F466207

General Info

Members Datasets Scaffolds Average Seq Length
582 317 1164 191

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0058623|Ga0495663_0058623_497_1153
Length 218
Sequence LSLPPVAGIAGGVRHRVALGREKEGELQMDKFFGNLHAVLGAGLVLASILMLGLNGQNFEDGAAAAGAVMRWLHTFFGVLWIGLLYYFNFVQIPTMPKIPAELKPGVSKHIAPAALFWFRWAAAATVVLGLAIAGHAKYLVPALSFQDPYKLIGVGMWLGLIMAFNVWFVIWPNQKKALGIVAADDATKAKSAKTAMIFSRTNTLLSIPMLYAMVSFS

Samples

Sample ID Description Type Environment
1 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
282 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
309 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
314 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
315 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
316 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
317 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.17
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 2.58
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495663_0058623 3300046525 Bacteria 1207
2 JGI24735J21928_10135463 3300002067 Bacteria 710
3 JGI25153J46596_10001493 3300003215 Bacteria 13955
4 Ga0055536_1002550 3300003781 Bacteria 10179
5 Ga0055536_1007994 3300003781 Bacteria 4628
6 Ga0055536_1013607 3300003781 Bacteria 2917
7 Ga0055534_1013686 3300003784 Bacteria 1550
8 Ga0055530_10000522 3300003791 Bacteria 33291
9 Ga0055530_10073589 3300003791 Bacteria 731
10 Ga0055531_10002871 3300003794 Bacteria 11231
11 Ga0065704_10308270 3300005289 Bacteria 873
12 Ga0065712_10318943 3300005290 Bacteria 832
13 Ga0065715_10530377 3300005293 Bacteria 756
14 Ga0065707_10168593 3300005295 Bacteria 1502
15 Ga0070676_10019938 3300005328 Bacteria 3736
16 Ga0070683_100053606 3300005329 Bacteria 3737
17 Ga0070683_100121420 3300005329 Bacteria 2468
18 Ga0070690_100060358 3300005330 Bacteria 2440
19 Ga0070690_100169261 3300005330 Bacteria 1503
20 Ga0070670_100000570 3300005331 Bacteria 29190
21 Ga0070670_100028698 3300005331 Bacteria 4789
22 Ga0070670_100078166 3300005331 Bacteria 2842
23 Ga0070670_100645169 3300005331 Bacteria 949
24 Ga0070677_10085856 3300005333 Bacteria 1358
25 Ga0070682_100995762 3300005337 Bacteria 695
26 Ga0068868_100000063 3300005338 Bacteria 61783
27 Ga0068868_100004436 3300005338 Bacteria 9841
28 Ga0068868_101070760 3300005338 Bacteria 741
29 Ga0070660_100019823 3300005339 Bacteria 4934
30 Ga0070689_100009271 3300005340 Bacteria 6973
31 Ga0070689_100121635 3300005340 Bacteria 2085
32 Ga0070687_100185033 3300005343 Bacteria 1251
33 Ga0070687_100247443 3300005343 Bacteria 1106
34 Ga0070687_100290079 3300005343 Bacteria 1034
35 Ga0070661_100019873 3300005344 Bacteria 4786
36 Ga0070668_100000001 3300005347 Bacteria 275905
37 Ga0070668_100074846 3300005347 Bacteria 2643
38 Ga0070668_100299186 3300005347 Bacteria 1349
39 Ga0070669_100022464 3300005353 Bacteria 4510
40 Ga0070669_100345079 3300005353 Bacteria 1207
41 Ga0070675_100004568 3300005354 Bacteria 10566
42 Ga0070675_100015141 3300005354 Bacteria 6090
43 Ga0070675_100127337 3300005354 Bacteria 2168
44 Ga0070675_100264366 3300005354 Bacteria 1508
45 Ga0070675_100272925 3300005354 Bacteria 1484
46 Ga0070671_100000167 3300005355 Bacteria 43269
47 Ga0070671_100136363 3300005355 Bacteria 2069
48 Ga0070671_100197770 3300005355 Bacteria 1704
49 Ga0070671_100351490 3300005355 Bacteria 1258
50 Ga0070674_100008899 3300005356 Bacteria 5994
51 Ga0070674_100073308 3300005356 Bacteria 2426
52 Ga0070674_100202326 3300005356 Bacteria 1534
53 Ga0070673_100102438 3300005364 Bacteria 2360
54 Ga0070659_100000034 3300005366 Bacteria 115416
55 Ga0070667_100000006 3300005367 Bacteria 336732
56 Ga0070667_100171897 3300005367 Bacteria 1913
57 Ga0070701_10130632 3300005438 Bacteria 1426
58 Ga0070705_100068326 3300005440 Bacteria 2138
59 Ga0070705_100243702 3300005440 Bacteria 1258
60 Ga0070705_100609465 3300005440 Bacteria 846
61 Ga0070700_100106550 3300005441 Bacteria 1856
62 Ga0070694_100106377 3300005444 Bacteria 1992
63 Ga0070694_100130111 3300005444 Unclassified 1817
64 Ga0070694_100162686 3300005444 Bacteria 1639
65 Ga0070694_100188574 3300005444 Bacteria 1530
66 Ga0070708_100137586 3300005445 Unclassified 2263
67 Ga0070663_100201931 3300005455 Bacteria 1552
68 Ga0070678_100019701 3300005456 Bacteria 4407
69 Ga0070678_100053499 3300005456 Bacteria 2936
70 Ga0070662_100063538 3300005457 Bacteria 2701
71 Ga0070662_100941763 3300005457 Bacteria 738
72 Ga0070681_10077083 3300005458 Bacteria 3291
73 Ga0068867_100006451 3300005459 Bacteria 8284
74 Ga0068867_100104461 3300005459 Bacteria 2168
75 Ga0068867_100229217 3300005459 Bacteria 1501
76 Ga0068867_100324926 3300005459 Bacteria 1276
77 Ga0070685_10285373 3300005466 Bacteria 1107
78 Ga0070685_10360115 3300005466 Bacteria 997
79 Ga0070706_100107619 3300005467 Bacteria 2594
80 Ga0070707_100011178 3300005468 Bacteria 8366
81 Ga0070707_100419461 3300005468 Bacteria 1299
82 Ga0070707_100695297 3300005468 Bacteria 980
83 Ga0070679_100092115 3300005530 Bacteria 3019
84 Ga0070697_100019678 3300005536 Bacteria 5332
85 Ga0070697_100495558 3300005536 Bacteria 1068
86 Ga0068853_100233628 3300005539 Bacteria 1683
87 Ga0070672_100021266 3300005543 Bacteria 4745
88 Ga0070672_100065270 3300005543 Bacteria 2879
89 Ga0070686_100000140 3300005544 Bacteria 49544
90 Ga0070686_100318664 3300005544 Bacteria 1158
91 Ga0070695_100043021 3300005545 Bacteria 2870
92 Ga0070695_100098510 3300005545 Bacteria 1965
93 Ga0070696_100004761 3300005546 Bacteria 9063
94 Ga0070696_100098839 3300005546 Bacteria 2088
95 Ga0070696_100347609 3300005546 Bacteria 1148
