metagRoot

F466209

General Info

Members	Datasets	Scaffolds	Average Seq Length
582	283	493	324

Family's Representative Sequence

Representative Sequence	3300047444\|Ga0495675_0000016\|Ga0495675_0000016_127905_128969
Length	354
Sequence	MLKKYLYVFFYNHIIDPDHLIPLLNIERAMSKSTRNAQSIFHRPLLTGLVVALAALSFALPSQARETLRIGYQKSSTLITLLKTQGSLDKALAQQNIDVSWHEFPSGLPLLEALNVGNVDISADVADTVPIFAQAAQAKLTYFAQEAPSPSAQAIVVHKDSSLQQLSDLKGKTVAVTKAAGSHYLLIAALNKAGLKFSDIQAAYLSPADGRAAFENNKVDAWVTWEPFLTSAQRQLPTRTLADGQGLASYKRYYLTSTNYAQQHPQVLKVVYDQLYKTGSWIKTNPRDAAQVLSPLWGNLGVDVVESANAHRSYQVQPVAIDQLGEQQKIADAFFAAGLLPTAVDAKDVEIWRP

Samples

	Sample ID	Description	Type	Environment
1	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
2	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
3	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
4	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
5	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
6	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
7	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
8	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
9	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
10	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
11	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
12	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
13	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
14	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
15	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
16	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
17	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
18	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
19	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
20	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
21	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
22	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
23	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
24	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
25	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
26	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
27	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
28	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
29	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
30	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
31	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
32	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
33	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
34	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
35	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
36	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
37	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
38	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
39	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
40	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
41	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
42	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
43	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
44	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
45	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
46	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
47	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
48	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
49	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
50	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
51	2904564687	Burkholderia sp. 571	Isolate	Unclassified
52	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
53	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
54	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
55	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
56	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
57	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
58	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
59	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
60	2928170801	Burkholderia sp. 572	Isolate	Unclassified
61	2928536128	Burkholderia sola 565	Isolate	Unclassified
62	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
63	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
64	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
65	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
66	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
67	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
68	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
69	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
70	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
71	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
72	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
73	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
74	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
75	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
76	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
77	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
78	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
79	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
80	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
81	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
82	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
83	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
84	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
85	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
86	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
87	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
88	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
89	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
90	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
91	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
92	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
93	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
94	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
95	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
96	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
97	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
98	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
99	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
100	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
101	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
102	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
103	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
104	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
105	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
106	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
107	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
108	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
109	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
110	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
111	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
112	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
113	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
114	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
115	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
116	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
117	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
118	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
119	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
120	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
121	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
129	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
153	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
155	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
156	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
157	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
158	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
159	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
160	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
161	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
162	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
163	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
164	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
165	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
166	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
167	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
168	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
169	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
170	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
171	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
172	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
173	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
174	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
175	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
176	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
177	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
178	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
179	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
180	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
181	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
182	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
183	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
184	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
185	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
186	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
187	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
188	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
189	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
190	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
191	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
192	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
193	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
194	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
195	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
196	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
197	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
198	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
199	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
200	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
201	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
202	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
203	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
204	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
205	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
206	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
207	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
208	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
209	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
210	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
211	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
212	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
213	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
214	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
215	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
216	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
217	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
218	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
219	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
220	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
221	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
222	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
223	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
224	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
225	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
226	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
227	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
228	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
229	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
230	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
231	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
232	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
233	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
234	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
235	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
236	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
237	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
238	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
239	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
240	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
241	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
242	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
243	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
244	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
245	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
246	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
247	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
248	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
249	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
250	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
251	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
252	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
253	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
254	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
255	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
256	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
257	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
258	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
259	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
260	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
261	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
262	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
263	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
264	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
265	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
266	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
267	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
268	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
269	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
270	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
271	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
272	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
273	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
274	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
275	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
276	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
277	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
278	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
279	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
280	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
281	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
282	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
283	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.71
Metatranscriptomes	0
Isolates	15.29

Biome Distribution

Category	Percentage (%)
Aerial Root	0.34
Bulb	0
Endosphere	4.64
Nodule	1.89
Rhizoplane	6.36
Rhizosphere	73.71
Stem	0
Stem Tuber	0
Unclassified	13.06

