 Ga0070714_100053430 3300005435 Bacteria 3448
68 Ga0070713_100230093 3300005436 Bacteria 1685
69 Ga0070663_100000098 3300005455 Bacteria 39429
70 Ga0070663_100006804 3300005455 Bacteria 6912
71 Ga0070663_100217132 3300005455 Bacteria 1500
72 Ga0070663_100230760 3300005455 Bacteria 1457
73 Ga0070662_100015623 3300005457 Bacteria 5089
74 Ga0070681_10000478 3300005458 Bacteria 32685
75 Ga0070681_10002606 3300005458 Bacteria 16546
76 Ga0070681_10006071 3300005458 Bacteria 11717
77 Ga0070681_10008891 3300005458 Bacteria 9873
78 Ga0070681_10051954 3300005458 Bacteria 4087
79 Ga0070681_10151614 3300005458 Bacteria 2244
80 Ga0070681_10181467 3300005458 Bacteria 2026
81 Ga0070685_10016889 3300005466 Bacteria 3895
82 Ga0070679_100000159 3300005530 Bacteria 53995
83 Ga0070679_100001102 3300005530 Bacteria 23613
84 Ga0070679_100005521 3300005530 Bacteria 11717
85 Ga0070679_100258561 3300005530 Bacteria 1696
86 Ga0070684_100015112 3300005535 Bacteria 6276
87 Ga0070684_100268297 3300005535 Bacteria 1562
88 Ga0068853_100000998 3300005539 Bacteria 19938
89 Ga0068853_100015777 3300005539 Bacteria 6204
90 Ga0068853_100032032 3300005539 Bacteria 4451
91 Ga0068853_100249431 3300005539 Bacteria 1628
92 Ga0070696_100013121 3300005546 Bacteria 5559
93 Ga0070696_100019136 3300005546 Bacteria 4635
94 Ga0070696_100021589 3300005546 Bacteria 4366
95 Ga0070696_100032241 3300005546 Bacteria 3595
96 Ga0070693_100024182 3300005547 Bacteria 3255
97 Ga0070693_100057716 3300005547 Bacteria 2245
98 Ga0068855_100042451 3300005563 Bacteria 5388
99 Ga0068855_100054823 3300005563 Bacteria 4685
100 Ga0068857_100046007 3300005577 Bacteria 3872
101 Ga0068854_100014236 3300005578 Bacteria 5238
102 Ga0068854_100017938 3300005578 Bacteria 4744
103 Ga0068854_100135998 3300005578 Bacteria 1881
104 Ga0068854_100198100 3300005578 Bacteria 1577
105 Ga0068856_100000416 3300005614 Bacteria 46989
106 Ga0068856_100004196 3300005614 Bacteria 14393
107 Ga0068856_100030189 3300005614 Bacteria 5299
108 Ga0068856_100132041 3300005614 Bacteria 2502
109 Ga0068852_100103211 3300005616 Bacteria 2578
110 Ga0068859_100507566 3300005617 Bacteria 1301
111 Ga0068864_100022244 3300005618 Bacteria 5314
112 Ga0068864_100175186 3300005618 Bacteria 1958
113 Ga0068851_10013971 3300005834 Bacteria 3805
114 Ga0068863_100040023 3300005841 Bacteria 4457
115 Ga0068863_100046769 3300005841 Bacteria 4107
116 Ga0068858_100237183 3300005842 Bacteria 1730
117 Ga0068860_100034319 3300005843 Bacteria 4865
118 Ga0097621_100039782 3300006237 Bacteria 3778
119 Ga0068865_100217977 3300006881 Bacteria 1490
120 Ga0097620_100507600 3300006931 Bacteria 1301
121 Ga0105240_10008662 3300009093 Bacteria 14524
122 Ga0105240_10028816 3300009093 Bacteria 7243
123 Ga0105240_10090461 3300009093 Bacteria 3740
124 Ga0105240_10090630 3300009093 Bacteria 3737
125 Ga0105240_10381373 3300009093 Bacteria 1592
126 Ga0105243_10004981 3300009148 Bacteria 10410
127 Ga0105241_10273475 3300009174 Bacteria 1440
128 Ga0105241_10358131 3300009174 Bacteria 1269
129 Ga0105248_10000294 3300009177 Bacteria 59302
130 Ga0105248_10216895 3300009177 Bacteria 2155
131 Ga0105237_10000007 3300009545 Bacteria 367690
132 Ga0105237_10000637 3300009545 Bacteria 48955
133 Ga0105237_10071696 3300009545 Bacteria 3459
134 Ga0105238_10003835 3300009551 Bacteria 14930
135 Ga0105238_10036497 3300009551 Bacteria 4996
136 Ga0105238_10054370 3300009551 Bacteria 4020
137 Ga0105238_10073353 3300009551 Bacteria 3417
138 Ga0105238_10210926 3300009551 Bacteria 1918
139 Ga0105249_10000272 3300009553 Bacteria 54568
140 Ga0105249_10036550 3300009553 Bacteria 4455
141 Ga0105239_10000030 3300010375 Bacteria 233669
142 Ga0105239_10039254 3300010375 Bacteria 5187
143 Ga0105239_10065148 3300010375 Bacteria 4001
144 Ga0105239_10067311 3300010375 Bacteria 3935
145 Ga0105239_10106232 3300010375 Bacteria 3110
146 Ga0105246_10003959 3300011119 Bacteria 8977
147 Ga0157373_10026888 3300013100 Bacteria 4153
148 Ga0157373_10248043 3300013100 Bacteria 1259
149 Ga0157371_10010073 3300013102 Bacteria 7390
150 Ga0157371_10046887 3300013102 Bacteria 3071
151 Ga0157370_10000293 3300013104 Bacteria 63396
152 Ga0157370_10001525 3300013104 Bacteria 28645
153 Ga0157370_10005088 3300013104 Bacteria 14834
154 Ga0157370_10007298 3300013104 Bacteria 12062
155 Ga0157370_10167371 3300013104 Bacteria 2044
156 Ga0157369_10012900 3300013105 Bacteria 9472
157 Ga0157374_10019015 3300013296 Bacteria 6076
158 Ga0157374_10039886 3300013296 Bacteria 4323
159 Ga0163162_10000489 3300013306 Bacteria 36741
160 Ga0157372_10003283 3300013307 Bacteria 17484
161 Ga0157372_10007646 3300013307 Bacteria 11492
162 Ga0157372_10011205 3300013307 Bacteria 9538
163 Ga0157372_10056190 3300013307 Bacteria 4398
164 Ga0157372_10329461 3300013307 Bacteria 1778
165 Ga0157372_10505534 3300013307 Bacteria 1409
166 Ga0157375_10014055 3300013308 Bacteria 7139
167 Ga0163163_10053838 3300014325 Bacteria 3974