96 Ga0070693_100126339 3300005547 Bacteria 1593
97 Ga0070693_100279134 3300005547 Bacteria 1118
98 Ga0070665_100000105 3300005548 Bacteria 157734
99 Ga0070665_100002184 3300005548 Bacteria 21806
100 Ga0070665_100172679 3300005548 Bacteria 2162
101 Ga0070665_100462250 3300005548 Bacteria 1279
102 Ga0070704_100069165 3300005549 Bacteria 2557
103 Ga0070704_100106528 3300005549 Bacteria 2124
104 Ga0070704_100495014 3300005549 Bacteria 1060
105 Ga0070704_100644614 3300005549 Bacteria 935
106 Ga0070704_101018157 3300005549 Bacteria 750
107 Ga0068855_100309264 3300005563 Bacteria 1749
108 Ga0070664_100164957 3300005564 Bacteria 1962
109 Ga0068857_100027365 3300005577 Bacteria 5031
110 Ga0068854_100499613 3300005578 Bacteria 1024
111 Ga0068854_100521423 3300005578 Bacteria 1004
112 Ga0068852_100002785 3300005616 Bacteria 12109
113 Ga0068852_100214509 3300005616 Bacteria 1828
114 Ga0068852_100866795 3300005616 Bacteria 919
115 Ga0068859_100027031 3300005617 Bacteria 5755
116 Ga0068859_100028919 3300005617 Bacteria 5560
117 Ga0068859_100156144 3300005617 Bacteria 2359
118 Ga0068859_100224662 3300005617 Bacteria 1966
119 Ga0068859_100487604 3300005617 Bacteria 1328
120 Ga0068864_100002091 3300005618 Bacteria 16490
121 Ga0068864_100170796 3300005618 Bacteria 1982
122 Ga0068864_100582411 3300005618 Bacteria 1084
123 Ga0068864_100761466 3300005618 Bacteria 949
124 Ga0068861_100031256 3300005719 Bacteria 3910
125 Ga0068861_100073769 3300005719 Bacteria 2652
126 Ga0068861_100961631 3300005719 Bacteria 813
127 Ga0068861_101312257 3300005719 Bacteria 704
128 Ga0068851_10288278 3300005834 Bacteria 941
129 Ga0068870_10222769 3300005840 Bacteria 1155
130 Ga0068870_10477842 3300005840 Bacteria 826
131 Ga0068863_100001776 3300005841 Bacteria 21388
132 Ga0068863_100022271 3300005841 Bacteria 6050
133 Ga0068863_100220834 3300005841 Bacteria 1826
134 Ga0068863_100446185 3300005841 Bacteria 1269
135 Ga0068858_100000412 3300005842 Bacteria 44458
136 Ga0068858_100049472 3300005842 Bacteria 3893
137 Ga0068860_100000120 3300005843 Bacteria 125823
138 Ga0068860_100000903 3300005843 Bacteria 32899
139 Ga0068860_100046033 3300005843 Bacteria 4160
140 Ga0068860_100123687 3300005843 Bacteria 2479
141 Ga0068860_100333878 3300005843 Bacteria 1489
142 Ga0068860_100475791 3300005843 Bacteria 1244
143 Ga0068862_100000365 3300005844 Bacteria 49043
144 Ga0068862_100033939 3300005844 Bacteria 4316
145 Ga0068862_100040916 3300005844 Bacteria 3942
146 Ga0070717_10811336 3300006028 Bacteria 851
147 Ga0070716_100039011 3300006173 Bacteria 2633
148 Ga0075362_10030142 3300006177 Bacteria 2341
149 Ga0075367_10070525 3300006178 Bacteria 2101
150 Ga0075366_10056864 3300006195 Bacteria 2324
151 Ga0097621_100150814 3300006237 Bacteria 1993
152 Ga0075370_10268647 3300006353 Bacteria 1012
153 Ga0068871_100035672 3300006358 Bacteria 3954
154 Ga0068871_100182195 3300006358 Bacteria 1805
155 Ga0075428_100198067 3300006844 Bacteria 2172
156 Ga0075428_100858405 3300006844 Bacteria 964
157 Ga0075430_100004710 3300006846 Bacteria 11472
158 Ga0075430_100037762 3300006846 Bacteria 4093
159 Ga0075430_100475185 3300006846 Bacteria 1031
160 Ga0075431_100054682 3300006847 Bacteria 4116
161 Ga0075431_100199942 3300006847 Bacteria 2045
162 Ga0075431_100448870 3300006847 Bacteria 1285
163 Ga0075433_10629491 3300006852 Bacteria 941
164 Ga0075434_100039264 3300006871 Bacteria 4690
165 Ga0075434_100144328 3300006871 Bacteria 2401
166 Ga0075434_100194328 3300006871 Bacteria 2049
167 Ga0075434_100443445 3300006871 Bacteria 1319
168 Ga0075429_100340084 3300006880 Bacteria 1314
169 Ga0075429_100343100 3300006880 Bacteria 1307
170 Ga0068865_100003663 3300006881 Bacteria 9226
171 Ga0068865_100109023 3300006881 Bacteria 2039
172 Ga0068865_100321729 3300006881 Bacteria 1244
173 Ga0075436_100000111 3300006914 Bacteria 47863
174 Ga0097620_100027032 3300006931 Bacteria 5755
175 Ga0097620_100028919 3300006931 Bacteria 5560
176 Ga0097620_100156131 3300006931 Bacteria 2359
177 Ga0097620_100224668 3300006931 Bacteria 1966
178 Ga0097620_100487595 3300006931 Bacteria 1328
179 Ga0075435_100130668 3300007076 Bacteria 2101
180 Ga0075435_100294055 3300007076 Bacteria 1388
181 Ga0075435_100451210 3300007076 Bacteria 1109
182 Ga0105240_10008445 3300009093 Bacteria 14731
183 Ga0111539_10179513 3300009094 Bacteria 2473
184 Ga0105245_10009778 3300009098 Bacteria 8355
185 Ga0105245_10246709 3300009098 Bacteria 1733
186 Ga0105245_10309642 3300009098 Bacteria 1552
187 Ga0105245_10412655 3300009098 Bacteria 1352
188 Ga0114129_10033159 3300009147 Bacteria 7298
189 Ga0114129_10164186 3300009147 Bacteria 3032
190 Ga0114129_10585700 3300009147 Bacteria 1447
191 Ga0105243_10037366 3300009148 Bacteria 3774
192 Ga0105243_10162637 3300009148 Bacteria 1926
193 Ga0105243_10451846 3300009148 Bacteria 1206
194 Ga0105243_10637569 3300009148 Bacteria 1031
195 Ga0105243_10820076 3300009148 Bacteria 919
196 Ga0105242_10002502 3300009176 Bacteria 14410
197 Ga0105242_10069596 3300009176 Bacteria 2915
198 Ga0105242_10078105 3300009176 Bacteria 2763
199 Ga0105242_10186724 3300009176 Bacteria 1832
200 Ga0105242_10884420 3300009176 Bacteria 892
201 Ga0105248_10075044 3300009177 Bacteria 3800
202 Ga0105248_10417796 3300009177 Bacteria 1510
203 Ga0105248_10476008 3300009177 Bacteria 1408
204 Ga0105237_10401355 3300009545 Bacteria 1376
205 Ga0105238_10591871 3300009551 Bacteria 1116
206 Ga0105238_10683603 3300009551 Bacteria 1038
207 Ga0105249_10361463 3300009553 Bacteria 1473
208 Ga0105249_10442664 3300009553 Bacteria 1337