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH1_10073167	3300003316	Bacteria	2034
2	rootL2_10028366	3300003322	Bacteria	6745
3	rootL2_10059585	3300003322	Bacteria	4744
4	JGI25160J50197_1000118	3300003354	Bacteria	71711
5	Ga0055532_1002418	3300003758	Bacteria	3906
6	Ga0055527_1005556	3300003760	Bacteria	1632
7	Ga0055535_1011001	3300003761	Bacteria	1455
8	Ga0055542_1003391	3300003762	Bacteria	4341
9	Ga0055529_1007707	3300003763	Bacteria	1455
10	Ga0055528_1006895	3300003790	Bacteria	5094
11	Ga0055530_10000165	3300003791	Bacteria	60120
12	Ga0055540_1000186	3300003792	Bacteria	60120
13	Ga0065165_1000383	3300005262	Bacteria	71804
14	Ga0065714_10005495	3300005288	Bacteria	7225
15	Ga0065714_10069480	3300005288	Bacteria	4212
16	Ga0065714_10100652	3300005288	Bacteria	1605
17	Ga0065704_10096718	3300005289	Bacteria	2419
18	Ga0065704_10101447	3300005289	Bacteria	2228
19	Ga0065712_10010708	3300005290	Bacteria	2057
20	Ga0070670_100004037	3300005331	Bacteria	12255
21	Ga0070670_100008352	3300005331	Bacteria	8826
22	Ga0070661_100001228	3300005344	Bacteria	18034
23	Ga0070669_100000656	3300005353	Bacteria	25577
24	Ga0070663_100143610	3300005455	Bacteria	1824
25	Ga0070663_100318421	3300005455	Bacteria	1250
26	Ga0070662_100010143	3300005457	Bacteria	6172
27	Ga0068853_100206063	3300005539	Bacteria	1791
28	Ga0068855_100260167	3300005563	Bacteria	1933
29	Ga0070664_100001616	3300005564	Bacteria	18034
30	Ga0070664_100107092	3300005564	Bacteria	2437
31	Ga0068851_10005610	3300005834	Bacteria	5697
32	Ga0075364_10205592	3300006051	Bacteria	1335
33	Ga0075432_10003216	3300006058	Bacteria	5508
34	Ga0079104_1000006	3300006946	Bacteria	396255
35	Ga0099826_10018123	3300006948	Bacteria	5318
36	Ga0105251_10000274	3300009011	Bacteria	51694
37	Ga0105251_10002874	3300009011	Bacteria	12992
38	Ga0105251_10003862	3300009011	Bacteria	10676
39	Ga0105251_10012071	3300009011	Bacteria	4902
40	Ga0105251_10044082	3300009011	Bacteria	2156
41	Ga0105244_10001956	3300009036	Bacteria	15982
42	Ga0105244_10019508	3300009036	Bacteria	3782
43	Ga0105244_10105860	3300009036	Bacteria	1372
44	Ga0105250_10000191	3300009092	Bacteria	52429
45	Ga0105250_10000199	3300009092	Bacteria	51075
46	Ga0105250_10068076	3300009092	Bacteria	1437
47	Ga0105240_10001380	3300009093	Bacteria	41739
48	Ga0105242_10001563	3300009176	Bacteria	18015
49	Ga0105248_10050339	3300009177	Bacteria	4672
50	Ga0105248_10071454	3300009177	Bacteria	3899
51	Ga0105237_10000413	3300009545	Bacteria	60829
52	Ga0157373_10002201	3300013100	Bacteria	14757
53	Ga0157373_10005674	3300013100	Bacteria	9349
54	Ga0157373_10005885	3300013100	Bacteria	9174
55	Ga0157373_10084568	3300013100	Bacteria	2236
56	Ga0157373_10097608	3300013100	Bacteria	2068
57	Ga0157373_10125689	3300013100	Bacteria	1803
58	Ga0157371_10000045	3300013102	Bacteria	189065
59	Ga0157371_10001530	3300013102	Bacteria	23802
60	Ga0157371_10083258	3300013102	Bacteria	2265
61	Ga0157370_10187196	3300013104	Bacteria	1922
62	Ga0157370_10294706	3300013104	Bacteria	1498
63	Ga0157369_10006200	3300013105	Bacteria	13873
64	Ga0157369_10029003	3300013105	Bacteria	6119
65	Ga0157369_10228580	3300013105	Bacteria	1945
66	Ga0157375_10000140	3300013308	Bacteria	72172
67	Ga0157375_10014397	3300013308	Bacteria	7054
68	Ga0157375_10055074	3300013308	Bacteria	3919
69	Ga0182008_10003359	3300014497	Bacteria	9715
70	Ga0182008_10005716	3300014497	Bacteria	7043
71	Ga0182006_1002789	3300015261	Bacteria	9325
72	Ga0182006_1023033	3300015261	Bacteria	2581
73	Ga0182006_1039305	3300015261	Bacteria	1867
74	Ga0182007_10000841	3300015262	Bacteria	17020
75	Ga0182007_10005340	3300015262	Bacteria	5659
76	Ga0182007_10027357	3300015262	Bacteria	1967
77	Ga0182005_1004134	3300015265	Bacteria	4745
78	Ga0182005_1036507	3300015265	Bacteria	1336
79	Ga0163161_10017291	3300017792	Bacteria	5046
80	Ga0163161_10018475	3300017792	Bacteria	4886
81	Ga0163161_10066752	3300017792	Bacteria	2627
82	Ga0163161_10072161	3300017792	Bacteria	2528
83	Ga0163161_10081873	3300017792	Bacteria	2378
84	Ga0209566_100665	3300025225	Bacteria	20581
85	Ga0209674_103043	3300025226	Bacteria	3227
86	Ga0209672_100102	3300025228	Bacteria	104385
87	Ga0209147_100071	3300025229	Bacteria	215861
88	Ga0209147_100284	3300025229	Bacteria	43233
89	Ga0209258_100082	3300025242	Bacteria	247739
90	Ga0209148_1000168	3300025254	Bacteria	133952
91	Ga0209455_1000141	3300025272	Bacteria	138212
92	Ga0209673_1000184	3300025273	Bacteria	126036
93	Ga0209676_1001866	3300025292	Bacteria	17337
94	Ga0209564_1024673	3300025295	Bacteria	2049
95	Ga0209050_1000037	3300025298	Bacteria	415612
96	Ga0207426_1000004	3300025302	Bacteria	1047900
97	Ga0209051_1000040	3300025303	Bacteria	315055
98	Ga0209257_1002301	3300025304	Bacteria	19356
99	Ga0207656_10000110	3300025321	Bacteria	31241
100	Ga0207696_1000078	3300025711	Bacteria	207623
101	Ga0207696_1000090	3300025711	Bacteria	188474
102	Ga0207696_1000176	3300025711	Bacteria	100134
103	Ga0207696_1000177	3300025711	Bacteria	100134
104	Ga0207655_1000140	3300025728	Bacteria	139110
105	Ga0207655_1002447	3300025728	Bacteria	15073
106	Ga0207655_1019147	3300025728	Bacteria	3593
107	Ga0207713_1000010	3300025735	Bacteria	528374
108	Ga0207713_1017966	3300025735	Bacteria	3518
109	Ga0207713_1051016	3300025735	Bacteria	1647
110	Ga0207647_10126954	3300025904	Bacteria	1501
111	Ga0207705_10069265	3300025909	Bacteria	2555
112	Ga0207695_10001136	3300025913	Bacteria	46129
113	Ga0207695_10001137	3300025913	Bacteria	46108
114	Ga0207671_10004907	3300025914	Bacteria	12569
115	Ga0207671_10345265	3300025914	Bacteria	1180
116	Ga0207649_10000156	3300025920	Bacteria	55743
117	Ga0207681_10000631	3300025923	Bacteria	23527
118	Ga0207650_10000145	3300025925	Bacteria	85892
119	Ga0207650_10232754	3300025925	Bacteria	1486
120	Ga0207706_10003743	3300025933	Bacteria	14503
121	Ga0207686_10008250	3300025934	Bacteria	5620
122	Ga0207679_10000016	3300025945	Bacteria	253494
123	Ga0207667_10062114	3300025949	Bacteria	3907
124	Ga0207667_10300579	3300025949	Bacteria	1640
125	Ga0207639_10063131	3300026041	Bacteria	2867
126	Ga0207678_10189929	3300026067	Bacteria	1755
127	Ga0207678_10355160	3300026067	Bacteria	1264
128	Ga0209281_1000011	3300027111	Bacteria	695292
129	Ga0209371_1000385	3300027312	Bacteria	46739
130	Ga0209371_1000488	3300027312	Bacteria	38733
131	Ga0207428_10010270	3300027907	Bacteria	8368
132	Ga0207428_10039860	3300027907	Bacteria	3813
133	Ga0268256_1000394	3300030500	Bacteria	39863
134	Ga0268256_1003581	3300030500	Bacteria	6933
135	Ga0307405_10000336	3300031731	Bacteria	17466
136	Ga0307412_10086101	3300031911	Bacteria	2186
137	Ga0307414_10018120	3300032004	Bacteria	4325
138	Ga0307510_10098115	3300033180	Bacteria	2735
139	Ga0395898_0342098	3300037466	Bacteria	1427
140	Ga0439438_000200	3300041405	Bacteria	27336
141	Ga0439438_000450	3300041405	Bacteria	18562
142	Ga0439438_000502	3300041405	Bacteria	17737
143	Ga0439447_001740	3300041407	Bacteria	7981
144	Ga0439466_0067917	3300041411	Bacteria	1139
145	Ga0439431_0016278	3300041997	Bacteria	1739
146	Ga0439452_000115	3300042010	Bacteria	63101
147	Ga0439452_000826	3300042010	Bacteria	14386
148	Ga0439455_0015355	3300042012	Bacteria	1760
149	Ga0439456_012733	3300042013	Bacteria	1745
150	Ga0450911_000027	3300042115	Bacteria	82476
151	Ga0450904_000112	3300042139	Bacteria	18033
152	Ga0439446_0006054	3300042156	Bacteria	3137
153	Ga0439459_0000314	3300042438	Bacteria	5881
154	Ga0439464_0001103	3300042439	Bacteria	6213
155	Ga0439464_0041569	3300042439	Bacteria	1311
156	Ga0439464_0044946	3300042439	Bacteria	1266
157	Ga0450893_0000311	3300042532	Bacteria	6767
158	Ga0466972_0092932	3300044658	Bacteria	1430
159	Ga0466965_0090650	3300044683	Bacteria	1555
160	Ga0466961_0076085	3300044693	Bacteria	2127
161	Ga0466961_0103613	3300044693	Bacteria	1791
162	Ga0466968_0002500	3300044735	Bacteria	6752
163	Ga0466970_0024752	3300044765	Bacteria	3140
164	Ga0466970_0146836	3300044765	Bacteria	1301
165	Ga0466957_0030770	3300044842	Bacteria	3205
166	Ga0466957_0101888	3300044842	Bacteria	1811
167	Ga0495617_000044	3300046452	Bacteria	119709
168	Ga0495617_001946	3300046452	Bacteria	8664
169	Ga0495617_027370	3300046452	Bacteria	1918
170	Ga0495627_000032	3300046453	Bacteria	224665
171	Ga0495627_001103	3300046453	Bacteria	17601
172	Ga0495627_002849	3300046453	Bacteria	7986
173	Ga0495603_0008881	3300046455	Bacteria	6076
174	Ga0495603_0064404	3300046455	Bacteria	2161
175	Ga0495603_0073226	3300046455	Bacteria	2013
176	Ga0495590_0003120	3300046457	Bacteria	6776
177	Ga0495591_000018	3300046458	Bacteria	232216
178	Ga0495591_000074	3300046458	Bacteria	114062
179	Ga0495591_000088	3300046458	Bacteria	102486
180	Ga0495591_001145	3300046458	Bacteria	17397
181	Ga0495591_001166	3300046458	Bacteria	17170
182	Ga0495591_005504	3300046458	Bacteria	5844
183	Ga0495629_0000048	3300046459	Bacteria	109659
184	Ga0495638_0000589	3300046460	Bacteria	41015
185	Ga0495638_0001183	3300046460	Bacteria	25045
186	Ga0495638_0006533	3300046460	Bacteria	8484
187	Ga0495638_0008681	3300046460	Bacteria	7188
188	Ga0495638_0015764	3300046460	Bacteria	5064
189	Ga0495638_0077179	3300046460	Bacteria	2029
190	Ga0495653_0000586	3300046463	Bacteria	28020
191	Ga0495653_0013406	3300046463	Bacteria	6680
192	Ga0495650_0000143	3300046471	Bacteria	168096
193	Ga0495650_0000592	3300046471	Bacteria	50128
194	Ga0495650_0002921	3300046471	Bacteria	12978
195	Ga0495650_0005354	3300046471	Bacteria	8370
196	Ga0495650_0013662	3300046471	Bacteria	4280
197	Ga0495650_0016800	3300046471	Bacteria	3689
198	Ga0495580_0011324	3300046472	Bacteria	6902
199	Ga0495580_0012330	3300046472	Bacteria	6557
200	Ga0495582_0027523	3300046473	Bacteria	3117
201	Ga0495605_0000091	3300046474	Bacteria	115482
202	Ga0495605_0000158	3300046474	Bacteria	86829
203	Ga0495605_0000165	3300046474	Bacteria	83731
204	Ga0495605_0000243	3300046474	Bacteria	64914
205	Ga0495605_0002738	3300046474	Bacteria	10763