168 Ga0163163_10443403 3300014325 Bacteria 1358
169 Ga0182008_10007901 3300014497 Bacteria 5838
170 Ga0182008_10033442 3300014497 Bacteria 2579
171 Ga0157379_10006837 3300014968 Bacteria 9858
172 Ga0157376_10038489 3300014969 Bacteria 3892
173 Ga0182005_1000028 3300015265 Bacteria 221889
174 Ga0182005_1004772 3300015265 Bacteria 4323
175 Ga0183369_1007 3300015685 Bacteria 414878
176 Ga0183368_1003 3300015687 Bacteria 1276390
177 Ga0163161_10086921 3300017792 Bacteria 2308
178 Ga0206354_10560480 3300020081 Bacteria 6450
179 Ga0206353_10613403 3300020082 Bacteria 1238
180 Ga0154015_1237743 3300020610 Bacteria 3202
181 Ga0209435_102200 3300025206 Bacteria 2314
182 Ga0209435_108134 3300025206 Bacteria 1157
183 Ga0209784_100120 3300025224 Bacteria 82684
184 Ga0209674_100012 3300025226 Bacteria 950162
185 Ga0209674_101824 3300025226 Bacteria 5080
186 Ga0209674_102139 3300025226 Bacteria 4455
187 Ga0209672_100005 3300025228 Bacteria 1069303
188 Ga0209672_100277 3300025228 Bacteria 37238
189 Ga0209672_100911 3300025228 Bacteria 13436
190 Ga0209563_100023 3300025230 Bacteria 636844
191 Ga0207427_100013 3300025231 Bacteria 581419
192 Ga0207427_100055 3300025231 Bacteria 209093
193 Ga0207427_100244 3300025231 Bacteria 43765
194 Ga0207427_100248 3300025231 Bacteria 42623
195 Ga0207427_103884 3300025231 Bacteria 2810
196 Ga0209437_100015 3300025233 Bacteria 713457
197 Ga0209437_100020 3300025233 Bacteria 656374
198 Ga0209437_100079 3300025233 Bacteria 275948
199 Ga0209437_100161 3300025233 Bacteria 148264
200 Ga0209437_100224 3300025233 Bacteria 101515
201 Ga0209437_102166 3300025233 Bacteria 3939
202 Ga0209437_103650 3300025233 Bacteria 2758
203 Ga0209258_100006 3300025242 Bacteria 1069303
204 Ga0209258_100049 3300025242 Bacteria 358328
205 Ga0209258_100186 3300025242 Bacteria 132381
206 Ga0209258_103422 3300025242 Bacteria 3427
207 Ga0209646_1000467 3300025246 Bacteria 20487
208 Ga0209646_1000760 3300025246 Bacteria 11160
209 Ga0209026_1000037 3300025250 Bacteria 282562
210 Ga0209026_1000204 3300025250 Bacteria 81999
211 Ga0209026_1000375 3300025250 Bacteria 41000
212 Ga0209026_1001302 3300025250 Bacteria 11274
213 Ga0209148_1000005 3300025254 Bacteria 1806504
214 Ga0209148_1000010 3300025254 Bacteria 1265567
215 Ga0209148_1000012 3300025254 Bacteria 1069303
216 Ga0209148_1000073 3300025254 Bacteria 320851
217 Ga0209148_1001285 3300025254 Bacteria 13676
218 Ga0209759_1000103 3300025256 Bacteria 153195
219 Ga0209759_1000672 3300025256 Bacteria 31426
220 Ga0209759_1013336 3300025256 Bacteria 2229
221 Ga0209233_1000009 3300025261 Bacteria 1265567
222 Ga0209233_1000020 3300025261 Bacteria 798224
223 Ga0209233_1000063 3300025261 Bacteria 395810
224 Ga0209233_1000147 3300025261 Bacteria 186517
225 Ga0209233_1011780 3300025261 Bacteria 2566
226 Ga0209455_1000008 3300025272 Bacteria 1069303
227 Ga0209455_1000082 3300025272 Bacteria 257909
228 Ga0209455_1000177 3300025272 Bacteria 106026
229 Ga0209455_1000344 3300025272 Bacteria 43864
230 Ga0209455_1006368 3300025272 Bacteria 3494
231 Ga0209676_1000034 3300025292 Bacteria 460125
232 Ga0209256_1004365 3300025299 Bacteria 8952
233 Ga0207426_1011861 3300025302 Bacteria 3298
234 Ga0207656_10046545 3300025321 Bacteria 1861
235 Ga0207680_10000005 3300025903 Bacteria 660983
236 Ga0207647_10000084 3300025904 Bacteria 71295
237 Ga0207647_10000747 3300025904 Bacteria 25485
238 Ga0207647_10010317 3300025904 Bacteria 6599
239 Ga0207705_10001128 3300025909 Bacteria 21726
240 Ga0207705_10008538 3300025909 Bacteria 7469
241 Ga0207705_10010341 3300025909 Bacteria 6787
242 Ga0207705_10015167 3300025909 Bacteria 5538
243 Ga0207705_10074272 3300025909 Bacteria 2468
244 Ga0207705_10081318 3300025909 Bacteria 2361
245 Ga0207654_10004928 3300025911 Bacteria 6754
246 Ga0207707_10000032 3300025912 Bacteria 158499
247 Ga0207707_10000274 3300025912 Bacteria 55548
248 Ga0207707_10002692 3300025912 Bacteria 15870
249 Ga0207707_10003858 3300025912 Bacteria 13289
250 Ga0207707_10011681 3300025912 Bacteria 7643
251 Ga0207707_10058093 3300025912 Bacteria 3367
252 Ga0207707_10161666 3300025912 Bacteria 1958
253 Ga0207695_10001749 3300025913 Bacteria 34474
254 Ga0207695_10003349 3300025913 Bacteria 22657
255 Ga0207695_10003804 3300025913 Bacteria 20926
256 Ga0207695_10004269 3300025913 Bacteria 19628
257 Ga0207695_10019259 3300025913 Bacteria 7860
258 Ga0207695_10149108 3300025913 Bacteria 2279
259 Ga0207695_10171773 3300025913 Bacteria 2093
260 Ga0207671_10000074 3300025914 Bacteria 156482
261 Ga0207671_10009987 3300025914 Bacteria 7885
262 Ga0207671_10103904 3300025914 Bacteria 2155
263 Ga0207660_10000431 3300025917 Bacteria 27636
264 Ga0207660_10001041 3300025917 Bacteria 18343
265 Ga0207660_10002224 3300025917 Bacteria 12842
266 Ga0207660_10014264 3300025917 Bacteria 5221
267 Ga0207660_10045926 3300025917 Bacteria 3080
268 Ga0207660_10187936 3300025917 Bacteria 1607