209 Ga0105249_11573734 3300009553 Bacteria 730
210 Ga0157370_10672990 3300013104 Bacteria 945
211 Ga0157374_10125352 3300013296 Bacteria 2482
212 Ga0157378_10004527 3300013297 Bacteria 12196
213 Ga0157378_10046586 3300013297 Bacteria 3854
214 Ga0157378_10385566 3300013297 Bacteria 1377
215 Ga0157378_10797836 3300013297 Bacteria 970
216 Ga0163162_10005803 3300013306 Bacteria 11947
217 Ga0163162_10040290 3300013306 Bacteria 4671
218 Ga0157372_10408544 3300013307 Bacteria 1582
219 Ga0157375_10058576 3300013308 Bacteria 3811
220 Ga0157375_10442310 3300013308 Bacteria 1466
221 Ga0157375_10605346 3300013308 Bacteria 1255
222 Ga0157375_11006614 3300013308 Bacteria 973
223 Ga0157375_11501661 3300013308 Bacteria 795
224 Ga0163163_10382828 3300014325 Bacteria 1464
225 Ga0163163_10844886 3300014325 Bacteria 979
226 Ga0157380_10007364 3300014326 Bacteria 7813
227 Ga0157380_10231710 3300014326 Bacteria 1659
228 Ga0157380_10770998 3300014326 Bacteria 975
229 Ga0182008_10552911 3300014497 Bacteria 640
230 Ga0157379_10035631 3300014968 Bacteria 4437
231 Ga0157379_10066556 3300014968 Bacteria 3221
232 Ga0157379_10117893 3300014968 Bacteria 2388
233 Ga0157379_10232735 3300014968 Bacteria 1670
234 Ga0163161_10065092 3300017792 Bacteria 2660
235 Ga0163161_10209428 3300017792 Bacteria 1506
236 Ga0163161_10452167 3300017792 Bacteria 1038
237 Ga0206350_11574848 3300020080 Bacteria 756
238 Ga0209455_1010168 3300025272 Bacteria 2410
239 Ga0209675_1003710 3300025291 Bacteria 7103
240 Ga0209676_1000557 3300025292 Bacteria 56440
241 Ga0209676_1001387 3300025292 Bacteria 23537
242 Ga0209676_1001888 3300025292 Bacteria 17095
243 Ga0209676_1014718 3300025292 Bacteria 2925
244 Ga0209676_1062433 3300025292 Bacteria 921
245 Ga0209025_1036502 3300025294 Bacteria 2200
246 Ga0209025_1038151 3300025294 Bacteria 2118
247 Ga0209758_1000036 3300025297 Bacteria 441671
248 Ga0209050_1000017 3300025298 Bacteria 728928
249 Ga0209050_1003770 3300025298 Bacteria 10850
250 Ga0209257_1001118 3300025304 Bacteria 34674
251 Ga0209257_1001176 3300025304 Bacteria 33109
252 Ga0209257_1001719 3300025304 Bacteria 24483
253 Ga0207697_10009458 3300025315 Bacteria 4210
254 Ga0207656_10358661 3300025321 Bacteria 728
255 Ga0207682_10030036 3300025893 Bacteria 2175
256 Ga0207682_10034359 3300025893 Bacteria 2044
257 Ga0207688_10008762 3300025901 Bacteria 5504
258 Ga0207680_10153493 3300025903 Bacteria 1537
259 Ga0207680_10166946 3300025903 Bacteria 1480
260 Ga0207680_10240699 3300025903 Bacteria 1247
261 Ga0207645_10012727 3300025907 Bacteria 5703
262 Ga0207645_10161383 3300025907 Bacteria 1467
263 Ga0207643_10020601 3300025908 Bacteria 3620
264 Ga0207684_10117974 3300025910 Bacteria 2274
265 Ga0207684_10166258 3300025910 Bacteria 1901
266 Ga0207707_10346502 3300025912 Unclassified 1280
267 Ga0207695_10152244 3300025913 Bacteria 2251
268 Ga0207662_10042493 3300025918 Bacteria 2679
269 Ga0207662_10149753 3300025918 Bacteria 1483
270 Ga0207657_10000839 3300025919 Bacteria 32505
271 Ga0207649_10005015 3300025920 Bacteria 7157
272 Ga0207652_10126216 3300025921 Unclassified 2279
273 Ga0207646_10046396 3300025922 Bacteria 3898
274 Ga0207646_10479208 3300025922 Bacteria 1122
275 Ga0207681_10082302 3300025923 Bacteria 2275
276 Ga0207681_10150675 3300025923 Bacteria 1742
277 Ga0207650_10014606 3300025925 Bacteria 5454
278 Ga0207650_10244708 3300025925 Bacteria 1450
279 Ga0207659_10035258 3300025926 Bacteria 3456
280 Ga0207659_10186644 3300025926 Bacteria 1647
281 Ga0207659_10203034 3300025926 Bacteria 1584
282 Ga0207659_10881900 3300025926 Bacteria 769
283 Ga0207687_10029259 3300025927 Bacteria 3705
284 Ga0207687_10499813 3300025927 Bacteria 1015
285 Ga0207687_10609067 3300025927 Bacteria 921
286 Ga0207644_10000047 3300025931 Bacteria 103158
287 Ga0207644_10035090 3300025931 Bacteria 3512
288 Ga0207644_10262625 3300025931 Bacteria 1381
289 Ga0207644_10342530 3300025931 Bacteria 1212
290 Ga0207644_10342622 3300025931 Bacteria 1212
291 Ga0207690_10000005 3300025932 Bacteria 581199
292 Ga0207706_10041710 3300025933 Bacteria 4068
293 Ga0207686_10017443 3300025934 Bacteria 4046
294 Ga0207686_10046068 3300025934 Bacteria 2687
295 Ga0207686_10146154 3300025934 Bacteria 1640
296 Ga0207709_10041714 3300025935 Bacteria 2756
297 Ga0207709_10208451 3300025935 Bacteria 1401
298 Ga0207709_10224338 3300025935 Bacteria 1357
299 Ga0207709_10250607 3300025935 Bacteria 1293
300 Ga0207670_10094949 3300025936 Bacteria 2117
301 Ga0207669_10792508 3300025937 Bacteria 785
302 Ga0207669_10927805 3300025937 Bacteria 729
303 Ga0207704_10005537 3300025938 Bacteria 5819
304 Ga0207704_10115058 3300025938 Bacteria 1827
305 Ga0207665_10019582 3300025939 Bacteria 4450
306 Ga0207665_10300827 3300025939 Bacteria 1199
307 Ga0207691_10006268 3300025940 Bacteria 11483
308 Ga0207691_10219991 3300025940 Bacteria 1647
309 Ga0207691_10332307 3300025940 Bacteria 1302
310 Ga0207711_10214071 3300025941 Bacteria 1760
311 Ga0207689_10195671 3300025942 Bacteria 1668
312 Ga0207661_10010949 3300025944 Bacteria 6549
313 Ga0207679_10000906 3300025945 Bacteria 18937
314 Ga0207667_10638013 3300025949 Bacteria 1072
315 Ga0207651_10013310 3300025960 Bacteria 4702
316 Ga0207651_10583017 3300025960 Bacteria 976
317 Ga0207712_10050532 3300025961 Bacteria 2903
318 Ga0207712_10515660 3300025961 Bacteria 1024
319 Ga0207712_10697973 3300025961 Bacteria 885
320 Ga0207712_11032911 3300025961 Bacteria 730
321 Ga0207668_10000043 3300025972 Bacteria 103738
322 Ga0207668_10146778 3300025972 Bacteria 1821
323 Ga0207668_10586643 3300025972 Bacteria 969