206	Ga0495605_0003544	3300046474	Bacteria	9260
207	Ga0495605_0004122	3300046474	Bacteria	8569
208	Ga0495605_0005011	3300046474	Bacteria	7740
209	Ga0495605_0008240	3300046474	Bacteria	5894
210	Ga0495605_0010439	3300046474	Bacteria	5194
211	Ga0495605_0020555	3300046474	Bacteria	3508
212	Ga0495605_0030021	3300046474	Bacteria	2791
213	Ga0495605_0032935	3300046474	Bacteria	2635
214	Ga0495605_0036161	3300046474	Bacteria	2491
215	Ga0495584_0000666	3300046491	Bacteria	22861
216	Ga0495584_0000817	3300046491	Bacteria	20470
217	Ga0495584_0001595	3300046491	Bacteria	13386
218	Ga0495584_0003395	3300046491	Bacteria	8785
219	Ga0495584_0004500	3300046491	Bacteria	7491
220	Ga0495584_0005294	3300046491	Bacteria	6834
221	Ga0495585_0000142	3300046492	Bacteria	79060
222	Ga0495585_0009971	3300046492	Bacteria	5677
223	Ga0495594_0003462	3300046499	Bacteria	8148
224	Ga0495596_0000061	3300046500	Bacteria	79205
225	Ga0495596_0004357	3300046500	Bacteria	6919
226	Ga0495596_0015811	3300046500	Bacteria	3147
227	Ga0495607_0000013	3300046501	Bacteria	189755
228	Ga0495607_0000032	3300046501	Bacteria	153288
229	Ga0495607_0001277	3300046501	Bacteria	22527
230	Ga0495607_0001430	3300046501	Bacteria	21274
231	Ga0495607_0004915	3300046501	Bacteria	9720
232	Ga0495607_0007408	3300046501	Bacteria	7596
233	Ga0495607_0026243	3300046501	Bacteria	3616
234	Ga0495607_0031945	3300046501	Bacteria	3219
235	Ga0495607_0087873	3300046501	Bacteria	1690
236	Ga0495607_0132442	3300046501	Bacteria	1295
237	Ga0495583_0000036	3300046506	Bacteria	246077
238	Ga0495583_0000356	3300046506	Bacteria	71830
239	Ga0495583_0001205	3300046506	Bacteria	27737
240	Ga0495583_0001446	3300046506	Bacteria	24098
241	Ga0495583_0001755	3300046506	Bacteria	20693
242	Ga0495583_0002212	3300046506	Bacteria	17211
243	Ga0495583_0008597	3300046506	Bacteria	6217
244	Ga0495583_0014406	3300046506	Bacteria	4365
245	Ga0495583_0018419	3300046506	Bacteria	3676
246	Ga0495583_0022856	3300046506	Bacteria	3179
247	Ga0495606_0000013	3300046507	Bacteria	292850
248	Ga0495606_0000468	3300046507	Bacteria	66350
249	Ga0495606_0000503	3300046507	Bacteria	63667
250	Ga0495606_0006954	3300046507	Bacteria	10284
251	Ga0495606_0014826	3300046507	Bacteria	6055
252	Ga0495606_0036869	3300046507	Bacteria	3326
253	Ga0495606_0050054	3300046507	Bacteria	2735
254	Ga0495610_0004479	3300046512	Bacteria	10301
255	Ga0495610_0004531	3300046512	Bacteria	10224
256	Ga0495610_0008051	3300046512	Bacteria	6897
257	Ga0495610_0009173	3300046512	Bacteria	6284
258	Ga0495610_0011754	3300046512	Bacteria	5318
259	Ga0495610_0013939	3300046512	Bacteria	4750
260	Ga0495610_0029709	3300046512	Bacteria	2874
261	Ga0495610_0037972	3300046512	Bacteria	2446
262	Ga0495610_0046761	3300046512	Bacteria	2133
263	Ga0495616_0000429	3300046513	Bacteria	32137
264	Ga0495616_0020493	3300046513	Bacteria	3594
265	Ga0495616_0094627	3300046513	Bacteria	1409
266	Ga0495620_0000022	3300046515	Bacteria	136531
267	Ga0495620_0000540	3300046515	Bacteria	24076
268	Ga0495620_0006805	3300046515	Bacteria	6251
269	Ga0495620_0026863	3300046515	Bacteria	2701
270	Ga0495620_0029790	3300046515	Bacteria	2521
271	Ga0495620_0041343	3300046515	Bacteria	2023
272	Ga0495620_0056093	3300046515	Bacteria	1658
273	Ga0495628_0002334	3300046516	Bacteria	17149
274	Ga0495631_0005205	3300046518	Bacteria	6850
275	Ga0495632_0000037	3300046519	Bacteria	158699
276	Ga0495632_0000207	3300046519	Bacteria	59532
277	Ga0495632_0000495	3300046519	Bacteria	37144
278	Ga0495632_0001832	3300046519	Bacteria	17123
279	Ga0495632_0008926	3300046519	Bacteria	6088
280	Ga0495632_0010433	3300046519	Bacteria	5504
281	Ga0495632_0065588	3300046519	Bacteria	1753
282	Ga0495632_0112215	3300046519	Bacteria	1279
283	Ga0495637_0000021	3300046520	Bacteria	179141
284	Ga0495637_0000697	3300046520	Bacteria	23127
285	Ga0495637_0001357	3300046520	Bacteria	14696
286	Ga0495637_0005932	3300046520	Bacteria	6175
287	Ga0495637_0015946	3300046520	Bacteria	3518
288	Ga0495637_0042342	3300046520	Bacteria	1949
289	Ga0495637_0043463	3300046520	Bacteria	1917
290	Ga0495637_0071387	3300046520	Bacteria	1400
291	Ga0495643_0002236	3300046522	Bacteria	15721
292	Ga0495643_0005991	3300046522	Bacteria	8111
293	Ga0495643_0009602	3300046522	Bacteria	6001
294	Ga0495643_0011444	3300046522	Bacteria	5402
295	Ga0495643_0077401	3300046522	Bacteria	1738
296	Ga0495644_0015599	3300046523	Bacteria	2911
297	Ga0495648_0011464	3300046524	Bacteria	6672
298	Ga0495648_0011473	3300046524	Bacteria	6669
299	Ga0495648_0020534	3300046524	Bacteria	4603
300	Ga0495648_0028307	3300046524	Bacteria	3735
301	Ga0495648_0070453	3300046524	Bacteria	2031
302	Ga0495648_0080259	3300046524	Bacteria	1859
303	Ga0495642_0000114	3300046528	Bacteria	45647
304	Ga0495642_0000187	3300046528	Bacteria	36703
305	Ga0495652_0069064	3300046529	Bacteria	2959
306	Ga0495654_0000619	3300046530	Bacteria	28271
307	Ga0495654_0001643	3300046530	Bacteria	15140
308	Ga0495654_0007886	3300046530	Bacteria	5920
309	Ga0495654_0028236	3300046530	Bacteria	2870
310	Ga0495654_0029818	3300046530	Bacteria	2780
311	Ga0495654_0035371	3300046530	Bacteria	2515
312	Ga0495654_0114251	3300046530	Bacteria	1228
313	Ga0495609_0000029	3300046538	Bacteria	217067
314	Ga0495609_0000062	3300046538	Bacteria	138094
315	Ga0495609_0000111	3300046538	Bacteria	94808
316	Ga0495609_0000477	3300046538	Bacteria	32285
317	Ga0495597_0000013	3300046542	Bacteria	203829
318	Ga0495597_0000884	3300046542	Bacteria	23311
319	Ga0495597_0006660	3300046542	Bacteria	5951
320	Ga0495597_0016280	3300046542	Bacteria	3511
321	Ga0495597_0039592	3300046542	Bacteria	2110
322	Ga0495597_0100212	3300046542	Bacteria	1222
323	Ga0495645_0032014	3300046543	Bacteria	3835
324	Ga0495622_0034517	3300046557	Bacteria	2359
325	Ga0495633_0000140	3300046558	Bacteria	96787
326	Ga0495633_0126515	3300046558	Bacteria	1182
327	Ga0495656_0167101	3300046615	Bacteria	1073
328	Ga0495668_0001601	3300046616	Bacteria	21209
329	Ga0495668_0007714	3300046616	Bacteria	6835
330	Ga0495668_0019701	3300046616	Bacteria	3885
331	Ga0495668_0066071	3300046616	Bacteria	1990
332	Ga0495611_0001906	3300046648	Bacteria	9923
333	Ga0495611_0002505	3300046648	Bacteria	8359
334	Ga0495611_0003481	3300046648	Bacteria	6933
335	Ga0495611_0042877	3300046648	Bacteria	2021
336	Ga0495625_0000028	3300046660	Bacteria	256946
337	Ga0495625_0004436	3300046660	Bacteria	13280
338	Ga0495625_0050899	3300046660	Bacteria	2970
339	Ga0495659_0013389	3300046664	Bacteria	2671
340	Ga0495661_0000001	3300046665	Bacteria	898372
341	Ga0495661_0000004	3300046665	Bacteria	555340
342	Ga0495661_0000057	3300046665	Bacteria	135044
343	Ga0495661_0000138	3300046665	Bacteria	85693
344	Ga0495661_0002931	3300046665	Bacteria	12902
345	Ga0495661_0008325	3300046665	Bacteria	7181
346	Ga0495646_0003083	3300046680	Bacteria	10336
347	Ga0495624_0007764	3300046690	Bacteria	7528
348	Ga0495670_0046883	3300046691	Bacteria	2159
349	Ga0495670_0136437	3300046691	Bacteria	1281
350	Ga0495671_0003163	3300046692	Bacteria	10232
351	Ga0495671_0114568	3300046692	Bacteria	1316
352	Ga0495671_0120456	3300046692	Bacteria	1280
353	Ga0495649_0000091	3300046694	Bacteria	77817
354	Ga0495649_0000106	3300046694	Bacteria	74615
355	Ga0495649_0012623	3300046694	Bacteria	4903
356	Ga0495589_0000502	3300046794	Bacteria	27679
357	Ga0495589_0002841	3300046794	Bacteria	9580
358	Ga0495589_0006906	3300046794	Bacteria	5966
359	Ga0495589_0011267	3300046794	Bacteria	4642
360	Ga0495589_0024108	3300046794	Bacteria	3093
361	Ga0495660_0000873	3300046810	Bacteria	22251
362	Ga0495660_0002663	3300046810	Bacteria	11308
363	Ga0495660_0006494	3300046810	Bacteria	6910
364	Ga0495660_0009819	3300046810	Bacteria	5572
365	Ga0495660_0014518	3300046810	Bacteria	4555
366	Ga0495660_0016466	3300046810	Bacteria	4263
367	Ga0495660_0030180	3300046810	Bacteria	3055
368	Ga0495660_0061116	3300046810	Bacteria	2022
369	Ga0495636_0000127	3300047318	Bacteria	31014
370	Ga0495636_0002898	3300047318	Bacteria	6631
371	Ga0495674_0085731	3300047319	Bacteria	2697
372	Ga0495672_0000965	3300047320	Bacteria	29862
373	Ga0495672_0002724	3300047320	Bacteria	15866
374	Ga0495672_0002839	3300047320	Bacteria	15399
375	Ga0495672_0032367	3300047320	Bacteria	3254
376	Ga0495672_0050398	3300047320	Bacteria	2457
377	Ga0495672_0149994	3300047320	Bacteria	1210
378	Ga0495676_0000006	3300047321	Bacteria	280508
379	Ga0495683_0000045	3300047323	Bacteria	131634
380	Ga0495683_0000474	3300047323	Bacteria	31190
381	Ga0495683_0003569	3300047323	Bacteria	9038
382	Ga0495683_0004944	3300047323	Bacteria	7458
383	Ga0495683_0053780	3300047323	Bacteria	2007
384	Ga0495687_000005	3300047443	Bacteria	610401
385	Ga0495687_003493	3300047443	Bacteria	11347
386	Ga0495687_011806	3300047443	Bacteria	4665
387	Ga0495687_020874	3300047443	Bacteria	3183
388	Ga0495687_059155	3300047443	Bacteria	1587
389	Ga0495675_0000016	3300047444	Bacteria	129732
390	Ga0495679_000150	3300047446	Bacteria	62726
391	Ga0495679_000254	3300047446	Bacteria	44204
392	Ga0495679_000325	3300047446	Bacteria	37968
393	Ga0495679_002780	3300047446	Bacteria	8701
394	Ga0495679_005098	3300047446	Bacteria	5894
395	Ga0495679_008663	3300047446	Bacteria	4117
396	Ga0495685_008793	3300047447	Bacteria	3363
397	Ga0495673_0000118	3300047469	Bacteria	147670
398	Ga0495673_0000190	3300047469	Bacteria	97539
399	Ga0495673_0000237	3300047469	Bacteria	78921
400	Ga0495673_0000997	3300047469	Bacteria	25163
401	Ga0495673_0003166	3300047469	Bacteria	11004
402	Ga0495673_0064226	3300047469	Bacteria	1562
403	Ga0495681_0000257	3300047470	Bacteria	43264
404	Ga0495681_0005542	3300047470	Bacteria	8435
405	Ga0495681_0007713	3300047470	Bacteria	6825
406	Ga0495681_0011544	3300047470	Bacteria	5252
407	Ga0495681_0016940	3300047470	Bacteria	4064
408	Ga0495681_0020206	3300047470	Bacteria	3618
409	Ga0495681_0042794	3300047470	Bacteria	2189
410	Ga0495686_0006709	3300047472	Bacteria	8754
411	Ga0495686_0038439	3300047472	Bacteria	3060