269 Ga0207657_10001633 3300025919 Bacteria 24148
270 Ga0207657_10002096 3300025919 Bacteria 21574
271 Ga0207649_10008395 3300025920 Bacteria 5629
272 Ga0207649_10157664 3300025920 Bacteria 1570
273 Ga0207652_10000026 3300025921 Bacteria 156183
274 Ga0207652_10000715 3300025921 Bacteria 32237
275 Ga0207652_10005288 3300025921 Bacteria 10475
276 Ga0207652_10234641 3300025921 Bacteria 1653
277 Ga0207694_10009159 3300025924 Bacteria 7472
278 Ga0207694_10011255 3300025924 Bacteria 6757
279 Ga0207694_10074068 3300025924 Bacteria 2665
280 Ga0207694_10098035 3300025924 Bacteria 2320
281 Ga0207694_10332149 3300025924 Bacteria 1256
282 Ga0207650_10169429 3300025925 Bacteria 1735
283 Ga0207700_10141960 3300025928 Bacteria 1974
284 Ga0207664_10098555 3300025929 Bacteria 2410
285 Ga0207690_10001160 3300025932 Bacteria 16674
286 Ga0207690_10005361 3300025932 Bacteria 7558
287 Ga0207706_10026570 3300025933 Bacteria 5181
288 Ga0207709_10007378 3300025935 Bacteria 6126
289 Ga0207711_10000850 3300025941 Bacteria 29523
290 Ga0207689_10042832 3300025942 Bacteria 3743
291 Ga0207661_10174231 3300025944 Bacteria 1874
292 Ga0207667_10002690 3300025949 Bacteria 21986
293 Ga0207667_10005247 3300025949 Bacteria 15812
294 Ga0207667_10011214 3300025949 Bacteria 10429
295 Ga0207667_10251913 3300025949 Bacteria 1806
296 Ga0207667_10321237 3300025949 Bacteria 1581
297 Ga0207712_10000339 3300025961 Bacteria 42473
298 Ga0207712_10001053 3300025961 Bacteria 19387
299 Ga0207712_10026904 3300025961 Bacteria 3837
300 Ga0207668_10204173 3300025972 Bacteria 1576
301 Ga0207640_10002743 3300025981 Bacteria 9424
302 Ga0207640_10006105 3300025981 Bacteria 6586
303 Ga0207640_10008198 3300025981 Bacteria 5791
304 Ga0207640_10030042 3300025981 Bacteria 3343
305 Ga0207640_10031945 3300025981 Bacteria 3260
306 Ga0207640_10113448 3300025981 Bacteria 1926
307 Ga0207658_10000166 3300025986 Bacteria 70441
308 Ga0207658_10084659 3300025986 Bacteria 2440
309 Ga0207639_10002830 3300026041 Bacteria 11641
310 Ga0207639_10012112 3300026041 Bacteria 6001
311 Ga0207639_10014786 3300026041 Bacteria 5497
312 Ga0207639_10022813 3300026041 Bacteria 4512
313 Ga0207678_10001403 3300026067 Bacteria 22155
314 Ga0207678_10002211 3300026067 Bacteria 17577
315 Ga0207678_10003668 3300026067 Bacteria 13806
316 Ga0207678_10011703 3300026067 Bacteria 7699
317 Ga0207678_10022074 3300026067 Bacteria 5577
318 Ga0207678_10111048 3300026067 Bacteria 2339
319 Ga0207678_10120294 3300026067 Bacteria 2241
320 Ga0207702_10000185 3300026078 Bacteria 74602
321 Ga0207702_10008548 3300026078 Bacteria 8628
322 Ga0207702_10096143 3300026078 Bacteria 2604
323 Ga0207702_10184847 3300026078 Bacteria 1921
324 Ga0207641_10064929 3300026088 Bacteria 3121
325 Ga0207641_10078202 3300026088 Bacteria 2864
326 Ga0207648_10176343 3300026089 Bacteria 1890
327 Ga0207676_10066337 3300026095 Bacteria 2878
328 Ga0207674_10002798 3300026116 Bacteria 21725
329 Ga0207674_10018482 3300026116 Bacteria 7576
330 Ga0207674_10054334 3300026116 Bacteria 4078
331 Ga0207674_10105380 3300026116 Bacteria 2798
332 Ga0207698_10001786 3300026142 Bacteria 12566
333 Ga0207698_10002926 3300026142 Bacteria 10208
334 Ga0207698_10100907 3300026142 Bacteria 2392
335 Ga0209371_1000007 3300027312 Bacteria 1050654
336 Ga0209371_1000016 3300027312 Bacteria 646301
337 Ga0268266_10000004 3300028379 Bacteria 1495817
338 Ga0268264_10056756 3300028381 Bacteria 3274
339 Ga0268256_1000008 3300030500 Bacteria 1050654
340 Ga0268256_1000015 3300030500 Bacteria 646300
341 Ga0307516_10106044 3300031730 Bacteria 2621
342 Ga0307412_10003347 3300031911 Bacteria 8905
343 Ga0307412_10100670 3300031911 Bacteria 2043
344 Ga0307409_100317436 3300031995 Bacteria 1457
345 Ga0307414_10004643 3300032004 Bacteria 7480
346 Ga0307414_10008972 3300032004 Bacteria 5717
347 Ga0307414_10041317 3300032004 Bacteria 3123
348 Ga0307414_10046183 3300032004 Bacteria 2987
349 Ga0307411_10075577 3300032005 Bacteria 2300
350 Ga0307510_10005230 3300033180 Bacteria 15426
351 Ga0307510_10021816 3300033180 Bacteria 7452
352 Ga0395899_0016207 3300037312 Bacteria 5679
353 Ga0395899_0085820 3300037312 Bacteria 2287
354 Ga0395899_0219217 3300037312 Bacteria 1318
355 Ga0395900_0005984 3300037418 Bacteria 12701
356 Ga0395900_0007251 3300037418 Bacteria 11478
357 Ga0395900_0008909 3300037418 Bacteria 10296
358 Ga0395900_0047569 3300037418 Bacteria 4417
359 Ga0395898_0000049 3300037466 Bacteria 284792
360 Ga0395898_0003336 3300037466 Bacteria 18023
361 Ga0395898_0004927 3300037466 Bacteria 14491
362 Ga0395898_0012224 3300037466 Bacteria 8876
363 Ga0395898_0114074 3300037466 Bacteria 2589
364 Ga0395905_0084163 3300037471 Bacteria 2980
365 Ga0395901_0004732 3300038443 Bacteria 13738
366 Ga0395901_0005132 3300038443 Bacteria 13220
367 Ga0395901_0009707 3300038443 Bacteria 9760
368 Ga0395901_0010230 3300038443 Bacteria 9503
369 Ga0395901_0165825 3300038443 Bacteria 2320
370 Ga0395901_0186033 3300038443 Bacteria 2178