324 Ga0207640_10163832 3300025981 Bacteria 1648
325 Ga0207640_10653420 3300025981 Bacteria 896
326 Ga0207658_10000010 3300025986 Bacteria 240224
327 Ga0207658_10238386 3300025986 Bacteria 1539
328 Ga0207677_10000044 3300026023 Bacteria 107614
329 Ga0207677_10686216 3300026023 Bacteria 907
330 Ga0207703_10003516 3300026035 Bacteria 13106
331 Ga0207703_10031316 3300026035 Bacteria 4205
332 Ga0207703_10273572 3300026035 Bacteria 1531
333 Ga0207639_10401833 3300026041 Bacteria 1234
334 Ga0207639_10492166 3300026041 Bacteria 1119
335 Ga0207639_10631123 3300026041 Bacteria 990
336 Ga0207678_10121197 3300026067 Bacteria 2232
337 Ga0207678_11165008 3300026067 Bacteria 682
338 Ga0207708_10019486 3300026075 Bacteria 5115
339 Ga0207708_10209280 3300026075 Bacteria 1558
340 Ga0207641_10000294 3300026088 Bacteria 62469
341 Ga0207641_10012528 3300026088 Bacteria 6951
342 Ga0207641_10035171 3300026088 Bacteria 4172
343 Ga0207641_10198953 3300026088 Bacteria 1846
344 Ga0207641_10302402 3300026088 Bacteria 1511
345 Ga0207641_10475736 3300026088 Bacteria 1210
346 Ga0207648_10007566 3300026089 Bacteria 10660
347 Ga0207648_10010128 3300026089 Bacteria 8962
348 Ga0207676_10002645 3300026095 Bacteria 12750
349 Ga0207676_10026026 3300026095 Bacteria 4346
350 Ga0207676_10077980 3300026095 Bacteria 2681
351 Ga0207676_10561714 3300026095 Bacteria 1091
352 Ga0207676_10886521 3300026095 Bacteria 874
353 Ga0207674_10034895 3300026116 Bacteria 5253
354 Ga0207674_10077608 3300026116 Bacteria 3327
355 Ga0207675_100007331 3300026118 Bacteria 10423
356 Ga0207675_100042970 3300026118 Bacteria 4220
357 Ga0207683_10008343 3300026121 Bacteria 8861
358 Ga0207698_10010035 3300026142 Bacteria 6064
359 Ga0207698_10607701 3300026142 Bacteria 1079
360 Ga0207698_10728667 3300026142 Bacteria 989
361 Ga0207698_10811690 3300026142 Bacteria 938
362 Ga0209967_1000193 3300027364 Bacteria 8591
363 Ga0209981_1002518 3300027378 Bacteria 2338
364 Ga0209981_1005097 3300027378 Bacteria 1739
365 Ga0209996_1007658 3300027395 Bacteria 1409
366 Ga0209996_1014881 3300027395 Bacteria 1059
367 Ga0210000_1000435 3300027462 Bacteria 5732
368 Ga0210000_1000719 3300027462 Bacteria 4592
369 Ga0209995_1000658 3300027471 Bacteria 5325
370 Ga0209968_1005366 3300027526 Bacteria 1929
371 Ga0209968_1005975 3300027526 Bacteria 1833
372 Ga0209999_1008603 3300027543 Bacteria 1842
373 Ga0209999_1038090 3300027543 Bacteria 899
374 Ga0209983_1021933 3300027665 Bacteria 1337
375 Ga0209966_1002399 3300027695 Bacteria 3123
376 Ga0209974_10049378 3300027876 Bacteria 1411
377 Ga0207428_10080158 3300027907 Bacteria 2551
378 Ga0268266_10000055 3300028379 Bacteria 291630
379 Ga0268266_10098288 3300028379 Bacteria 2575
380 Ga0268266_10443517 3300028379 Bacteria 1233
381 Ga0268266_10695186 3300028379 Bacteria 980
382 Ga0268265_10000143 3300028380 Bacteria 90469
383 Ga0268265_10017185 3300028380 Bacteria 4986
384 Ga0268265_10059327 3300028380 Bacteria 2927
385 Ga0268265_10196026 3300028380 Bacteria 1748
386 Ga0268264_10000070 3300028381 Bacteria 268524
387 Ga0268264_10016446 3300028381 Bacteria 6057
388 Ga0268264_10096134 3300028381 Bacteria 2565
389 Ga0268264_10451617 3300028381 Bacteria 1245
390 Ga0265318_10062847 3300028577 Bacteria 1382
391 Ga0307517_10078802 3300028786 Bacteria 2844
392 Ga0265330_10059375 3300031235 Bacteria 1666
393 Ga0265332_10004178 3300031238 Bacteria 6848
394 Ga0265328_10014479 3300031239 Bacteria 3106
395 Ga0265320_10023211 3300031240 Bacteria 3306
396 Ga0265329_10039391 3300031242 Bacteria 1518
397 Ga0265331_10001179 3300031250 Bacteria 19910
398 Ga0265331_10017366 3300031250 Bacteria 3755
399 Ga0265327_10002178 3300031251 Bacteria 21530
400 Ga0265327_10163829 3300031251 Bacteria 1025
401 Ga0265316_10001190 3300031344 Bacteria 28178
402 Ga0265316_10049383 3300031344 Bacteria 3315
403 Ga0307408_100707213 3300031548 Bacteria 906
404 Ga0307408_101342037 3300031548 Bacteria 671
405 Ga0265313_10053687 3300031595 Bacteria 1917
406 Ga0265314_10000887 3300031711 Bacteria 35662
407 Ga0265342_10029125 3300031712 Bacteria 3432
408 Ga0307516_10000094 3300031730 Bacteria 100401
409 Ga0307410_10294831 3300031852 Bacteria 1278
410 Ga0307406_10041841 3300031901 Bacteria 2858
411 Ga0307406_10182713 3300031901 Bacteria 1528
412 Ga0307406_10375685 3300031901 Bacteria 1119
413 Ga0307412_10046703 3300031911 Bacteria 2839
414 Ga0307409_100409845 3300031995 Bacteria 1297
415 Ga0307416_100122364 3300032002 Bacteria 2322
416 Ga0307416_100521998 3300032002 Bacteria 1256
417 Ga0307416_101746943 3300032002 Bacteria 726
418 Ga0307414_10001549 3300032004 Bacteria 11941
419 Ga0307414_10005871 3300032004 Bacteria 6791
420 Ga0307414_10079731 3300032004 Bacteria 2391
421 Ga0307414_10090859 3300032004 Bacteria 2267
422 Ga0307414_10163229 3300032004 Bacteria 1772
423 Ga0307414_10369030 3300032004 Bacteria 1237
424 Ga0307414_10433509 3300032004 Bacteria 1149
425 Ga0307414_10444246 3300032004 Bacteria 1136
426 Ga0307411_10040338 3300032005 Bacteria 2961
427 Ga0307411_10216370 3300032005 Bacteria 1483
428 Ga0307411_10440116 3300032005 Bacteria 1088
429 Ga0307411_10653775 3300032005 Bacteria 910
430 Ga0307411_11221363 3300032005 Bacteria 682
431 Ga0373932_0113151 3300035112 Bacteria 897
432 Ga0373953_0062726 3300035117 Bacteria 1522
433 Ga0373927_0009397 3300035695 Bacteria 6558
434 Ga0373937_0016620 3300036401 Bacteria 6538
435 Ga0373925_0001850 3300037068 Bacteria 17621
436 Ga0395898_0402019 3300037466 Bacteria 1306
437 Ga0395905_0673841 3300037471 Bacteria 936
438 Ga0436364_1446039 3300037853 Bacteria 1319