412	Ga0495686_0055653	3300047472	Bacteria	2473
413	Ga0495686_0079392	3300047472	Bacteria	2006
414	Ga0495593_0031659	3300047673	Bacteria	2887
415	Ga0495626_0000019	3300048091	Bacteria	225494
416	Ga0495626_0000033	3300048091	Bacteria	184008
417	Ga0495626_0005749	3300048091	Bacteria	7161
418	Ga0495626_0020709	3300048091	Bacteria	3273
419	Ga0496100_0000020	3300048903	Bacteria	147250
420	Ga0496101_0000045	3300048904	Bacteria	157340
421	Ga0496101_0117206	3300048904	Bacteria	2010
422	Ga0496101_0162408	3300048904	Bacteria	1714
423	Ga0496102_0000589	3300048905	Bacteria	38406
424	Ga0496102_0344123	3300048905	Bacteria	1404
425	Ga0496103_0000264	3300048906	Bacteria	50288
426	Ga0496104_0129415	3300048907	Bacteria	2424
427	Ga0496105_0203738	3300048908	Bacteria	1614
428	Ga0496107_0017664	3300048910	Bacteria	5018
429	Ga0496110_0483460	3300048913	Bacteria	1128
430	Ga0496112_0018947	3300048915	Bacteria	6487
431	Ga0496112_0143887	3300048915	Bacteria	2353
432	Ga0496113_0002788	3300048916	Bacteria	10276
433	Ga0496115_0232934	3300048918	Bacteria	1518
434	Ga0496116_0095697	3300048919	Bacteria	1791
435	Ga0496117_0000293	3300048920	Bacteria	89946
436	Ga0496117_0000967	3300048920	Bacteria	43985
437	Ga0496117_0026809	3300048920	Bacteria	4501
438	Ga0496117_0063728	3300048920	Bacteria	2518
439	Ga0496117_0069732	3300048920	Bacteria	2365
440	Ga0496117_0124008	3300048920	Bacteria	1580
441	Ga0496118_0000411	3300048921	Bacteria	71545
442	Ga0496118_0007085	3300048921	Bacteria	12041
443	Ga0496118_0021571	3300048921	Bacteria	5663
444	Ga0496118_0057215	3300048921	Bacteria	2924
445	Ga0496118_0079006	3300048921	Bacteria	2324
446	Ga0496118_0083789	3300048921	Bacteria	2227
447	Ga0496119_0005338	3300048922	Bacteria	12367
448	Ga0496119_0013344	3300048922	Bacteria	6560
449	Ga0496120_0004179	3300048923	Bacteria	12370
450	Ga0496120_0153352	3300048923	Bacteria	1156
451	Ga0496121_0000765	3300048924	Bacteria	59004
452	Ga0496121_0005294	3300048924	Bacteria	16609
453	Ga0496121_0008828	3300048924	Bacteria	11738
454	Ga0496121_0069611	3300048924	Bacteria	2838
455	Ga0496121_0087763	3300048924	Bacteria	2440
456	Ga0496122_0025520	3300048925	Bacteria	5129
457	Ga0496122_0040746	3300048925	Bacteria	3684
458	Ga0496122_0069503	3300048925	Bacteria	2521
459	Ga0496122_0073504	3300048925	Bacteria	2423
460	Ga0496122_0168569	3300048925	Bacteria	1323
461	Ga0496123_0003758	3300048926	Bacteria	16648
462	Ga0496123_0009891	3300048926	Bacteria	8511
463	Ga0496123_0067446	3300048926	Bacteria	2259
464	Ga0496123_0073015	3300048926	Bacteria	2131
465	Ga0496124_0000228	3300048927	Bacteria	109927
466	Ga0496124_0000580	3300048927	Bacteria	61729
467	Ga0496124_0001380	3300048927	Bacteria	36375
468	Ga0496124_0006602	3300048927	Bacteria	12596
469	Ga0496124_0090723	3300048927	Bacteria	2491
470	Ga0496124_0196353	3300048927	Bacteria	1539
471	Ga0496125_0000941	3300048928	Bacteria	45712
472	Ga0496125_0004138	3300048928	Bacteria	16935
473	Ga0496125_0028062	3300048928	Bacteria	5090
474	Ga0496125_0080406	3300048928	Bacteria	2494
475	Ga0496125_0099323	3300048928	Bacteria	2150
476	Ga0496126_0023434	3300048929	Bacteria	5983
477	Ga0496126_0067905	3300048929	Bacteria	3184
478	Ga0496126_0080571	3300048929	Bacteria	2881
479	Ga0496126_0356812	3300048929	Bacteria	1195
480	Ga0495678_000037	3300049459	Bacteria	197851
481	Ga0495678_000583	3300049459	Bacteria	34467
482	Ga0495678_001257	3300049459	Bacteria	20628
483	Ga0495678_002176	3300049459	Bacteria	13770
484	Ga0495678_003624	3300049459	Bacteria	9408
485	Ga0495678_006411	3300049459	Bacteria	6264
486	Ga0495678_007183	3300049459	Bacteria	5807
487	Ga0495678_014083	3300049459	Bacteria	3730
488	Ga0495678_024383	3300049459	Bacteria	2612
489	Ga0495678_048655	3300049459	Bacteria	1652
490	Ga0495682_0000702	3300049460	Bacteria	21923
491	Ga0495682_0020032	3300049460	Bacteria	2513
492	Ga0501032_0012961	3300049569	Bacteria	5938
493	Ga0500634_0015909	3300053161	Bacteria	4006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046455	Ga0495603_0064404	Ga0495603_0064404_128_982	275
2	3300025914	Ga0207671_10345265	Ga0207671_103452651	290
3	3300013102	Ga0157371_10000045	Ga0157371_10000045105	296
4	3300048929	Ga0496126_0080571	Ga0496126_0080571_28_924	298
5	3300009092	Ga0105250_10000199	Ga0105250_1000019937	300
6	3300013100	Ga0157373_10002201	Ga0157373_1000220110	300
7	3300015262	Ga0182007_10005340	Ga0182007_100053404	300
8	3300048925	Ga0496122_0073504	Ga0496122_0073504_1277_2185	300
9	3300048927	Ga0496124_0090723	Ga0496124_0090723_747_1655	300
10	3300048928	Ga0496125_0099323	Ga0496125_0099323_660_1568	300
11	3300048929	Ga0496126_0067905	Ga0496126_0067905_122_1030	300
12	3300046474	Ga0495605_0000165	Ga0495605_0000165_50431_51342	301
13	3300009036	Ga0105244_10019508	Ga0105244_100195082	303
14	3300025728	Ga0207655_1019147	Ga0207655_10191473	303
15	3300046501	Ga0495607_0001430	Ga0495607_0001430_8808_9845	303
16	3300009011	Ga0105251_10012071	Ga0105251_100120715	305
17	3300013105	Ga0157369_10228580	Ga0157369_102285802	305
18	3300046543	Ga0495645_0032014	Ga0495645_0032014_2330_3304	306
19	3300005289	Ga0065704_10101447	Ga0065704_101014471	307
20	3300005290	Ga0065712_10010708	Ga0065712_100107082	307
21	3300017792	Ga0163161_10018475	Ga0163161_100184755	307
22	3300046471	Ga0495650_0016800	Ga0495650_0016800_32_961	307
23	3300046500	Ga0495596_0000061	Ga0495596_0000061_19450_20379	307
24	3300046501	Ga0495607_0031945	Ga0495607_0031945_2207_3136	307
25	3300046616	Ga0495668_0001601	Ga0495668_0001601_19450_20379	307
26	3300048920	Ga0496117_0069732	Ga0496117_0069732_439_1383	307
27	3300048921	Ga0496118_0057215	Ga0496118_0057215_1033_1977	307
28	3300048924	Ga0496121_0087763	Ga0496121_0087763_961_1905	307
29	3300048928	Ga0496125_0028062	Ga0496125_0028062_335_1279	307
30	iso_pu_bacteria	2984499530	2984502088	307
31	3300009011	Ga0105251_10000274	Ga0105251_1000027418	308
32	3300009092	Ga0105250_10000191	Ga0105250_1000019120	308
33	3300046529	Ga0495652_0069064	Ga0495652_0069064_1873_2805	308
34	iso_pu_bacteria	2597489889	2597870270	308
35	iso_pu_bacteria	2599185167	2599397573	308
36	iso_pu_bacteria	2599185179	2599452018	308
37	iso_pu_bacteria	2599185190	2599513598	308
38	iso_pu_bacteria	2599185191	2599517900	308
39	iso_pu_bacteria	2599185288	2599880680	308
40	iso_pu_bacteria	2599185290	2599892275	308
41	iso_pu_bacteria	2599185303	2599949733	308
42	iso_pu_bacteria	2643221571	2643871146	308
43	iso_pu_bacteria	2738541294	2738806199	308
44	iso_pu_bacteria	2738541309	2738893559	308
45	iso_pu_bacteria	2834028612	2834032603	308
46	iso_pu_bacteria	2908446538	2908449013	308
47	iso_pu_bacteria	2929189879	2929193020	308
48	iso_pu_bacteria	2931390751	2931393472	308
49	iso_pu_bacteria	2946006987	2946010589	308
50	iso_pu_bacteria	2946027586	2946031294	308
51	iso_pu_bacteria	2947233263	2947238270	308
52	iso_pu_bacteria	8054285046	8054288376	308
53	iso_pu_bacteria	8054503363	8054506793	308
54	iso_pu_bacteria	8055817908	8055821579	308
55	3300013100	Ga0157373_10005885	Ga0157373_100058852	309
56	3300046471	Ga0495650_0000592	Ga0495650_0000592_33378_34352	309
57	3300046474	Ga0495605_0032935	Ga0495605_0032935_1313_2281	309
58	3300046501	Ga0495607_0000032	Ga0495607_0000032_93897_94865	309
59	3300046506	Ga0495583_0000356	Ga0495583_0000356_15919_16893	309
60	3300046512	Ga0495610_0013939	Ga0495610_0013939_667_1641	309
61	3300046616	Ga0495668_0019701	Ga0495668_0019701_118_1086	309
62	3300046665	Ga0495661_0000057	Ga0495661_0000057_227_1201	309
63	3300046810	Ga0495660_0002663	Ga0495660_0002663_9601_10569	309
64	3300047320	Ga0495672_0050398	Ga0495672_0050398_262_1230	309
65	iso_pu_bacteria	2554235132	2554814852	309
66	iso_pu_bacteria	2606217733	2608383661	309
67	iso_pu_bacteria	3007419365	3007421879	310
68	3300046558	Ga0495633_0126515	Ga0495633_0126515_75_1028	311
69	iso_pu_bacteria	2510065053	2510285012	311
70	iso_pu_bacteria	2510065055	2510294152	311
71	iso_pu_bacteria	2510065058	2510313183	311
72	iso_pu_bacteria	2511231021	2511359953	311
73	iso_pu_bacteria	2600254954	2600442688	311
74	iso_pu_bacteria	2600255389	2602011066	311
75	iso_pu_bacteria	2623620446	2624491718	311
76	iso_pu_bacteria	2823421272	2823421582	311
77	iso_pu_bacteria	2919125081	2919129717	311
78	iso_pu_bacteria	2919501602	2919503490	311
79	iso_pu_bacteria	2926063275	2926065938	311
80	iso_pu_bacteria	2945961074	2945962972	311
81	iso_pu_bacteria	2974298342	2974299728	311
82	iso_pu_bacteria	2984504281	2984504398	311
83	iso_pu_bacteria	8016728285	8016728368	311
84	iso_pu_bacteria	8034962539	8034964343	311
85	iso_pu_bacteria	8056177738	8056179014	311
86	3300005288	Ga0065714_10100652	Ga0065714_101006522	312
87	3300005289	Ga0065704_10096718	Ga0065704_100967182	312
88	3300005331	Ga0070670_100004037	Ga0070670_1000040376	312
89	3300005331	Ga0070670_100008352	Ga0070670_10000835210	312
90	3300005344	Ga0070661_100001228	Ga0070661_10000122816	312
91	3300005353	Ga0070669_100000656	Ga0070669_10000065612	312
92	3300005457	Ga0070662_100010143	Ga0070662_1000101432	312
93	3300005539	Ga0068853_100206063	Ga0068853_1002060631	312
94	3300005564	Ga0070664_100001616	Ga0070664_10000161617	312
95	3300005564	Ga0070664_100107092	Ga0070664_1001070922	312
96	3300005834	Ga0068851_10005610	Ga0068851_100056103	312
97	3300006051	Ga0075364_10205592	Ga0075364_102055921	312
98	3300009011	Ga0105251_10002874	Ga0105251_100028745	312
99	3300009011	Ga0105251_10003862	Ga0105251_100038626	312
100	3300009036	Ga0105244_10105860	Ga0105244_101058601	312
101	3300009176	Ga0105242_10001563	Ga0105242_100015631	312
102	3300009545	Ga0105237_10000413	Ga0105237_100004131	312
103	3300013100	Ga0157373_10005674	Ga0157373_100056748	312
104	3300013100	Ga0157373_10097608	Ga0157373_100976082	312
105	3300013100	Ga0157373_10125689	Ga0157373_101256891	312
106	3300013105	Ga0157369_10006200	Ga0157369_100062003	312
107	3300013105	Ga0157369_10029003	Ga0157369_100290031	312