371 Ga0395901_0194078 3300038443 Bacteria 2129
372 Ga0237816_02346 3300039145 Bacteria 1459
373 Ga0436365_0838762 3300039437 Bacteria 3305
374 Ga0439436_0000156 3300041404 Bacteria 15891
375 Ga0451800_0027863 3300041459 Bacteria 1854
376 Ga0451800_0163290 3300041459 Bacteria 12437
377 Ga0451806_619891 3300041462 Bacteria 4955
378 Ga0451804_0794885 3300041463 Bacteria 2792
379 Ga0451807_1039361 3300041486 Bacteria 5369
380 Ga0451853_2514762 3300041512 Bacteria 2017
381 Ga0439459_0006387 3300042438 Bacteria 1962
382 Ga0466969_0003903 3300044656 Bacteria 7914
383 Ga0466965_0000550 3300044683 Bacteria 13502
384 Ga0466966_0001316 3300044684 Bacteria 15936
385 Ga0466966_0013296 3300044684 Bacteria 5450
386 Ga0466961_0004179 3300044693 Bacteria 9020
387 Ga0466961_0009981 3300044693 Bacteria 6051
388 Ga0466961_0013180 3300044693 Bacteria 5287
389 Ga0466963_0162984 3300044694 Bacteria 1552
390 Ga0466971_0006496 3300044719 Bacteria 5082
391 Ga0466971_0019590 3300044719 Bacteria 3006
392 Ga0466957_0028237 3300044842 Bacteria 3339
393 Ga0466957_0137941 3300044842 Bacteria 1569
394 Ga0466960_0005921 3300044901 Bacteria 4875
395 Ga0466959_0010673 3300045049 Bacteria 6576
396 Ga0466959_0045661 3300045049 Bacteria 3226
397 Ga0466958_0020369 3300045836 Bacteria 3867
398 Ga0495627_025570 3300046453 Bacteria 1913
399 Ga0495638_0000234 3300046460 Bacteria 75860
400 Ga0495650_0000247 3300046471 Bacteria 106616
401 Ga0495585_0000104 3300046492 Bacteria 90097
402 Ga0495607_0008360 3300046501 Bacteria 7080
403 Ga0495606_0000401 3300046507 Bacteria 73149
404 Ga0495606_0005269 3300046507 Bacteria 12464
405 Ga0495610_0002689 3300046512 Bacteria 14657
406 Ga0495648_0000914 3300046524 Bacteria 30767
407 Ga0495622_0006636 3300046557 Bacteria 5364
408 Ga0495633_0032712 3300046558 Bacteria 2511
409 Ga0495625_0005535 3300046660 Bacteria 11474
410 Ga0495625_0016176 3300046660 Bacteria 5876
411 Ga0495661_0000199 3300046665 Bacteria 69536
412 Ga0495670_0008599 3300046691 Bacteria 5024
413 Ga0495649_0000553 3300046694 Bacteria 31708
414 Ga0495660_0000583 3300046810 Bacteria 29142
415 Ga0495673_0000004 3300047469 Bacteria 1354526
416 Ga0495686_0000017 3300047472 Bacteria 435554
417 Ga0496100_0115146 3300048903 Bacteria 1874
418 Ga0496104_0030305 3300048907 Bacteria 5026
419 Ga0496105_0003042 3300048908 Bacteria 12333
420 Ga0496106_0007333 3300048909 Bacteria 8150
421 Ga0496106_0111966 3300048909 Bacteria 2126
422 Ga0496107_0094468 3300048910 Bacteria 2188
423 Ga0496108_0158003 3300048911 Bacteria 1958
424 Ga0496113_0014146 3300048916 Bacteria 5434
425 Ga0496113_0193342 3300048916 Bacteria 1615
426 Ga0496114_0016091 3300048917 Bacteria 6020
427 Ga0496115_0000073 3300048918 Bacteria 90289
428 Ga0496115_0000206 3300048918 Bacteria 54824
429 Ga0496115_0000946 3300048918 Bacteria 21065
430 Ga0496117_0008476 3300048920 Bacteria 9759
431 Ga0496117_0022641 3300048920 Bacteria 5035
432 Ga0496117_0025189 3300048920 Bacteria 4683
433 Ga0496117_0098077 3300048920 Bacteria 1864
434 Ga0496118_0003118 3300048921 Bacteria 21238
435 Ga0496118_0004645 3300048921 Bacteria 16112
436 Ga0496118_0006962 3300048921 Bacteria 12210
437 Ga0496118_0015853 3300048921 Bacteria 6948
438 Ga0496118_0019362 3300048921 Bacteria 6086
439 Ga0496119_0001081 3300048922 Bacteria 34425
440 Ga0496119_0014335 3300048922 Bacteria 6214
441 Ga0496120_0001250 3300048923 Bacteria 31970
442 Ga0496120_0001337 3300048923 Bacteria 30388
443 Ga0496121_0000045 3300048924 Bacteria 336130
444 Ga0496121_0000743 3300048924 Bacteria 59998
445 Ga0496121_0037519 3300048924 Bacteria 4303
446 Ga0496121_0131079 3300048924 Bacteria 1876
447 Ga0496121_0315768 3300048924 Bacteria 1054
448 Ga0496122_0000374 3300048925 Bacteria 96140
449 Ga0496122_0025528 3300048925 Bacteria 5128
450 Ga0496122_0186607 3300048925 Bacteria 1229
451 Ga0496123_0001233 3300048926 Bacteria 37229
452 Ga0496123_0039389 3300048926 Bacteria 3307
453 Ga0496124_0022699 3300048927 Bacteria 5746
454 Ga0496124_0142336 3300048927 Bacteria 1891
455 Ga0496125_0015635 3300048928 Bacteria 7323
456 Ga0496125_0043076 3300048928 Bacteria 3837
457 Ga0496126_0000169 3300048929 Bacteria 150322
458 Ga0496126_0003516 3300048929 Bacteria 19717
459 Ga0496126_0010323 3300048929 Bacteria 9803
460 Ga0496126_0072018 3300048929 Bacteria 3075
461 Ga0496126_0091306 3300048929 Bacteria 2678
462 Ga0496126_0176597 3300048929 Bacteria 1816
463 Ga0495682_0048565 3300049460 Bacteria 1547
464 Ga0501031_0001179 3300049568 Bacteria 15915
465 Ga0501031_0091146 3300049568 Bacteria 1988
466 Ga0501031_0168800 3300049568 Bacteria 1430
467 Ga0501032_0008047 3300049569 Bacteria 7685
468 Ga0501032_0127980 3300049569 Bacteria 1677
469 Ga0501033_0006957 3300049570 Bacteria 8831
470 Ga0501033_0040160 3300049570 Bacteria 3493
471 Ga0501033_0081765 3300049570 Bacteria 2369
472 Ga0501033_0168701 3300049570 Bacteria 1572
473 Ga0501034_0000091 3300049571 Bacteria 164456