439 Ga0395901_0019134 3300038443 Bacteria 7001
440 Ga0237819_00574 3300038705 Bacteria 12342
441 Ga0436365_1862304 3300039437 Bacteria 21258
442 Ga0436363_1179848 3300039450 Bacteria 1442
443 Ga0439436_0074971 3300041404 Bacteria 942
444 Ga0451798_0420236 3300041458 Bacteria 535
445 Ga0451804_0684765 3300041463 Bacteria 811
446 Ga0451853_0042166 3300041512 Bacteria 658
447 Ga0439441_001972 3300042001 Bacteria 2817
448 Ga0439446_0007782 3300042156 Bacteria 2824
449 Ga0439434_0008995 3300042435 Bacteria 2935
450 Ga0439435_0001153 3300042436 Bacteria 4737
451 Ga0439435_0016940 3300042436 Bacteria 1835
452 Ga0439444_0010931 3300042437 Bacteria 1460
453 Ga0439464_0137737 3300042439 Bacteria 759
454 Ga0451576_0318366 3300045051 Bacteria 1628
455 Ga0495592_0000739 3300046454 Bacteria 22747
456 Ga0495629_0185204 3300046459 Bacteria 1442
457 Ga0495653_0125097 3300046463 Bacteria 1827
458 Ga0495650_0094611 3300046471 Bacteria 1131
459 Ga0495639_0309824 3300046475 Bacteria 788
460 Ga0495608_0000167 3300046511 Bacteria 46550
461 Ga0495610_0162692 3300046512 Bacteria 942
462 Ga0495616_0000022 3300046513 Bacteria 149720
463 Ga0495628_0002132 3300046516 Bacteria 17926
464 Ga0495630_0023037 3300046517 Bacteria 4601
465 Ga0495632_0054694 3300046519 Bacteria 1956
466 Ga0495643_0025809 3300046522 Bacteria 3321
467 Ga0495666_0002610 3300046526 Bacteria 8968
468 Ga0495652_0576694 3300046529 Bacteria 770
469 Ga0495640_0003327 3300046533 Bacteria 12939
470 Ga0495586_0000552 3300046535 Bacteria 21719
471 Ga0495622_0001538 3300046557 Bacteria 11470
472 Ga0495667_0009148 3300046559 Bacteria 6728
473 Ga0495668_0000004 3300046616 Bacteria 574236
474 Ga0495634_0002697 3300046642 Bacteria 14598
475 Ga0495625_0000553 3300046660 Bacteria 54796
476 Ga0495635_0019697 3300046663 Bacteria 4699
477 Ga0495658_0018110 3300046683 Bacteria 3654
478 Ga0495658_0607773 3300046683 Bacteria 700
479 Ga0495613_0036492 3300046689 Bacteria 3645
480 Ga0495604_0002495 3300047317 Bacteria 14695
481 Ga0495680_0002018 3300047322 Bacteria 21287
482 Ga0495593_0025368 3300047673 Bacteria 3281
483 Ga0496103_0184047 3300048906 Bacteria 1343
484 Ga0496104_0470133 3300048907 Bacteria 1169
485 Ga0496105_0636460 3300048908 Bacteria 824
486 Ga0496106_0062415 3300048909 Bacteria 2829
487 Ga0496106_0296786 3300048909 Bacteria 1296
488 Ga0496107_0090125 3300048910 Bacteria 2240
489 Ga0496108_0096722 3300048911 Bacteria 2515
490 Ga0496109_0224488 3300048912 Bacteria 1767
491 Ga0496110_0022145 3300048913 Bacteria 5392
492 Ga0496110_0948959 3300048913 Bacteria 767
493 Ga0496111_0577511 3300048914 Bacteria 824
494 Ga0496112_0165469 3300048915 Bacteria 2178
495 Ga0496113_0234721 3300048916 Bacteria 1463
496 Ga0496124_0382684 3300048927 Bacteria 983
497 Ga0496124_0522998 3300048927 Bacteria 790
498 Ga0501300_032631 3300049523 Bacteria 771
499 Ga0501033_0158268 3300049570 Bacteria 1631
500 Ga0501036_0581603 3300049572 Bacteria 930
501 Ga0501039_0077735 3300049575 Bacteria 2581
502 Ga0501040_0014062 3300049576 Bacteria 5268
503 Ga0501040_0018340 3300049576 Bacteria 4645
504 Ga0501041_0320973 3300049577 Bacteria 977
505 Ga0501042_0075207 3300049578 Bacteria 2417
506 Ga0501042_0294965 3300049578 Bacteria 1171
507 Ga0501046_0362659 3300049580 Bacteria 1051
508 Ga0501048_0160788 3300049582 Bacteria 1590
509 Ga0501048_0348405 3300049582 Bacteria 1056
510 Ga0501067_0113761 3300049583 Bacteria 1505
511 Ga0501071_0042208 3300049587 Bacteria 3267
512 Ga0501071_0079255 3300049587 Bacteria 2401
513 Ga0501072_0035972 3300049588 Bacteria 3881
514 Ga0501073_0612673 3300049589 Bacteria 752
515 Ga0501075_0035578 3300049591 Bacteria 3714
516 Ga0501075_0083029 3300049591 Bacteria 2427
517 Ga0501076_0003038 3300049592 Bacteria 11668
518 Ga0501076_0385907 3300049592 Bacteria 1151
519 Ga0501079_0254217 3300049741 Bacteria 1373
520 Ga0501080_0024662 3300049742 Bacteria 5578
521 Ga0501262_025252 3300049759 Bacteria 833
522 Ga0501283_007881 3300049779 Bacteria 1525
523 Ga0501035_0363052 3300049822 Bacteria 1210
524 Ga0501035_0465048 3300049822 Bacteria 1045
525 Ga0501045_0038895 3300049824 Bacteria 3461
526 nmdc:mga03683_248435_c1 3300050489 Bacteria 826
527 nmdc:mga03683_36513_c1 3300050489 Bacteria 1999
528 nmdc:mga0k408_28373_c1 3300050493 Bacteria 3182
529 nmdc:mga0k408_357172_c1 3300050493 Bacteria 871
530 nmdc:mga05p37_27888_c1 3300050507 Bacteria 6879
531 nmdc:mga05p37_45790_c1 3300050507 Bacteria 5379
532 nmdc:mga05p37_466751_c1 3300050507 Bacteria 1457
533 nmdc:mga05p37_96085_c1 3300050507 Bacteria 3650
534 nmdc:mga09592_330962_c1 3300050508 Bacteria 1319
535 nmdc:mga09592_94489_c1 3300050508 Bacteria 2557
536 nmdc:mga0qj67_102112_c1 3300050509 Bacteria 2312
537 nmdc:mga0qj67_528938_c1 3300050509 Bacteria 947
538 nmdc:mga0qj67_6110_c1 3300050509 Bacteria 8827
539 nmdc:mga06r32_13589_c1 3300050510 Bacteria 7380
540 nmdc:mga06r32_150345_c1 3300050510 Bacteria 2307
541 nmdc:mga06r32_595505_c1 3300050510 Bacteria 1077
542 nmdc:mga08y16_125138_c1 3300050511 Bacteria 2674
543 nmdc:mga0n895_20283_c1 3300050512 Bacteria 6196
544 nmdc:mga0n895_379976_c1 3300050512 Bacteria 1429
545 nmdc:mga0n895_45914_c1 3300050512 Bacteria 4265
546 nmdc:mga0n895_92159_c1 3300050512 Bacteria 3033
547 nmdc:mga0rr50_213794_c1 3300050513 Bacteria 1590
548 nmdc:mga0rr50_86207_c1 3300050513 Bacteria 2435
549 nmdc:mga08x19_12629_c1 3300050514 Bacteria 5093
550 nmdc:mga08x19_14797_c1 3300050514 Bacteria 4737
551 nmdc:mga08x19_401_c1 3300050514 Bacteria 30460
552 nmdc:mga08x19_477428_c1 3300050514 Bacteria 879