108	3300013308	Ga0157375_10000140	Ga0157375_1000014032	312
109	3300013308	Ga0157375_10014397	Ga0157375_100143972	312
110	3300013308	Ga0157375_10055074	Ga0157375_100550741	312
111	3300014497	Ga0182008_10003359	Ga0182008_100033599	312
112	3300017792	Ga0163161_10017291	Ga0163161_100172912	312
113	3300017792	Ga0163161_10072161	Ga0163161_100721612	312
114	3300025321	Ga0207656_10000110	Ga0207656_1000011015	312
115	3300025711	Ga0207696_1000090	Ga0207696_1000090149	312
116	3300025711	Ga0207696_1000176	Ga0207696_100017637	312
117	3300025711	Ga0207696_1000177	Ga0207696_100017772	312
118	3300025728	Ga0207655_1000140	Ga0207655_100014020	312
119	3300025735	Ga0207713_1017966	Ga0207713_10179663	312
120	3300025735	Ga0207713_1051016	Ga0207713_10510161	312
121	3300025914	Ga0207671_10004907	Ga0207671_100049074	312
122	3300025920	Ga0207649_10000156	Ga0207649_1000015629	312
123	3300025923	Ga0207681_10000631	Ga0207681_100006319	312
124	3300025925	Ga0207650_10000145	Ga0207650_1000014566	312
125	3300025925	Ga0207650_10232754	Ga0207650_102327541	312
126	3300025933	Ga0207706_10003743	Ga0207706_100037435	312
127	3300025934	Ga0207686_10008250	Ga0207686_100082503	312
128	3300025945	Ga0207679_10000016	Ga0207679_1000001670	312
129	3300026041	Ga0207639_10063131	Ga0207639_100631313	312
130	3300031731	Ga0307405_10000336	Ga0307405_100003365	312
131	3300031911	Ga0307412_10086101	Ga0307412_100861012	312
132	3300046453	Ga0495627_001103	Ga0495627_001103_16478_17431	312
133	3300046458	Ga0495591_001166	Ga0495591_001166_148_1101	312
134	3300046501	Ga0495607_0132442	Ga0495607_0132442_233_1186	312
135	3300046506	Ga0495583_0002212	Ga0495583_0002212_2766_3746	312
136	3300046507	Ga0495606_0006954	Ga0495606_0006954_2093_3046	312
137	3300046512	Ga0495610_0004479	Ga0495610_0004479_3733_4677	312
138	3300046512	Ga0495610_0008051	Ga0495610_0008051_716_1696	312
139	3300046512	Ga0495610_0046761	Ga0495610_0046761_974_1918	312
140	3300046515	Ga0495620_0029790	Ga0495620_0029790_791_1744	312
141	3300046515	Ga0495620_0041343	Ga0495620_0041343_297_1241	312
142	3300046519	Ga0495632_0001832	Ga0495632_0001832_16063_17016	312
143	3300046520	Ga0495637_0015946	Ga0495637_0015946_2228_3172	312
144	3300046522	Ga0495643_0077401	Ga0495643_0077401_76_1029	312
145	3300046524	Ga0495648_0080259	Ga0495648_0080259_606_1586	312
146	3300046530	Ga0495654_0001643	Ga0495654_0001643_247_1227	312
147	3300046530	Ga0495654_0007886	Ga0495654_0007886_2118_3062	312
148	3300046665	Ga0495661_0000138	Ga0495661_0000138_3022_3975	312
149	3300046665	Ga0495661_0002931	Ga0495661_0002931_10321_11301	312
150	3300046794	Ga0495589_0002841	Ga0495589_0002841_7513_8466	312
151	3300046810	Ga0495660_0030180	Ga0495660_0030180_1600_2562	312
152	3300047446	Ga0495679_002780	Ga0495679_002780_7479_8432	312
153	3300047446	Ga0495679_005098	Ga0495679_005098_1022_2002	312
154	3300047446	Ga0495679_008663	Ga0495679_008663_571_1551	312
155	3300047470	Ga0495681_0005542	Ga0495681_0005542_7283_8236	312
156	3300047472	Ga0495686_0055653	Ga0495686_0055653_834_1787	312
157	3300048920	Ga0496117_0000967	Ga0496117_0000967_37018_37971	312
158	3300048920	Ga0496117_0026809	Ga0496117_0026809_2002_2946	312
159	3300048921	Ga0496118_0007085	Ga0496118_0007085_10859_11812	312
160	3300048921	Ga0496118_0021571	Ga0496118_0021571_1986_2930	312
161	3300048922	Ga0496119_0005338	Ga0496119_0005338_6615_7568	312
162	3300048923	Ga0496120_0004179	Ga0496120_0004179_4884_5837	312
163	3300048925	Ga0496122_0040746	Ga0496122_0040746_2094_3056	312
164	3300048926	Ga0496123_0003758	Ga0496123_0003758_15047_16009	312
165	3300048927	Ga0496124_0001380	Ga0496124_0001380_27471_28424	312
166	3300048928	Ga0496125_0000941	Ga0496125_0000941_6019_6972	312
167	3300048928	Ga0496125_0004138	Ga0496125_0004138_838_1800	312
168	3300048928	Ga0496125_0080406	Ga0496125_0080406_1171_2151	312
169	3300048929	Ga0496126_0023434	Ga0496126_0023434_443_1396	312
170	3300053161	Ga0500634_0015909	Ga0500634_0015909_532_1512	312
171	iso_pu_bacteria	2511231007	2511269623	312
172	iso_pu_bacteria	2511231008	2511280835	312
173	iso_pu_bacteria	2599185305	2599958418	312
174	iso_pu_bacteria	2600255283	2601623842	312
175	iso_pu_bacteria	2651869719	2652543952	312
176	iso_pu_bacteria	2667528176	2671126870	312
177	iso_pu_bacteria	2923586266	2923588012	312
178	iso_pu_bacteria	2931369376	2931374705	312
179	iso_pu_bacteria	2931396565	2931401286	312
180	iso_pu_bacteria	3007315729	3007318470	312
181	iso_pu_bacteria	8056131705	8056135234	312
182	3300006058	Ga0075432_10003216	Ga0075432_100032165	313
183	3300027907	Ga0207428_10010270	Ga0207428_100102706	313
184	3300046501	Ga0495607_0026243	Ga0495607_0026243_1740_2687	313
185	3300046542	Ga0495597_0100212	Ga0495597_0100212_250_1197	313
186	3300042439	Ga0439464_0001103	Ga0439464_0001103_4428_5387	314
187	3300044735	Ga0466968_0002500	Ga0466968_0002500_2877_3845	314
188	3300046810	Ga0495660_0014518	Ga0495660_0014518_1748_2719	314
189	iso_pu_bacteria	2738541281	2738743406	314
190	iso_pu_bacteria	2738543032	2739353023	314
191	3300005288	Ga0065714_10005495	Ga0065714_100054956	315
192	3300009036	Ga0105244_10001956	Ga0105244_1000195613	315
193	3300009092	Ga0105250_10068076	Ga0105250_100680761	315
194	3300013100	Ga0157373_10084568	Ga0157373_100845682	315
195	3300013102	Ga0157371_10001530	Ga0157371_100015307	315
196	3300013102	Ga0157371_10083258	Ga0157371_100832582	315
197	3300015261	Ga0182006_1023033	Ga0182006_10230332	315
198	3300015265	Ga0182005_1036507	Ga0182005_10365072	315
199	3300017792	Ga0163161_10066752	Ga0163161_100667522	315
200	3300025711	Ga0207696_1000078	Ga0207696_1000078183	315
201	3300025728	Ga0207655_1002447	Ga0207655_10024473	315
202	3300025735	Ga0207713_1000010	Ga0207713_1000010321	315
203	3300027312	Ga0209371_1000385	Ga0209371_10003859	315
204	3300030500	Ga0268256_1000394	Ga0268256_100039429	315
205	3300033180	Ga0307510_10098115	Ga0307510_100981153	315
206	3300041405	Ga0439438_000502	Ga0439438_000502_12732_13748	315
207	3300041407	Ga0439447_001740	Ga0439447_001740_5565_6581	315
208	3300041411	Ga0439466_0067917	Ga0439466_0067917_87_1103	315
209	3300042010	Ga0439452_000115	Ga0439452_000115_28402_29418	315
210	3300042439	Ga0439464_0044946	Ga0439464_0044946_59_1012	315
211	3300046452	Ga0495617_000044	Ga0495617_000044_42087_43094	315
212	3300046452	Ga0495617_027370	Ga0495617_027370_864_1883	315
213	3300046453	Ga0495627_000032	Ga0495627_000032_79182_80150	315
214	3300046458	Ga0495591_000018	Ga0495591_000018_109556_110524	315
215	3300046458	Ga0495591_000074	Ga0495591_000074_94366_95328	315
216	3300046458	Ga0495591_000088	Ga0495591_000088_42687_43655	315
217	3300046458	Ga0495591_001145	Ga0495591_001145_16019_17038	315
218	3300046460	Ga0495638_0000589	Ga0495638_0000589_3142_4116	315
219	3300046460	Ga0495638_0006533	Ga0495638_0006533_7110_8126	315
220	3300046460	Ga0495638_0008681	Ga0495638_0008681_2238_3233	315
221	3300046471	Ga0495650_0000143	Ga0495650_0000143_140944_141963	315
222	3300046474	Ga0495605_0000091	Ga0495605_0000091_9502_10464	315
223	3300046474	Ga0495605_0000158	Ga0495605_0000158_76291_77307	315
224	3300046474	Ga0495605_0003544	Ga0495605_0003544_5137_6105	315
225	3300046474	Ga0495605_0004122	Ga0495605_0004122_4793_5812	315
226	3300046474	Ga0495605_0010439	Ga0495605_0010439_977_1951	315
227	3300046474	Ga0495605_0036161	Ga0495605_0036161_759_1775	315
228	3300046491	Ga0495584_0000817	Ga0495584_0000817_17252_18226	315
229	3300046491	Ga0495584_0001595	Ga0495584_0001595_10174_11193	315
230	3300046491	Ga0495584_0003395	Ga0495584_0003395_1894_2868	315
231	3300046491	Ga0495584_0004500	Ga0495584_0004500_231_1205	315
232	3300046492	Ga0495585_0000142	Ga0495585_0000142_58030_59004	315
233	3300046492	Ga0495585_0009971	Ga0495585_0009971_1806_2825	315
234	3300046500	Ga0495596_0015811	Ga0495596_0015811_503_1522	315
235	3300046501	Ga0495607_0000013	Ga0495607_0000013_110431_111399	315
236	3300046501	Ga0495607_0007408	Ga0495607_0007408_14_982	315
237	3300046501	Ga0495607_0087873	Ga0495607_0087873_599_1591	315
238	3300046506	Ga0495583_0001205	Ga0495583_0001205_23495_24457	315
239	3300046506	Ga0495583_0001446	Ga0495583_0001446_22974_23966	315
240	3300046506	Ga0495583_0008597	Ga0495583_0008597_3034_4008	315
241	3300046506	Ga0495583_0014406	Ga0495583_0014406_1776_2801	315
242	3300046507	Ga0495606_0000013	Ga0495606_0000013_49719_50738	315
243	3300046507	Ga0495606_0000503	Ga0495606_0000503_58193_59155	315
244	3300046507	Ga0495606_0014826	Ga0495606_0014826_234_1208	315
245	3300046512	Ga0495610_0011754	Ga0495610_0011754_1558_2577	315
246	3300046512	Ga0495610_0037972	Ga0495610_0037972_433_1407	315
247	3300046513	Ga0495616_0020493	Ga0495616_0020493_793_1812	315
248	3300046515	Ga0495620_0000540	Ga0495620_0000540_2175_3149	315
249	3300046515	Ga0495620_0006805	Ga0495620_0006805_3029_4036	315
250	3300046515	Ga0495620_0026863	Ga0495620_0026863_1626_2645	315
251	3300046515	Ga0495620_0056093	Ga0495620_0056093_61_1029	315
252	3300046519	Ga0495632_0000037	Ga0495632_0000037_26283_27257	315
253	3300046519	Ga0495632_0000207	Ga0495632_0000207_31609_32583	315
254	3300046519	Ga0495632_0008926	Ga0495632_0008926_273_1247	315
255	3300046519	Ga0495632_0010433	Ga0495632_0010433_4111_5130	315
256	3300046519	Ga0495632_0065588	Ga0495632_0065588_403_1395	315
257	3300046520	Ga0495637_0000021	Ga0495637_0000021_26043_27068	315
258	3300046520	Ga0495637_0005932	Ga0495637_0005932_2855_3829	315
259	3300046520	Ga0495637_0042342	Ga0495637_0042342_416_1390	315
260	3300046520	Ga0495637_0043463	Ga0495637_0043463_714_1682	315
261	3300046522	Ga0495643_0002236	Ga0495643_0002236_970_1944	315
262	3300046522	Ga0495643_0005991	Ga0495643_0005991_6768_7760	315
263	3300046522	Ga0495643_0009602	Ga0495643_0009602_2261_3235	315
264	3300046523	Ga0495644_0015599	Ga0495644_0015599_133_1158	315
265	3300046524	Ga0495648_0011464	Ga0495648_0011464_766_1734	315