474 Ga0501034_0002029 3300049571 Bacteria 25488
475 Ga0501034_0010969 3300049571 Bacteria 9412
476 Ga0501034_0031976 3300049571 Bacteria 5345
477 Ga0501034_0070728 3300049571 Bacteria 3500
478 Ga0501036_0010107 3300049572 Bacteria 7779
479 Ga0501036_0077353 3300049572 Bacteria 2815
480 Ga0501036_0206056 3300049572 Bacteria 1653
481 Ga0501037_0014206 3300049573 Bacteria 5863
482 Ga0501037_0037219 3300049573 Bacteria 3587
483 Ga0501037_0054282 3300049573 Bacteria 2930
484 Ga0501037_0157137 3300049573 Bacteria 1622
485 Ga0501038_0017649 3300049574 Bacteria 6450
486 Ga0501038_0078887 3300049574 Bacteria 2777
487 Ga0501043_0002924 3300049579 Bacteria 14260
488 Ga0501043_0018714 3300049579 Bacteria 5434
489 Ga0501043_0031687 3300049579 Bacteria 4156
490 Ga0501043_0091289 3300049579 Bacteria 2394
491 Ga0501043_0289219 3300049579 Bacteria 1255
492 Ga0501046_0006397 3300049580 Bacteria 10444
493 Ga0501046_0078849 3300049580 Bacteria 2547
494 Ga0501047_0001140 3300049581 Bacteria 26350
495 Ga0501047_0009456 3300049581 Bacteria 9208
496 Ga0501047_0015754 3300049581 Bacteria 7205
497 Ga0501047_0041058 3300049581 Bacteria 4471
498 Ga0501047_0042030 3300049581 Bacteria 4417
499 Ga0501047_0082045 3300049581 Bacteria 3099
500 Ga0501048_0018513 3300049582 Bacteria 5120
501 Ga0501068_0157228 3300049584 Bacteria 1432
502 Ga0501068_0202825 3300049584 Bacteria 1258
503 Ga0501069_0012229 3300049585 Bacteria 4560
504 Ga0501069_0060579 3300049585 Bacteria 2113
505 Ga0501070_0000955 3300049586 Bacteria 26067
506 Ga0501070_0004034 3300049586 Bacteria 12612
507 Ga0501070_0009100 3300049586 Bacteria 8398
508 Ga0501070_0017920 3300049586 Bacteria 5945
509 Ga0501070_0018070 3300049586 Bacteria 5916
510 Ga0501070_0027783 3300049586 Bacteria 4745
511 Ga0501070_0050818 3300049586 Bacteria 3441
512 Ga0501070_0090101 3300049586 Bacteria 2538
513 Ga0501071_0006093 3300049587 Bacteria 7818
514 Ga0501073_0009510 3300049589 Bacteria 7176
515 Ga0501073_0052005 3300049589 Bacteria 2869
516 Ga0501073_0072705 3300049589 Bacteria 2395
517 Ga0501074_0014060 3300049590 Bacteria 5819
518 Ga0501074_0014638 3300049590 Bacteria 5705
519 Ga0501074_0105751 3300049590 Bacteria 2015
520 Ga0501076_0430481 3300049592 Bacteria 1086
521 Ga0501077_0008784 3300049593 Bacteria 6271
522 Ga0501225_0010582 3300049705 Bacteria 2611
523 Ga0501079_0123108 3300049741 Bacteria 2017
524 Ga0501080_0002935 3300049742 Bacteria 14979
525 Ga0501080_0004845 3300049742 Bacteria 11997
526 Ga0501080_0019215 3300049742 Bacteria 6327
527 Ga0501080_0028480 3300049742 Bacteria 5197
528 Ga0501080_0049529 3300049742 Bacteria 3910
529 Ga0501080_0051332 3300049742 Bacteria 3837
530 Ga0501035_0001816 3300049822 Bacteria 21577
531 Ga0501035_0001954 3300049822 Bacteria 20636
532 Ga0501035_0002968 3300049822 Bacteria 16311
533 Ga0501035_0013820 3300049822 Bacteria 7451
534 Ga0501035_0023994 3300049822 Bacteria 5597
535 Ga0501035_0042186 3300049822 Bacteria 4116
536 Ga0501035_0064924 3300049822 Bacteria 3243
537 Ga0501035_0179982 3300049822 Bacteria 1821
538 Ga0501044_0017427 3300049823 Bacteria 7705
539 Ga0501044_0020806 3300049823 Bacteria 7003
540 Ga0501044_0036954 3300049823 Bacteria 5106
541 Ga0501044_0044350 3300049823 Bacteria 4614
542 Ga0501044_0086361 3300049823 Bacteria 3169
543 Ga0501044_0097311 3300049823 Bacteria 2964
544 Ga0501044_0101792 3300049823 Bacteria 2889
545 Ga0501044_0131218 3300049823 Bacteria 2499
546 Ga0501044_0153508 3300049823 Bacteria 2283
547 Ga0500620_009766 3300053155 Bacteria 2492
548 Ga0500634_0000051 3300053161 Bacteria 52447
549 Ga0501084_0226009 3300054114 Bacteria 1579
550 Ga0466962_0004383 3300061719 Bacteria 6768
551 Ga0466962_0010142 3300061719 Bacteria 4524
552 Ga0466962_0090676 3300061719 Bacteria 1464
553 2538832291 2537561836 Bacteria 3910579
554 2595446780 2593339238 Bacteria 4182970
555 2595449543 2593339239 Bacteria 4124669
556 2643830300 2643221562 Bacteria 4048635
557 2643908028 2643221579 Bacteria 4443405
558 2643915770 2643221581 Bacteria 3893603
559 2687583745 2687453130 Bacteria 4227172
560 2739730279 2739367700 Bacteria 4747630
561 2748016040 2747842501 Bacteria 5293829
562 2819563934 2818991440 Bacteria 4774720
563 2819659931 2818991457 Bacteria 5323295
564 2842783844 2842780639 Bacteria 4337790
565 2842919854 2842918807 Bacteria 4289178
566 2852685244 2852684882 Bacteria 5463342
567 2857446159 2857442823 Bacteria 4562550
568 2884341452 2884338543 Bacteria 4610696
569 2884412122 2884411467 Bacteria 5246714
570 2895498956 2895498888 Bacteria 5283788
571 2895511995 2895511927 Bacteria 6802080
572 2895524939 2895522137 Bacteria 3284416
573 2895527938 2895525241 Bacteria 3388457
574 2904464570 2904463128 Bacteria 4775606
575 2919088345 2919085039 Bacteria 4532964
576 2919131369 2919130084 Bacteria 5301837
577 2919406072 2919404418 Bacteria 4232372
578 2923518677 2923516293 Bacteria 3716336
579 2928967717 2928963466 Bacteria 5165703