553 nmdc:mga08x19_71125_c1 3300050514 Bacteria 2268
554 nmdc:mga0a205_156041_c1 3300050515 Bacteria 2181
555 nmdc:mga0a205_93318_c1 3300050515 Bacteria 2908
556 Ga0495601_0011164 3300053077 Bacteria 5366
557 Ga0500643_000219 3300053087 Bacteria 53403
558 Ga0500643_000465 3300053087 Bacteria 29876
559 Ga0500643_001114 3300053087 Bacteria 16085
560 Ga0500647_0078205 3300053091 Bacteria 1587
561 Ga0500562_010572 3300053108 Bacteria 2340
562 Ga0500595_013353 3300053119 Bacteria 3148
563 Ga0500658_0151592 3300053134 Bacteria 1045
564 Ga0500561_0044765 3300053137 Bacteria 1184
565 Ga0500568_0002510 3300053139 Bacteria 10740
566 Ga0500573_0069531 3300053140 Bacteria 2009
567 Ga0500588_0077147 3300053146 Bacteria 1107
568 Ga0500604_0000031 3300053151 Bacteria 57942
569 Ga0500604_0002272 3300053151 Bacteria 5258
570 Ga0500616_0001465 3300053153 Bacteria 22527
571 Ga0500627_0000049 3300053158 Bacteria 58947
572 Ga0500627_0016099 3300053158 Bacteria 2909
573 Ga0500627_0036470 3300053158 Bacteria 2094
574 Ga0500587_000417 3300053739 Bacteria 4970
575 Ga0501084_0003460 3300054114 Bacteria 12817
576 Ga0501082_0006112 3300060353 Bacteria 10454
577 Ga0530510_0003204 3300061734 Bacteria 11234
578 2643820536 2643221560 Bacteria 4801179
579 2643836350 2643221563 Bacteria 4726935
580 2644052826 2643221608 Bacteria 4724829
581 2852653961 2852653556 Bacteria 4050083
582 2852682643 2852680915 Bacteria 4100189
583 Ga0495663_0058623
584 JGI24735J21928_10135463
585 JGI25153J46596_10001493
586 Ga0055536_1002550
587 Ga0055536_1007994
588 Ga0055536_1013607
589 Ga0055534_1013686
590 Ga0055530_10000522
591 Ga0055530_10073589
592 Ga0055531_10002871
593 Ga0065704_10308270
594 Ga0065712_10318943
595 Ga0065715_10530377
596 Ga0065707_10168593
597 Ga0070676_10019938
598 Ga0070683_100053606
599 Ga0070683_100121420
600 Ga0070690_100060358
601 Ga0070690_100169261
602 Ga0070670_100000570
603 Ga0070670_100028698
604 Ga0070670_100078166
605 Ga0070670_100645169
606 Ga0070677_10085856
607 Ga0070682_100995762
608 Ga0068868_100000063
609 Ga0068868_100004436
610 Ga0068868_101070760
611 Ga0070660_100019823
612 Ga0070689_100009271
613 Ga0070689_100121635
614 Ga0070687_100185033
615 Ga0070687_100247443
616 Ga0070687_100290079
617 Ga0070661_100019873
618 Ga0070668_100000001
619 Ga0070668_100074846
620 Ga0070668_100299186
621 Ga0070669_100022464
622 Ga0070669_100345079
623 Ga0070675_100004568
624 Ga0070675_100015141
625 Ga0070675_100127337
626 Ga0070675_100264366
627 Ga0070675_100272925
628 Ga0070671_100000167
629 Ga0070671_100136363
630 Ga0070671_100197770
631 Ga0070671_100351490
632 Ga0070674_100008899
633 Ga0070674_100073308
634 Ga0070674_100202326
635 Ga0070673_100102438
636 Ga0070659_100000034
637 Ga0070667_100000006
638 Ga0070667_100171897
639 Ga0070701_10130632
640 Ga0070705_100068326
641 Ga0070705_100243702
642 Ga0070705_100609465
643 Ga0070700_100106550
644 Ga0070694_100106377
645 Ga0070694_100130111
646 Ga0070694_100162686
647 Ga0070694_100188574
648 Ga0070708_100137586
649 Ga0070663_100201931
650 Ga0070678_100019701
651 Ga0070678_100053499
652 Ga0070662_100063538
653 Ga0070662_100941763
654 Ga0070681_10077083
655 Ga0068867_100006451
656 Ga0068867_100104461
657 Ga0068867_100229217
658 Ga0068867_100324926
659 Ga0070685_10285373
660 Ga0070685_10360115
661 Ga0070706_100107619
662 Ga0070707_100011178
663 Ga0070707_100419461
664 Ga0070707_100695297
665 Ga0070679_100092115
666 Ga0070697_100019678
667 Ga0070697_100495558
668 Ga0068853_100233628
669 Ga0070672_100021266
670 Ga0070672_100065270
671 Ga0070686_100000140
672 Ga0070686_100318664
673 Ga0070695_100043021
674 Ga0070695_100098510
675 Ga0070696_100004761
676 Ga0070696_100098839
677 Ga0070696_100347609
678 Ga0070693_100126339
679 Ga0070693_100279134
680 Ga0070665_100000105
681 Ga0070665_100002184
682 Ga0070665_100172679
683 Ga0070665_100462250
684 Ga0070704_100069165
685 Ga0070704_100106528
686 Ga0070704_100495014
687 Ga0070704_100644614
688 Ga0070704_101018157
689 Ga0068855_100309264
690 Ga0070664_100164957
691 Ga0068857_100027365
692 Ga0068854_100499613
693 Ga0068854_100521423
694 Ga0068852_100002785
695 Ga0068852_100214509
696 Ga0068852_100866795
697 Ga0068859_100027031
698 Ga0068859_100028919
699 Ga0068859_100156144
700 Ga0068859_100224662
701 Ga0068859_100487604
702 Ga0068864_100002091
703 Ga0068864_100170796
704 Ga0068864_100582411
705 Ga0068864_100761466
706 Ga0068861_100031256
707 Ga0068861_100073769
708 Ga0068861_100961631
709 Ga0068861_101312257
710 Ga0068851_10288278
711 Ga0068870_10222769
712 Ga0068870_10477842
713 Ga0068863_100001776
714 Ga0068863_100022271
715 Ga0068863_100220834
716 Ga0068863_100446185
717 Ga0068858_100000412
718 Ga0068858_100049472
719 Ga0068860_100000120
720 Ga0068860_100000903
721 Ga0068860_100046033
722 Ga0068860_100123687
723 Ga0068860_100333878
724 Ga0068860_100475791
725 Ga0068862_100000365
726 Ga0068862_100033939
727 Ga0068862_100040916
728 Ga0070717_10811336
729 Ga0070716_100039011
730 Ga0075362_10030142
731 Ga0075367_10070525
732 Ga0075366_10056864
733 Ga0097621_100150814
734 Ga0075370_10268647
735 Ga0068871_100035672
736 Ga0068871_100182195
737 Ga0075428_100198067
738 Ga0075428_100858405
739 Ga0075430_100004710
740 Ga0075430_100037762
741 Ga0075430_100475185
742 Ga0075431_100054682
743 Ga0075431_100199942
744 Ga0075431_100448870
745 Ga0075433_10629491
746 Ga0075434_100039264
747 Ga0075434_100144328
748 Ga0075434_100194328
749 Ga0075434_100443445
750 Ga0075429_100340084
751 Ga0075429_100343100
752 Ga0068865_100003663
753 Ga0068865_100109023
754 Ga0068865_100321729