266	3300046524	Ga0495648_0070453	Ga0495648_0070453_281_1273	315
267	3300046528	Ga0495642_0000114	Ga0495642_0000114_29464_30438	315
268	3300046530	Ga0495654_0028236	Ga0495654_0028236_1573_2547	315
269	3300046530	Ga0495654_0029818	Ga0495654_0029818_412_1404	315
270	3300046530	Ga0495654_0114251	Ga0495654_0114251_57_1076	315
271	3300046538	Ga0495609_0000062	Ga0495609_0000062_26592_27611	315
272	3300046538	Ga0495609_0000111	Ga0495609_0000111_75978_76952	315
273	3300046542	Ga0495597_0000013	Ga0495597_0000013_99752_100720	315
274	3300046542	Ga0495597_0016280	Ga0495597_0016280_1878_2852	315
275	3300046542	Ga0495597_0039592	Ga0495597_0039592_167_1162	315
276	3300046615	Ga0495656_0167101	Ga0495656_0167101_46_1014	315
277	3300046616	Ga0495668_0007714	Ga0495668_0007714_3389_4351	315
278	3300046616	Ga0495668_0066071	Ga0495668_0066071_627_1619	315
279	3300046648	Ga0495611_0001906	Ga0495611_0001906_1706_2725	315
280	3300046648	Ga0495611_0042877	Ga0495611_0042877_411_1403	315
281	3300046660	Ga0495625_0000028	Ga0495625_0000028_227619_228638	315
282	3300046660	Ga0495625_0050899	Ga0495625_0050899_545_1513	315
283	3300046665	Ga0495661_0000001	Ga0495661_0000001_128876_129895	315
284	3300046665	Ga0495661_0008325	Ga0495661_0008325_1507_2469	315
285	3300046694	Ga0495649_0000091	Ga0495649_0000091_977_1951	315
286	3300046794	Ga0495589_0011267	Ga0495589_0011267_595_1569	315
287	3300046794	Ga0495589_0024108	Ga0495589_0024108_1423_2391	315
288	3300046810	Ga0495660_0000873	Ga0495660_0000873_20873_21841	315
289	3300046810	Ga0495660_0009819	Ga0495660_0009819_1146_2114	315
290	3300047318	Ga0495636_0000127	Ga0495636_0000127_3074_4048	315
291	3300047320	Ga0495672_0002724	Ga0495672_0002724_11819_12793	315
292	3300047320	Ga0495672_0002839	Ga0495672_0002839_559_1551	315
293	3300047320	Ga0495672_0032367	Ga0495672_0032367_809_1777	315
294	3300047320	Ga0495672_0149994	Ga0495672_0149994_114_1130	315
295	3300047321	Ga0495676_0000006	Ga0495676_0000006_250823_251842	315
296	3300047323	Ga0495683_0003569	Ga0495683_0003569_4426_5445	315
297	3300047443	Ga0495687_020874	Ga0495687_020874_21_1037	315
298	3300047446	Ga0495679_000150	Ga0495679_000150_33263_34282	315
299	3300047469	Ga0495673_0000118	Ga0495673_0000118_141322_142296	315
300	3300047469	Ga0495673_0000190	Ga0495673_0000190_58493_59509	315
301	3300047469	Ga0495673_0000237	Ga0495673_0000237_59698_60687	315
302	3300047469	Ga0495673_0000997	Ga0495673_0000997_22068_23042	315
303	3300047469	Ga0495673_0003166	Ga0495673_0003166_8951_9913	315
304	3300047469	Ga0495673_0064226	Ga0495673_0064226_448_1467	315
305	3300047470	Ga0495681_0000257	Ga0495681_0000257_33875_34843	315
306	3300047470	Ga0495681_0011544	Ga0495681_0011544_2095_3114	315
307	3300047470	Ga0495681_0016940	Ga0495681_0016940_1124_2098	315
308	3300047472	Ga0495686_0006709	Ga0495686_0006709_7371_8345	315
309	3300047472	Ga0495686_0038439	Ga0495686_0038439_143_1162	315
310	3300047472	Ga0495686_0079392	Ga0495686_0079392_486_1454	315
311	3300048091	Ga0495626_0000019	Ga0495626_0000019_195960_196979	315
312	3300048091	Ga0495626_0000033	Ga0495626_0000033_69498_70466	315
313	3300048091	Ga0495626_0005749	Ga0495626_0005749_5236_6210	315
314	3300048913	Ga0496110_0483460	Ga0496110_0483460_24_986	315
315	3300048924	Ga0496121_0008828	Ga0496121_0008828_10647_11609	315
316	3300048925	Ga0496122_0025520	Ga0496122_0025520_3228_4190	315
317	3300048926	Ga0496123_0009891	Ga0496123_0009891_1901_2863	315
318	3300048927	Ga0496124_0000228	Ga0496124_0000228_57936_58910	315
319	3300048927	Ga0496124_0000580	Ga0496124_0000580_8145_9107	315
320	3300048927	Ga0496124_0006602	Ga0496124_0006602_6655_7671	315
321	3300049459	Ga0495678_000583	Ga0495678_000583_1542_2549	315
322	3300049459	Ga0495678_002176	Ga0495678_002176_11820_12794	315
323	3300049459	Ga0495678_003624	Ga0495678_003624_7223_8236	315
324	3300049459	Ga0495678_007183	Ga0495678_007183_896_1888	315
325	3300049459	Ga0495678_014083	Ga0495678_014083_687_1655	315
326	3300049459	Ga0495678_024383	Ga0495678_024383_1199_2173	315
327	3300049460	Ga0495682_0000702	Ga0495682_0000702_2389_3363	315
328	iso_pu_bacteria	2511231016	2511324227	315
329	3300003791	Ga0055530_10000165	Ga0055530_1000016533	316
330	3300003792	Ga0055540_1000186	Ga0055540_100018633	316
331	3300005288	Ga0065714_10069480	Ga0065714_100694802	316
332	3300006946	Ga0079104_1000006	Ga0079104_1000006289	316
333	3300006948	Ga0099826_10018123	Ga0099826_100181231	316
334	3300009011	Ga0105251_10044082	Ga0105251_100440821	316
335	3300014497	Ga0182008_10005716	Ga0182008_100057162	316
336	3300015261	Ga0182006_1002789	Ga0182006_10027892	316
337	3300015262	Ga0182007_10000841	Ga0182007_100008414	316
338	3300017792	Ga0163161_10081873	Ga0163161_100818732	316
339	3300025292	Ga0209676_1001866	Ga0209676_10018662	316
340	3300025298	Ga0209050_1000037	Ga0209050_1000037236	316
341	3300025303	Ga0209051_1000040	Ga0209051_1000040237	316
342	3300025304	Ga0209257_1002301	Ga0209257_10023012	316
343	3300027111	Ga0209281_1000011	Ga0209281_1000011476	316
344	3300027907	Ga0207428_10039860	Ga0207428_100398602	316
345	3300032004	Ga0307414_10018120	Ga0307414_100181205	316
346	3300041405	Ga0439438_000200	Ga0439438_000200_25401_26378	316
347	3300041405	Ga0439438_000450	Ga0439438_000450_16627_17604	316
348	3300042010	Ga0439452_000826	Ga0439452_000826_10847_11824	316
349	3300042013	Ga0439456_012733	Ga0439456_012733_613_1590	316
350	3300046453	Ga0495627_002849	Ga0495627_002849_850_1815	316
351	3300046458	Ga0495591_005504	Ga0495591_005504_855_1820	316
352	3300046460	Ga0495638_0001183	Ga0495638_0001183_20801_21778	316
353	3300046460	Ga0495638_0015764	Ga0495638_0015764_3656_4633	316
354	3300046463	Ga0495653_0013406	Ga0495653_0013406_4425_5399	316
355	3300046471	Ga0495650_0013662	Ga0495650_0013662_300_1265	316
356	3300046474	Ga0495605_0000243	Ga0495605_0000243_60082_61047	316
357	3300046474	Ga0495605_0002738	Ga0495605_0002738_9498_10511	316
358	3300046474	Ga0495605_0020555	Ga0495605_0020555_196_1176	316
359	3300046491	Ga0495584_0000666	Ga0495584_0000666_9641_10618	316
360	3300046499	Ga0495594_0003462	Ga0495594_0003462_2079_3044	316
361	3300046501	Ga0495607_0001277	Ga0495607_0001277_18722_19696	316
362	3300046506	Ga0495583_0000036	Ga0495583_0000036_169771_170736	316
363	3300046507	Ga0495606_0000468	Ga0495606_0000468_64103_65077	316
364	3300046507	Ga0495606_0036869	Ga0495606_0036869_374_1354	316
365	3300046512	Ga0495610_0004531	Ga0495610_0004531_7197_8162	316
366	3300046512	Ga0495610_0009173	Ga0495610_0009173_4143_5120	316
367	3300046512	Ga0495610_0029709	Ga0495610_0029709_1026_2069	316
368	3300046515	Ga0495620_0000022	Ga0495620_0000022_59989_60954	316
369	3300046518	Ga0495631_0005205	Ga0495631_0005205_5228_6193	316
370	3300046519	Ga0495632_0112215	Ga0495632_0112215_275_1252	316
371	3300046520	Ga0495637_0001357	Ga0495637_0001357_8698_9675	316
372	3300046520	Ga0495637_0071387	Ga0495637_0071387_320_1285	316
373	3300046524	Ga0495648_0011473	Ga0495648_0011473_3892_4857	316
374	3300046530	Ga0495654_0000619	Ga0495654_0000619_13757_14722	316
375	3300046538	Ga0495609_0000029	Ga0495609_0000029_168655_169620	316
376	3300046542	Ga0495597_0000884	Ga0495597_0000884_2953_3918	316
377	3300046558	Ga0495633_0000140	Ga0495633_0000140_75150_76115	316
378	3300046648	Ga0495611_0003481	Ga0495611_0003481_3342_4307	316
379	3300046660	Ga0495625_0004436	Ga0495625_0004436_478_1455	316
380	3300046665	Ga0495661_0000004	Ga0495661_0000004_60891_61856	316
381	3300046691	Ga0495670_0046883	Ga0495670_0046883_455_1420	316
382	3300046692	Ga0495671_0003163	Ga0495671_0003163_5928_6905	316
383	3300046692	Ga0495671_0120456	Ga0495671_0120456_274_1239	316
384	3300046694	Ga0495649_0012623	Ga0495649_0012623_1270_2283	316
385	3300046794	Ga0495589_0000502	Ga0495589_0000502_25528_26493	316
386	3300046810	Ga0495660_0006494	Ga0495660_0006494_1230_2195	316
387	3300046810	Ga0495660_0061116	Ga0495660_0061116_531_1505	316
388	3300047323	Ga0495683_0000045	Ga0495683_0000045_75564_76529	316
389	3300047443	Ga0495687_011806	Ga0495687_011806_2590_3567	316
390	3300047444	Ga0495675_0000016	Ga0495675_0000016_127905_128969	316
391	3300047446	Ga0495679_000325	Ga0495679_000325_25575_26540	316
392	3300047470	Ga0495681_0007713	Ga0495681_0007713_4741_5784	316
393	3300047470	Ga0495681_0020206	Ga0495681_0020206_1049_2014	316
394	3300047470	Ga0495681_0042794	Ga0495681_0042794_918_1895	316
395	3300048925	Ga0496122_0069503	Ga0496122_0069503_723_1688	316
396	3300048926	Ga0496123_0067446	Ga0496123_0067446_1006_1971	316
397	3300048927	Ga0496124_0196353	Ga0496124_0196353_476_1447	316
398	3300049459	Ga0495678_000037	Ga0495678_000037_75169_76134	316
399	3300049460	Ga0495682_0020032	Ga0495682_0020032_551_1528	316
400	iso_pu_bacteria	2599185316	2600021786	316
401	iso_pu_bacteria	2599185317	2600029227	316
402	iso_pu_bacteria	2599185325	2600075059	316
403	iso_pu_bacteria	2600254930	2600358602	316
404	iso_pu_bacteria	2808606373	2808905768	316
405	3300003760	Ga0055527_1005556	Ga0055527_10055562	318
406	3300003761	Ga0055535_1011001	Ga0055535_10110012	318
407	3300003762	Ga0055542_1003391	Ga0055542_10033912	318
408	3300003763	Ga0055529_1007707	Ga0055529_10077072	318
409	3300013104	Ga0157370_10294706	Ga0157370_102947062	318
410	3300025228	Ga0209672_100102	Ga0209672_10010269	318
411	3300025229	Ga0209147_100071	Ga0209147_10007142	318
412	3300025242	Ga0209258_100082	Ga0209258_100082166	318
413	3300025254	Ga0209148_1000168	Ga0209148_100016872	318
414	3300025272	Ga0209455_1000141	Ga0209455_100014172	318
415	3300042012	Ga0439455_0015355	Ga0439455_0015355_79_1053	319
416	3300042115	Ga0450911_000027	Ga0450911_000027_50997_51971	319
417	3300042438	Ga0439459_0000314	Ga0439459_0000314_4191_5165	319
418	3300042439	Ga0439464_0041569	Ga0439464_0041569_31_1005	319
419	3300042532	Ga0450893_0000311	Ga0450893_0000311_2030_3004	319
420	3300046452	Ga0495617_001946	Ga0495617_001946_3567_4553	319