580 2929198212 2929195423 Bacteria 5325372
581 2941472902 2941471342 Bacteria 5018624
582 8002872338 8002869464 Bacteria 3588529
583 Ga0070684_100106204
584 SwRhRL2b_contig_723762
585 JGI24741J21665_1004716
586 JGI24740J21852_10003993
587 JGI24737J22298_10009376
588 JGI24735J21928_10002797
589 JGI25156J39149_1000463
590 JGI25156J39149_1013681
591 JGI25156J39149_1013976
592 JGI25162J39368_1000163
593 JGI25162J39368_1000895
594 JGI25162J39368_1001323
595 JGI25162J39368_1001410
596 JGI25157J39369_1000229
597 JGI25157J39369_1000575
598 JGI25157J39369_1000654
599 JGI25157J39369_1004101
600 JGI25163J39215_1000538
601 JGI25164J39214_1000045
602 JGI25164J39214_1000285
603 JGI25164J39214_1000485
604 JGI25164J39214_1000690
605 JGI25165J46597_1000072
606 JGI25165J46597_1000215
607 JGI25165J46597_1000812
608 rootH1_10025459
609 rootH2_10012587
610 Ga0055538_1001046
611 Ga0055527_1000209
612 Ga0055527_1001498
613 Ga0055535_1000124
614 Ga0055535_1000451
615 Ga0055535_1000831
616 Ga0055535_1008706
617 Ga0055542_1000197
618 Ga0055542_1000242
619 Ga0055542_1000349
620 Ga0055542_1000466
621 Ga0055529_1000197
622 Ga0055529_1000204
623 Ga0055529_1000671
624 Ga0055536_1002005
625 Ga0058692_1000006
626 Ga0058692_1000012
627 Ga0065165_1000118
628 Ga0065704_10070476
629 Ga0065704_10070915
630 Ga0070658_10020563
631 Ga0070658_10094950
632 Ga0070666_10000005
633 Ga0070680_100001147
634 Ga0070680_100054615
635 Ga0070680_100101701
636 Ga0070682_100005899
637 Ga0070660_100010300
638 Ga0070660_100019495
639 Ga0070691_10011407
640 Ga0070661_100006026
641 Ga0070661_100083337
642 Ga0070661_100122322
643 Ga0070692_10000760
644 Ga0070668_100269442
645 Ga0070671_100313027
646 Ga0070659_100359423
647 Ga0070667_100000061
648 Ga0070667_100130011
649 Ga0070714_100053430
650 Ga0070713_100230093
651 Ga0070663_100000098
652 Ga0070663_100006804
653 Ga0070663_100217132
654 Ga0070663_100230760
655 Ga0070662_100015623
656 Ga0070681_10000478
657 Ga0070681_10002606
658 Ga0070681_10006071
659 Ga0070681_10008891
660 Ga0070681_10051954
661 Ga0070681_10151614
662 Ga0070681_10181467
663 Ga0070685_10016889
664 Ga0070679_100000159
665 Ga0070679_100001102
666 Ga0070679_100005521
667 Ga0070679_100258561
668 Ga0070684_100015112
669 Ga0070684_100268297
670 Ga0068853_100000998
671 Ga0068853_100015777
672 Ga0068853_100032032
673 Ga0068853_100249431
674 Ga0070696_100013121
675 Ga0070696_100019136
676 Ga0070696_100021589
677 Ga0070696_100032241
678 Ga0070693_100024182
679 Ga0070693_100057716
680 Ga0068855_100042451
681 Ga0068855_100054823
682 Ga0068857_100046007
683 Ga0068854_100014236
684 Ga0068854_100017938
685 Ga0068854_100135998
686 Ga0068854_100198100
687 Ga0068856_100000416
688 Ga0068856_100004196
689 Ga0068856_100030189
690 Ga0068856_100132041
691 Ga0068852_100103211
692 Ga0068859_100507566
693 Ga0068864_100022244
694 Ga0068864_100175186
695 Ga0068851_10013971
696 Ga0068863_100040023
697 Ga0068863_100046769
698 Ga0068858_100237183
699 Ga0068860_100034319
700 Ga0097621_100039782
701 Ga0068865_100217977
702 Ga0097620_100507600
703 Ga0105240_10008662
704 Ga0105240_10028816
705 Ga0105240_10090461
706 Ga0105240_10090630
707 Ga0105240_10381373
708 Ga0105243_10004981
709 Ga0105241_10273475
710 Ga0105241_10358131
711 Ga0105248_10000294
712 Ga0105248_10216895
713 Ga0105237_10000007
714 Ga0105237_10000637
715 Ga0105237_10071696
716 Ga0105238_10003835
717 Ga0105238_10036497
718 Ga0105238_10054370
719 Ga0105238_10073353
720 Ga0105238_10210926
721 Ga0105249_10000272
722 Ga0105249_10036550
723 Ga0105239_10000030
724 Ga0105239_10039254
725 Ga0105239_10065148
726 Ga0105239_10067311
727 Ga0105239_10106232
728 Ga0105246_10003959
729 Ga0157373_10026888
730 Ga0157373_10248043
731 Ga0157371_10010073
732 Ga0157371_10046887
733 Ga0157370_10000293
734 Ga0157370_10001525
735 Ga0157370_10005088
736 Ga0157370_10007298
737 Ga0157370_10167371
738 Ga0157369_10012900
739 Ga0157374_10019015
740 Ga0157374_10039886
741 Ga0163162_10000489
742 Ga0157372_10003283
743 Ga0157372_10007646
744 Ga0157372_10011205
745 Ga0157372_10056190
746 Ga0157372_10329461
747 Ga0157372_10505534
748 Ga0157375_10014055
749 Ga0163163_10053838
750 Ga0163163_10443403
751 Ga0182008_10007901
752 Ga0182008_10033442
753 Ga0157379_10006837
754 Ga0157376_10038489
755 Ga0182005_1000028
756 Ga0182005_1004772
757 Ga0183369_1007
758 Ga0183368_1003
759 Ga0163161_10086921
760 Ga0206354_10560480
761 Ga0206353_10613403
762 Ga0154015_1237743
763 Ga0209435_102200
764 Ga0209435_108134
765 Ga0209784_100120
766 Ga0209674_100012
767 Ga0209674_101824
768 Ga0209674_102139
769 Ga0209672_100005
770 Ga0209672_100277
771 Ga0209672_100911
772 Ga0209563_100023
773 Ga0207427_100013
774 Ga0207427_100055
775 Ga0207427_100244
776 Ga0207427_100248
777 Ga0207427_103884
778 Ga0209437_100015
779 Ga0209437_100020
780 Ga0209437_100079
781 Ga0209437_100161
782 Ga0209437_100224
783 Ga0209437_102166
784 Ga0209437_103650