755 Ga0075436_100000111
756 Ga0097620_100027032
757 Ga0097620_100028919
758 Ga0097620_100156131
759 Ga0097620_100224668
760 Ga0097620_100487595
761 Ga0075435_100130668
762 Ga0075435_100294055
763 Ga0075435_100451210
764 Ga0105240_10008445
765 Ga0111539_10179513
766 Ga0105245_10009778
767 Ga0105245_10246709
768 Ga0105245_10309642
769 Ga0105245_10412655
770 Ga0114129_10033159
771 Ga0114129_10164186
772 Ga0114129_10585700
773 Ga0105243_10037366
774 Ga0105243_10162637
775 Ga0105243_10451846
776 Ga0105243_10637569
777 Ga0105243_10820076
778 Ga0105242_10002502
779 Ga0105242_10069596
780 Ga0105242_10078105
781 Ga0105242_10186724
782 Ga0105242_10884420
783 Ga0105248_10075044
784 Ga0105248_10417796
785 Ga0105248_10476008
786 Ga0105237_10401355
787 Ga0105238_10591871
788 Ga0105238_10683603
789 Ga0105249_10361463
790 Ga0105249_10442664
791 Ga0105249_11573734
792 Ga0157370_10672990
793 Ga0157374_10125352
794 Ga0157378_10004527
795 Ga0157378_10046586
796 Ga0157378_10385566
797 Ga0157378_10797836
798 Ga0163162_10005803
799 Ga0163162_10040290
800 Ga0157372_10408544
801 Ga0157375_10058576
802 Ga0157375_10442310
803 Ga0157375_10605346
804 Ga0157375_11006614
805 Ga0157375_11501661
806 Ga0163163_10382828
807 Ga0163163_10844886
808 Ga0157380_10007364
809 Ga0157380_10231710
810 Ga0157380_10770998
811 Ga0182008_10552911
812 Ga0157379_10035631
813 Ga0157379_10066556
814 Ga0157379_10117893
815 Ga0157379_10232735
816 Ga0163161_10065092
817 Ga0163161_10209428
818 Ga0163161_10452167
819 Ga0206350_11574848
820 Ga0209455_1010168
821 Ga0209675_1003710
822 Ga0209676_1000557
823 Ga0209676_1001387
824 Ga0209676_1001888
825 Ga0209676_1014718
826 Ga0209676_1062433
827 Ga0209025_1036502
828 Ga0209025_1038151
829 Ga0209758_1000036
830 Ga0209050_1000017
831 Ga0209050_1003770
832 Ga0209257_1001118
833 Ga0209257_1001176
834 Ga0209257_1001719
835 Ga0207697_10009458
836 Ga0207656_10358661
837 Ga0207682_10030036
838 Ga0207682_10034359
839 Ga0207688_10008762
840 Ga0207680_10153493
841 Ga0207680_10166946
842 Ga0207680_10240699
843 Ga0207645_10012727
844 Ga0207645_10161383
845 Ga0207643_10020601
846 Ga0207684_10117974
847 Ga0207684_10166258
848 Ga0207707_10346502
849 Ga0207695_10152244
850 Ga0207662_10042493
851 Ga0207662_10149753
852 Ga0207657_10000839
853 Ga0207649_10005015
854 Ga0207652_10126216
855 Ga0207646_10046396
856 Ga0207646_10479208
857 Ga0207681_10082302
858 Ga0207681_10150675
859 Ga0207650_10014606
860 Ga0207650_10244708
861 Ga0207659_10035258
862 Ga0207659_10186644
863 Ga0207659_10203034
864 Ga0207659_10881900
865 Ga0207687_10029259
866 Ga0207687_10499813
867 Ga0207687_10609067
868 Ga0207644_10000047
869 Ga0207644_10035090
870 Ga0207644_10262625
871 Ga0207644_10342530
872 Ga0207644_10342622
873 Ga0207690_10000005
874 Ga0207706_10041710
875 Ga0207686_10017443
876 Ga0207686_10046068
877 Ga0207686_10146154
878 Ga0207709_10041714
879 Ga0207709_10208451
880 Ga0207709_10224338
881 Ga0207709_10250607
882 Ga0207670_10094949
883 Ga0207669_10792508
884 Ga0207669_10927805
885 Ga0207704_10005537
886 Ga0207704_10115058
887 Ga0207665_10019582
888 Ga0207665_10300827
889 Ga0207691_10006268
890 Ga0207691_10219991
891 Ga0207691_10332307
892 Ga0207711_10214071
893 Ga0207689_10195671
894 Ga0207661_10010949
895 Ga0207679_10000906
896 Ga0207667_10638013
897 Ga0207651_10013310
898 Ga0207651_10583017
899 Ga0207712_10050532
900 Ga0207712_10515660
901 Ga0207712_10697973
902 Ga0207712_11032911
903 Ga0207668_10000043
904 Ga0207668_10146778
905 Ga0207668_10586643
906 Ga0207640_10163832
907 Ga0207640_10653420
908 Ga0207658_10000010
909 Ga0207658_10238386
910 Ga0207677_10000044
911 Ga0207677_10686216
912 Ga0207703_10003516
913 Ga0207703_10031316
914 Ga0207703_10273572
915 Ga0207639_10401833
916 Ga0207639_10492166
917 Ga0207639_10631123
918 Ga0207678_10121197
919 Ga0207678_11165008
920 Ga0207708_10019486
921 Ga0207708_10209280
922 Ga0207641_10000294
923 Ga0207641_10012528
924 Ga0207641_10035171
925 Ga0207641_10198953
926 Ga0207641_10302402
927 Ga0207641_10475736
928 Ga0207648_10007566
929 Ga0207648_10010128
930 Ga0207676_10002645
931 Ga0207676_10026026
932 Ga0207676_10077980
933 Ga0207676_10561714
934 Ga0207676_10886521
935 Ga0207674_10034895
936 Ga0207674_10077608
937 Ga0207675_100007331
938 Ga0207675_100042970
939 Ga0207683_10008343
940 Ga0207698_10010035
941 Ga0207698_10607701
942 Ga0207698_10728667
943 Ga0207698_10811690
944 Ga0209967_1000193
945 Ga0209981_1002518
946 Ga0209981_1005097
947 Ga0209996_1007658
948 Ga0209996_1014881
949 Ga0210000_1000435
950 Ga0210000_1000719
951 Ga0209995_1000658
952 Ga0209968_1005366
953 Ga0209968_1005975
954 Ga0209999_1008603
955 Ga0209999_1038090
956 Ga0209983_1021933
957 Ga0209966_1002399
958 Ga0209974_10049378
959 Ga0207428_10080158
960 Ga0268266_10000055
961 Ga0268266_10098288
962 Ga0268266_10443517
963 Ga0268266_10695186
964 Ga0268265_10000143
965 Ga0268265_10017185
966 Ga0268265_10059327
967 Ga0268265_10196026
968 Ga0268264_10000070
969 Ga0268264_10016446
970 Ga0268264_10096134
971 Ga0268264_10451617
972 Ga0265318_10062847
973 Ga0307517_10078802
974 Ga0265330_10059375
975 Ga0265332_10004178
976 Ga0265328_10014479
977 Ga0265320_10023211
978 Ga0265329_10039391
979 Ga0265331_10001179
980 Ga0265331_10017366
981 Ga0265327_10002178
982 Ga0265327_10163829
983 Ga0265316_10001190
984 Ga0265316_10049383
985 Ga0307408_100707213
986 Ga0307408_101342037
987 Ga0265313_10053687
988 Ga0265314_10000887
989 Ga0265342_10029125
990 Ga0307516_10000094
991 Ga0307410_10294831
992 Ga0307406_10041841
993 Ga0307406_10182713
994 Ga0307406_10375685