421	3300046457	Ga0495590_0003120	Ga0495590_0003120_1696_2682	319
422	3300046460	Ga0495638_0077179	Ga0495638_0077179_347_1333	319
423	3300046471	Ga0495650_0005354	Ga0495650_0005354_3303_4289	319
424	3300046474	Ga0495605_0008240	Ga0495605_0008240_4011_4997	319
425	3300046491	Ga0495584_0005294	Ga0495584_0005294_5126_6112	319
426	3300046501	Ga0495607_0004915	Ga0495607_0004915_3843_4829	319
427	3300046506	Ga0495583_0022856	Ga0495583_0022856_1003_1989	319
428	3300046513	Ga0495616_0000429	Ga0495616_0000429_4086_5072	319
429	3300046519	Ga0495632_0000495	Ga0495632_0000495_32062_33048	319
430	3300046520	Ga0495637_0000697	Ga0495637_0000697_19372_20358	319
431	3300046522	Ga0495643_0011444	Ga0495643_0011444_4073_5059	319
432	3300046524	Ga0495648_0028307	Ga0495648_0028307_2161_3147	319
433	3300046528	Ga0495642_0000187	Ga0495642_0000187_31618_32604	319
434	3300046530	Ga0495654_0035371	Ga0495654_0035371_625_1611	319
435	3300046538	Ga0495609_0000477	Ga0495609_0000477_1519_2505	319
436	3300046542	Ga0495597_0006660	Ga0495597_0006660_3336_4322	319
437	3300046648	Ga0495611_0002505	Ga0495611_0002505_4117_5103	319
438	3300046664	Ga0495659_0013389	Ga0495659_0013389_840_1826	319
439	3300046691	Ga0495670_0136437	Ga0495670_0136437_18_1004	319
440	3300046692	Ga0495671_0114568	Ga0495671_0114568_72_1058	319
441	3300046694	Ga0495649_0000106	Ga0495649_0000106_39391_40377	319
442	3300046794	Ga0495589_0006906	Ga0495589_0006906_4133_5119	319
443	3300046810	Ga0495660_0016466	Ga0495660_0016466_1203_2189	319
444	3300047318	Ga0495636_0002898	Ga0495636_0002898_4110_5096	319
445	3300047320	Ga0495672_0000965	Ga0495672_0000965_1536_2522	319
446	3300047323	Ga0495683_0000474	Ga0495683_0000474_22919_23905	319
447	3300047443	Ga0495687_003493	Ga0495687_003493_4150_5136	319
448	3300047447	Ga0495685_008793	Ga0495685_008793_2323_3309	319
449	3300048091	Ga0495626_0020709	Ga0495626_0020709_1600_2586	319
450	3300049459	Ga0495678_001257	Ga0495678_001257_19070_20056	319
451	3300049459	Ga0495678_006411	Ga0495678_006411_1024_2010	319
452	3300049569	Ga0501032_0012961	Ga0501032_0012961_1479_2453	319
453	3300041997	Ga0439431_0016278	Ga0439431_0016278_55_1035	320
454	3300042139	Ga0450904_000112	Ga0450904_000112_8146_9126	320
455	3300042156	Ga0439446_0006054	Ga0439446_0006054_1153_2133	320
456	3300003790	Ga0055528_1006895	Ga0055528_10068955	321
457	3300025273	Ga0209673_1000184	Ga0209673_100018446	321
458	3300027312	Ga0209371_1000488	Ga0209371_100048844	321
459	3300030500	Ga0268256_1003581	Ga0268256_10035817	321
460	3300044693	Ga0466961_0103613	Ga0466961_0103613_246_1235	322
461	3300046455	Ga0495603_0073226	Ga0495603_0073226_949_1953	322
462	3300046459	Ga0495629_0000048	Ga0495629_0000048_84946_85950	322
463	3300046463	Ga0495653_0000586	Ga0495653_0000586_8677_9681	322
464	3300046471	Ga0495650_0002921	Ga0495650_0002921_10597_11601	322
465	3300046472	Ga0495580_0011324	Ga0495580_0011324_1482_2486	322
466	3300046473	Ga0495582_0027523	Ga0495582_0027523_1010_2014	322
467	3300046474	Ga0495605_0005011	Ga0495605_0005011_4152_5156	322
468	3300046500	Ga0495596_0004357	Ga0495596_0004357_5334_6338	322
469	3300046506	Ga0495583_0001755	Ga0495583_0001755_14330_15334	322
470	3300046507	Ga0495606_0050054	Ga0495606_0050054_794_1798	322
471	3300046516	Ga0495628_0002334	Ga0495628_0002334_9263_10267	322
472	3300046680	Ga0495646_0003083	Ga0495646_0003083_1924_2928	322
473	3300046690	Ga0495624_0007764	Ga0495624_0007764_6443_7447	322
474	3300047319	Ga0495674_0085731	Ga0495674_0085731_1482_2486	322
475	3300047323	Ga0495683_0004944	Ga0495683_0004944_5176_6180	322
476	3300047446	Ga0495679_000254	Ga0495679_000254_18400_19404	322
477	3300047673	Ga0495593_0031659	Ga0495593_0031659_1642_2646	322
478	3300048920	Ga0496117_0063728	Ga0496117_0063728_999_2003	322
479	3300048921	Ga0496118_0079006	Ga0496118_0079006_856_1863	322
480	3300048929	Ga0496126_0356812	Ga0496126_0356812_117_1121	322
481	3300049459	Ga0495678_048655	Ga0495678_048655_84_1088	322
482	3300003322	rootL2_10028366	rootL2_100283666	323
483	3300013104	Ga0157370_10187196	Ga0157370_101871962	323
484	3300015265	Ga0182005_1004134	Ga0182005_10041342	323
485	3300025295	Ga0209564_1024673	Ga0209564_10246732	323
486	3300048920	Ga0496117_0124008	Ga0496117_0124008_351_1445	323
487	3300047443	Ga0495687_000005	Ga0495687_000005_181652_182641	324
488	3300037466	Ga0395898_0342098	Ga0395898_0342098_177_1154	325
489	iso_pu_bacteria	2508501125	2509131691	325
490	iso_pu_bacteria	2515154122	2515679828	325
491	iso_pu_bacteria	2562617112	2563059007	325
492	iso_pu_bacteria	2599185239	2599737309	325
493	iso_pu_bacteria	2599185240	2599746958	325
494	iso_pu_bacteria	2599185355	2600208884	325
495	iso_pu_bacteria	2675903129	2676744524	325
496	iso_pu_bacteria	2711768613	2713480715	325
497	iso_pu_bacteria	2808606384	2808969306	325
498	iso_pu_bacteria	2808606390	2809004137	325
499	iso_pu_bacteria	2818991452	2819634969	325
500	iso_pu_bacteria	2863421361	2863424465	325
501	iso_pu_bacteria	2870068957	2870071613	325
502	iso_pu_bacteria	2902682994	2902690242	325
503	iso_pu_bacteria	2904564687	2904568757	325
504	iso_pu_bacteria	2904571731	2904575799	325
505	iso_pu_bacteria	2921643360	2921646404	325
506	iso_pu_bacteria	2928157003	2928160547	325
507	iso_pu_bacteria	2928170801	2928172844	325
508	iso_pu_bacteria	2928536128	2928540816	325
509	iso_pu_bacteria	2981990288	2981996147	325
510	iso_pu_bacteria	641736154	642415729	325
511	iso_pu_bacteria	8018845410	8018853578	325
512	iso_pu_bacteria	8020938398	8020942211	325
513	iso_pu_bacteria	8020945358	8020949412	325
514	iso_pu_bacteria	8020953355	8020958015	325
515	iso_pu_bacteria	8021120328	8021124260	325
516	iso_pu_bacteria	8039098773	8039104696	325
517	3300003322	rootL2_10059585	rootL2_100595854	328
518	3300003316	rootH1_10073167	rootH1_100731673	329
519	3300003354	JGI25160J50197_1000118	JGI25160J50197_100011849	329
520	3300003758	Ga0055532_1002418	Ga0055532_10024183	329
521	3300005262	Ga0065165_1000383	Ga0065165_100038327	329
522	3300005455	Ga0070663_100143610	Ga0070663_1001436103	329
523	3300005455	Ga0070663_100318421	Ga0070663_1003184211	329
524	3300005563	Ga0068855_100260167	Ga0068855_1002601673	329
525	3300009093	Ga0105240_10001380	Ga0105240_1000138041	329
526	3300009177	Ga0105248_10050339	Ga0105248_100503392	329
527	3300009177	Ga0105248_10071454	Ga0105248_100714542	329
528	3300015261	Ga0182006_1039305	Ga0182006_10393053	329
529	3300015262	Ga0182007_10027357	Ga0182007_100273573	329
530	3300025225	Ga0209566_100665	Ga0209566_10066516	329
531	3300025226	Ga0209674_103043	Ga0209674_1030432	329
532	3300025229	Ga0209147_100284	Ga0209147_10028440	329
533	3300025302	Ga0207426_1000004	Ga0207426_1000004397	329
534	3300025904	Ga0207647_10126954	Ga0207647_101269541	329
535	3300025909	Ga0207705_10069265	Ga0207705_100692653	329
536	3300025913	Ga0207695_10001136	Ga0207695_1000113641	329
537	3300025913	Ga0207695_10001137	Ga0207695_1000113741	329
538	3300025949	Ga0207667_10062114	Ga0207667_100621145	329
539	3300025949	Ga0207667_10300579	Ga0207667_103005791	329
540	3300026067	Ga0207678_10189929	Ga0207678_101899292	329
541	3300026067	Ga0207678_10355160	Ga0207678_103551601	329
542	3300044658	Ga0466972_0092932	Ga0466972_0092932_282_1271	329
543	3300044683	Ga0466965_0090650	Ga0466965_0090650_464_1453	329
544	3300044693	Ga0466961_0076085	Ga0466961_0076085_988_1977	329
545	3300044765	Ga0466970_0024752	Ga0466970_0024752_743_1732	329
546	3300044765	Ga0466970_0146836	Ga0466970_0146836_47_1036	329
547	3300044842	Ga0466957_0030770	Ga0466957_0030770_625_1614	329
548	3300044842	Ga0466957_0101888	Ga0466957_0101888_214_1203	329
549	3300046455	Ga0495603_0008881	Ga0495603_0008881_3603_4607	329
550	3300046472	Ga0495580_0012330	Ga0495580_0012330_1256_2260	329
551	3300046474	Ga0495605_0030021	Ga0495605_0030021_1741_2745	329
552	3300046506	Ga0495583_0018419	Ga0495583_0018419_1140_2144	329
553	3300046513	Ga0495616_0094627	Ga0495616_0094627_84_1088	329
554	3300046524	Ga0495648_0020534	Ga0495648_0020534_2499_3503	329
555	3300046557	Ga0495622_0034517	Ga0495622_0034517_230_1234	329
556	3300047323	Ga0495683_0053780	Ga0495683_0053780_511_1515	329
557	3300047443	Ga0495687_059155	Ga0495687_059155_399_1403	329
558	3300048903	Ga0496100_0000020	Ga0496100_0000020_27311_28315	329
559	3300048904	Ga0496101_0000045	Ga0496101_0000045_129033_130037	329
560	3300048904	Ga0496101_0117206	Ga0496101_0117206_500_1504	329
561	3300048904	Ga0496101_0162408	Ga0496101_0162408_108_1112	329
562	3300048905	Ga0496102_0000589	Ga0496102_0000589_10129_11133	329
563	3300048905	Ga0496102_0344123	Ga0496102_0344123_211_1215	329
564	3300048906	Ga0496103_0000264	Ga0496103_0000264_26731_27735	329
565	3300048907	Ga0496104_0129415	Ga0496104_0129415_261_1265	329
566	3300048908	Ga0496105_0203738	Ga0496105_0203738_507_1511	329
567	3300048910	Ga0496107_0017664	Ga0496107_0017664_1540_2544	329
568	3300048915	Ga0496112_0018947	Ga0496112_0018947_4762_5766	329
569	3300048915	Ga0496112_0143887	Ga0496112_0143887_805_1794	329
570	3300048916	Ga0496113_0002788	Ga0496113_0002788_1144_2148	329
571	3300048918	Ga0496115_0232934	Ga0496115_0232934_471_1475	329
572	3300048919	Ga0496116_0095697	Ga0496116_0095697_780_1769	329
573	3300048920	Ga0496117_0000293	Ga0496117_0000293_27380_28384	329
574	3300048921	Ga0496118_0000411	Ga0496118_0000411_27384_28388	329
575	3300048921	Ga0496118_0083789	Ga0496118_0083789_251_1240	329
576	3300048922	Ga0496119_0013344	Ga0496119_0013344_5365_6369	329
577	3300048923	Ga0496120_0153352	Ga0496120_0153352_123_1127	329
578	3300048924	Ga0496121_0000765	Ga0496121_0000765_26004_27008	329
579	3300048924	Ga0496121_0005294	Ga0496121_0005294_12071_13075	329
580	3300048924	Ga0496121_0069611	Ga0496121_0069611_538_1527	329
581	3300048925	Ga0496122_0168569	Ga0496122_0168569_172_1176	329
582	3300048926	Ga0496123_0073015	Ga0496123_0073015_989_1978	329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