785 Ga0209258_100006
786 Ga0209258_100049
787 Ga0209258_100186
788 Ga0209258_103422
789 Ga0209646_1000467
790 Ga0209646_1000760
791 Ga0209026_1000037
792 Ga0209026_1000204
793 Ga0209026_1000375
794 Ga0209026_1001302
795 Ga0209148_1000005
796 Ga0209148_1000010
797 Ga0209148_1000012
798 Ga0209148_1000073
799 Ga0209148_1001285
800 Ga0209759_1000103
801 Ga0209759_1000672
802 Ga0209759_1013336
803 Ga0209233_1000009
804 Ga0209233_1000020
805 Ga0209233_1000063
806 Ga0209233_1000147
807 Ga0209233_1011780
808 Ga0209455_1000008
809 Ga0209455_1000082
810 Ga0209455_1000177
811 Ga0209455_1000344
812 Ga0209455_1006368
813 Ga0209676_1000034
814 Ga0209256_1004365
815 Ga0207426_1011861
816 Ga0207656_10046545
817 Ga0207680_10000005
818 Ga0207647_10000084
819 Ga0207647_10000747
820 Ga0207647_10010317
821 Ga0207705_10001128
822 Ga0207705_10008538
823 Ga0207705_10010341
824 Ga0207705_10015167
825 Ga0207705_10074272
826 Ga0207705_10081318
827 Ga0207654_10004928
828 Ga0207707_10000032
829 Ga0207707_10000274
830 Ga0207707_10002692
831 Ga0207707_10003858
832 Ga0207707_10011681
833 Ga0207707_10058093
834 Ga0207707_10161666
835 Ga0207695_10001749
836 Ga0207695_10003349
837 Ga0207695_10003804
838 Ga0207695_10004269
839 Ga0207695_10019259
840 Ga0207695_10149108
841 Ga0207695_10171773
842 Ga0207671_10000074
843 Ga0207671_10009987
844 Ga0207671_10103904
845 Ga0207660_10000431
846 Ga0207660_10001041
847 Ga0207660_10002224
848 Ga0207660_10014264
849 Ga0207660_10045926
850 Ga0207660_10187936
851 Ga0207657_10001633
852 Ga0207657_10002096
853 Ga0207649_10008395
854 Ga0207649_10157664
855 Ga0207652_10000026
856 Ga0207652_10000715
857 Ga0207652_10005288
858 Ga0207652_10234641
859 Ga0207694_10009159
860 Ga0207694_10011255
861 Ga0207694_10074068
862 Ga0207694_10098035
863 Ga0207694_10332149
864 Ga0207650_10169429
865 Ga0207700_10141960
866 Ga0207664_10098555
867 Ga0207690_10001160
868 Ga0207690_10005361
869 Ga0207706_10026570
870 Ga0207709_10007378
871 Ga0207711_10000850
872 Ga0207689_10042832
873 Ga0207661_10174231
874 Ga0207667_10002690
875 Ga0207667_10005247
876 Ga0207667_10011214
877 Ga0207667_10251913
878 Ga0207667_10321237
879 Ga0207712_10000339
880 Ga0207712_10001053
881 Ga0207712_10026904
882 Ga0207668_10204173
883 Ga0207640_10002743
884 Ga0207640_10006105
885 Ga0207640_10008198
886 Ga0207640_10030042
887 Ga0207640_10031945
888 Ga0207640_10113448
889 Ga0207658_10000166
890 Ga0207658_10084659
891 Ga0207639_10002830
892 Ga0207639_10012112
893 Ga0207639_10014786
894 Ga0207639_10022813
895 Ga0207678_10001403
896 Ga0207678_10002211
897 Ga0207678_10003668
898 Ga0207678_10011703
899 Ga0207678_10022074
900 Ga0207678_10111048
901 Ga0207678_10120294
902 Ga0207702_10000185
903 Ga0207702_10008548
904 Ga0207702_10096143
905 Ga0207702_10184847
906 Ga0207641_10064929
907 Ga0207641_10078202
908 Ga0207648_10176343
909 Ga0207676_10066337
910 Ga0207674_10002798
911 Ga0207674_10018482
912 Ga0207674_10054334
913 Ga0207674_10105380
914 Ga0207698_10001786
915 Ga0207698_10002926
916 Ga0207698_10100907
917 Ga0209371_1000007
918 Ga0209371_1000016
919 Ga0268266_10000004
920 Ga0268264_10056756
921 Ga0268256_1000008
922 Ga0268256_1000015
923 Ga0307516_10106044
924 Ga0307412_10003347
925 Ga0307412_10100670
926 Ga0307409_100317436
927 Ga0307414_10004643
928 Ga0307414_10008972
929 Ga0307414_10041317
930 Ga0307414_10046183
931 Ga0307411_10075577
932 Ga0307510_10005230
933 Ga0307510_10021816
934 Ga0395899_0016207
935 Ga0395899_0085820
936 Ga0395899_0219217
937 Ga0395900_0005984
938 Ga0395900_0007251
939 Ga0395900_0008909
940 Ga0395900_0047569
941 Ga0395898_0000049
942 Ga0395898_0003336
943 Ga0395898_0004927
944 Ga0395898_0012224
945 Ga0395898_0114074
946 Ga0395905_0084163
947 Ga0395901_0004732
948 Ga0395901_0005132
949 Ga0395901_0009707
950 Ga0395901_0010230
951 Ga0395901_0165825
952 Ga0395901_0186033
953 Ga0395901_0194078
954 Ga0237816_02346
955 Ga0436365_0838762
956 Ga0439436_0000156
957 Ga0451800_0027863
958 Ga0451800_0163290
959 Ga0451806_619891
960 Ga0451804_0794885
961 Ga0451807_1039361
962 Ga0451853_2514762
963 Ga0439459_0006387
964 Ga0466969_0003903
965 Ga0466965_0000550
966 Ga0466966_0001316
967 Ga0466966_0013296
968 Ga0466961_0004179
969 Ga0466961_0009981
970 Ga0466961_0013180
971 Ga0466963_0162984
972 Ga0466971_0006496
973 Ga0466971_0019590
974 Ga0466957_0028237
975 Ga0466957_0137941
976 Ga0466960_0005921
977 Ga0466959_0010673
978 Ga0466959_0045661
979 Ga0466958_0020369
980 Ga0495627_025570
981 Ga0495638_0000234
982 Ga0495650_0000247
983 Ga0495585_0000104
984 Ga0495607_0008360
985 Ga0495606_0000401
986 Ga0495606_0005269
987 Ga0495610_0002689
988 Ga0495648_0000914
989 Ga0495622_0006636
990 Ga0495633_0032712
991 Ga0495625_0005535
992 Ga0495625_0016176
993 Ga0495661_0000199
994 Ga0495670_0008599
995 Ga0495649_0000553
996 Ga0495660_0000583
997 Ga0495673_0000004
998 Ga0495686_0000017
999 Ga0496100_0115146
1000 Ga0496104_0030305
1001 Ga0496105_0003042