995 Ga0307412_10046703
996 Ga0307409_100409845
997 Ga0307416_100122364
998 Ga0307416_100521998
999 Ga0307416_101746943
1000 Ga0307414_10001549
1001 Ga0307414_10005871
1002 Ga0307414_10079731
1003 Ga0307414_10090859
1004 Ga0307414_10163229
1005 Ga0307414_10369030
1006 Ga0307414_10433509
1007 Ga0307414_10444246
1008 Ga0307411_10040338
1009 Ga0307411_10216370
1010 Ga0307411_10440116
1011 Ga0307411_10653775
1012 Ga0307411_11221363
1013 Ga0373932_0113151
1014 Ga0373953_0062726
1015 Ga0373927_0009397
1016 Ga0373937_0016620
1017 Ga0373925_0001850
1018 Ga0395898_0402019
1019 Ga0395905_0673841
1020 Ga0436364_1446039
1021 Ga0395901_0019134
1022 Ga0237819_00574
1023 Ga0436365_1862304
1024 Ga0436363_1179848
1025 Ga0439436_0074971
1026 Ga0451798_0420236
1027 Ga0451804_0684765
1028 Ga0451853_0042166
1029 Ga0439441_001972
1030 Ga0439446_0007782
1031 Ga0439434_0008995
1032 Ga0439435_0001153
1033 Ga0439435_0016940
1034 Ga0439444_0010931
1035 Ga0439464_0137737
1036 Ga0451576_0318366
1037 Ga0495592_0000739
1038 Ga0495629_0185204
1039 Ga0495653_0125097
1040 Ga0495650_0094611
1041 Ga0495639_0309824
1042 Ga0495608_0000167
1043 Ga0495610_0162692
1044 Ga0495616_0000022
1045 Ga0495628_0002132
1046 Ga0495630_0023037
1047 Ga0495632_0054694
1048 Ga0495643_0025809
1049 Ga0495666_0002610
1050 Ga0495652_0576694
1051 Ga0495640_0003327
1052 Ga0495586_0000552
1053 Ga0495622_0001538
1054 Ga0495667_0009148
1055 Ga0495668_0000004
1056 Ga0495634_0002697
1057 Ga0495625_0000553
1058 Ga0495635_0019697
1059 Ga0495658_0018110
1060 Ga0495658_0607773
1061 Ga0495613_0036492
1062 Ga0495604_0002495
1063 Ga0495680_0002018
1064 Ga0495593_0025368
1065 Ga0496103_0184047
1066 Ga0496104_0470133
1067 Ga0496105_0636460
1068 Ga0496106_0062415
1069 Ga0496106_0296786
1070 Ga0496107_0090125
1071 Ga0496108_0096722
1072 Ga0496109_0224488
1073 Ga0496110_0022145
1074 Ga0496110_0948959
1075 Ga0496111_0577511
1076 Ga0496112_0165469
1077 Ga0496113_0234721
1078 Ga0496124_0382684
1079 Ga0496124_0522998
1080 Ga0501300_032631
1081 Ga0501033_0158268
1082 Ga0501036_0581603
1083 Ga0501039_0077735
1084 Ga0501040_0014062
1085 Ga0501040_0018340
1086 Ga0501041_0320973
1087 Ga0501042_0075207
1088 Ga0501042_0294965
1089 Ga0501046_0362659
1090 Ga0501048_0160788
1091 Ga0501048_0348405
1092 Ga0501067_0113761
1093 Ga0501071_0042208
1094 Ga0501071_0079255
1095 Ga0501072_0035972
1096 Ga0501073_0612673
1097 Ga0501075_0035578
1098 Ga0501075_0083029
1099 Ga0501076_0003038
1100 Ga0501076_0385907
1101 Ga0501079_0254217
1102 Ga0501080_0024662
1103 Ga0501262_025252
1104 Ga0501283_007881
1105 Ga0501035_0363052
1106 Ga0501035_0465048
1107 Ga0501045_0038895
1108 nmdc:mga03683_248435_c1
1109 nmdc:mga03683_36513_c1
1110 nmdc:mga0k408_28373_c1
1111 nmdc:mga0k408_357172_c1
1112 nmdc:mga05p37_27888_c1
1113 nmdc:mga05p37_45790_c1
1114 nmdc:mga05p37_466751_c1
1115 nmdc:mga05p37_96085_c1
1116 nmdc:mga09592_330962_c1
1117 nmdc:mga09592_94489_c1
1118 nmdc:mga0qj67_102112_c1
1119 nmdc:mga0qj67_528938_c1
1120 nmdc:mga0qj67_6110_c1
1121 nmdc:mga06r32_13589_c1
1122 nmdc:mga06r32_150345_c1
1123 nmdc:mga06r32_595505_c1
1124 nmdc:mga08y16_125138_c1
1125 nmdc:mga0n895_20283_c1
1126 nmdc:mga0n895_379976_c1
1127 nmdc:mga0n895_45914_c1
1128 nmdc:mga0n895_92159_c1
1129 nmdc:mga0rr50_213794_c1
1130 nmdc:mga0rr50_86207_c1
1131 nmdc:mga08x19_12629_c1
1132 nmdc:mga08x19_14797_c1
1133 nmdc:mga08x19_401_c1
1134 nmdc:mga08x19_477428_c1
1135 nmdc:mga08x19_71125_c1
1136 nmdc:mga0a205_156041_c1
1137 nmdc:mga0a205_93318_c1
1138 Ga0495601_0011164
1139 Ga0500643_000219
1140 Ga0500643_000465
1141 Ga0500643_001114
1142 Ga0500647_0078205
1143 Ga0500562_010572
1144 Ga0500595_013353
1145 Ga0500658_0151592
1146 Ga0500561_0044765
1147 Ga0500568_0002510
1148 Ga0500573_0069531
1149 Ga0500588_0077147
1150 Ga0500604_0000031
1151 Ga0500604_0002272
1152 Ga0500616_0001465
1153 Ga0500627_0000049
1154 Ga0500627_0016099
1155 Ga0500627_0036470
1156 Ga0500587_000417
1157 Ga0501084_0003460
1158 Ga0501082_0006112
1159 Ga0530510_0003204
1160 2643820536
1161 2643836350
1162 2644052826
1163 2852653961
1164 2852682643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

136

217

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpr-assembly2.cif.gz_B borrelia miyamotoi fbpa complement inhibitory domain 0.4945 35 173
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.4916 41 178
5zle-assembly1.cif.gz_A human duodenal cytochrome b (dcytb) in substrate free form 0.488 1 176
7ae9-assembly1.cif.gz_B crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.4854 35 176
5zle-assembly1.cif.gz_A human duodenal cytochrome b (dcytb) in substrate free form 0.4715 1 176
ID Description Score Start End Superfamily
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6362 35 176 1.20.120.230
af_I1KW97_209_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6067 45 147 1.20.120.550
af_Q61140_738_874_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5961 35 177 1.20.120.230
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5957 35 176 1.20.120.230
af_I1KW97_209_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5796 45 147 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A383EIT8-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9784 35 141 GO:0016020
AF-A0A7C7S3Q6-F1-model_v4 deleted 0.9667 31 173
AF-A0A2S6TV52-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9621 30 178 GO:0016020
AF-A0A1V1PRK1-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9547 1 178 GO:0016020
AF-A0A2E7UK13-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9534 35 177 GO:0016020

Map