1002 Ga0496106_0007333
1003 Ga0496106_0111966
1004 Ga0496107_0094468
1005 Ga0496108_0158003
1006 Ga0496113_0014146
1007 Ga0496113_0193342
1008 Ga0496114_0016091
1009 Ga0496115_0000073
1010 Ga0496115_0000206
1011 Ga0496115_0000946
1012 Ga0496117_0008476
1013 Ga0496117_0022641
1014 Ga0496117_0025189
1015 Ga0496117_0098077
1016 Ga0496118_0003118
1017 Ga0496118_0004645
1018 Ga0496118_0006962
1019 Ga0496118_0015853
1020 Ga0496118_0019362
1021 Ga0496119_0001081
1022 Ga0496119_0014335
1023 Ga0496120_0001250
1024 Ga0496120_0001337
1025 Ga0496121_0000045
1026 Ga0496121_0000743
1027 Ga0496121_0037519
1028 Ga0496121_0131079
1029 Ga0496121_0315768
1030 Ga0496122_0000374
1031 Ga0496122_0025528
1032 Ga0496122_0186607
1033 Ga0496123_0001233
1034 Ga0496123_0039389
1035 Ga0496124_0022699
1036 Ga0496124_0142336
1037 Ga0496125_0015635
1038 Ga0496125_0043076
1039 Ga0496126_0000169
1040 Ga0496126_0003516
1041 Ga0496126_0010323
1042 Ga0496126_0072018
1043 Ga0496126_0091306
1044 Ga0496126_0176597
1045 Ga0495682_0048565
1046 Ga0501031_0001179
1047 Ga0501031_0091146
1048 Ga0501031_0168800
1049 Ga0501032_0008047
1050 Ga0501032_0127980
1051 Ga0501033_0006957
1052 Ga0501033_0040160
1053 Ga0501033_0081765
1054 Ga0501033_0168701
1055 Ga0501034_0000091
1056 Ga0501034_0002029
1057 Ga0501034_0010969
1058 Ga0501034_0031976
1059 Ga0501034_0070728
1060 Ga0501036_0010107
1061 Ga0501036_0077353
1062 Ga0501036_0206056
1063 Ga0501037_0014206
1064 Ga0501037_0037219
1065 Ga0501037_0054282
1066 Ga0501037_0157137
1067 Ga0501038_0017649
1068 Ga0501038_0078887
1069 Ga0501043_0002924
1070 Ga0501043_0018714
1071 Ga0501043_0031687
1072 Ga0501043_0091289
1073 Ga0501043_0289219
1074 Ga0501046_0006397
1075 Ga0501046_0078849
1076 Ga0501047_0001140
1077 Ga0501047_0009456
1078 Ga0501047_0015754
1079 Ga0501047_0041058
1080 Ga0501047_0042030
1081 Ga0501047_0082045
1082 Ga0501048_0018513
1083 Ga0501068_0157228
1084 Ga0501068_0202825
1085 Ga0501069_0012229
1086 Ga0501069_0060579
1087 Ga0501070_0000955
1088 Ga0501070_0004034
1089 Ga0501070_0009100
1090 Ga0501070_0017920
1091 Ga0501070_0018070
1092 Ga0501070_0027783
1093 Ga0501070_0050818
1094 Ga0501070_0090101
1095 Ga0501071_0006093
1096 Ga0501073_0009510
1097 Ga0501073_0052005
1098 Ga0501073_0072705
1099 Ga0501074_0014060
1100 Ga0501074_0014638
1101 Ga0501074_0105751
1102 Ga0501076_0430481
1103 Ga0501077_0008784
1104 Ga0501225_0010582
1105 Ga0501079_0123108
1106 Ga0501080_0002935
1107 Ga0501080_0004845
1108 Ga0501080_0019215
1109 Ga0501080_0028480
1110 Ga0501080_0049529
1111 Ga0501080_0051332
1112 Ga0501035_0001816
1113 Ga0501035_0001954
1114 Ga0501035_0002968
1115 Ga0501035_0013820
1116 Ga0501035_0023994
1117 Ga0501035_0042186
1118 Ga0501035_0064924
1119 Ga0501035_0179982
1120 Ga0501044_0017427
1121 Ga0501044_0020806
1122 Ga0501044_0036954
1123 Ga0501044_0044350
1124 Ga0501044_0086361
1125 Ga0501044_0097311
1126 Ga0501044_0101792
1127 Ga0501044_0131218
1128 Ga0501044_0153508
1129 Ga0500620_009766
1130 Ga0500634_0000051
1131 Ga0501084_0226009
1132 Ga0466962_0004383
1133 Ga0466962_0010142
1134 Ga0466962_0090676
1135 2538832291
1136 2595446780
1137 2595449543
1138 2643830300
1139 2643908028
1140 2643915770
1141 2687583745
1142 2739730279
1143 2748016040
1144 2819563934
1145 2819659931
1146 2842783844
1147 2842919854
1148 2852685244
1149 2857446159
1150 2884341452
1151 2884412122
1152 2895498956
1153 2895511995
1154 2895524939
1155 2895527938
1156 2904464570
1157 2919088345
1158 2919131369
1159 2919406072
1160 2923518677
1161 2928967717
1162 2929198212
1163 2941472902
1164 8002872338

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

136

290

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

7

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9002 1 315
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8987 6 315
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.8942 2 315
8afu-assembly2.cif.gz_B daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.8929 1 315
8afv-assembly2.cif.gz_C daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8921 6 315
ID Description Score Start End Superfamily
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9183 134 289 3.30.360.10
af_Q2G1H4_169_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9047 155 289 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.898 133 289 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8869 134 293 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8817 134 293 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A367J6R2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase/acetylglutamate kinase 0.9801 200 317 GO:0016301
AF-T1AKM0-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9789 3 134 GO:0006526
GO:0016620
GO:0051287
AF-A0A2S6BA65-F1-model_v4 deleted 0.9779 219 314
AF-D5G7N8-F1-model_v4 (Perigord truffle) hypothetical protein 0.9765 184 315
AF-A0A2W5HSF8-F1-model_v4 deleted 0.9738 1 119

Map