92

289

0.88 PF16868

NMT1_3

NMT1-like family

119

249

0.85 PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

66

279

0.84 PF13379

NMT1_2

NMT1-like family

63

295

0.78 PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

108

242

0.72 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2x26-assembly1.cif.gz_A	crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli	0.9447	31	310
2x26-assembly2.cif.gz_B	crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli	0.943	31	310
2x26-assembly2.cif.gz_B	crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli	0.8995	31	310
2x26-assembly1.cif.gz_A	crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli	0.8531	31	310
3ksx-assembly1.cif.gz_A	the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops	0.8393	31	309

ID	Description	Score	Start	End	Superfamily
3ksxA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.946	116	212	3.40.190.10
2x26A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9134	31	310	3.40.190.10
3ksxA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9101	116	212	3.40.190.10
2x26A01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8761	31	310	3.40.190.10
3uifA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.8753	119	212	3.40.190.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1A7R8R6-F1-model_v4	Aliphatic sulfonate ABC transporter substrate-binding protein	0.9389	34	319	GO:0016020 GO:0042597 GO:0042626
AF-A0A1A7R8R6-F1-model_v4	Aliphatic sulfonate ABC transporter substrate-binding protein	0.9326	34	319	GO:0016020 GO:0042597 GO:0042626
AF-A0A838R042-F1-model_v4	Aliphatic sulfonate ABC transporter substrate-binding protein	0.9299	22	316	GO:0016020 GO:0042597 GO:0042626
AF-A0A4R9WJY7-F1-model_v4	Transporter substrate-binding domain-containing protein	0.9269	106	191
AF-A0A6L3STR4-F1-model_v4	Aliphatic sulfonate ABC transporter substrate-binding protein	0.9261	16	311	GO:0016020 GO:0042597 GO:0042626

Feature Viewer

pLDDT	pTM	Quality
90.41	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F466209

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF09084

NMT1

NMT1/THI5 like

92

289

0.88

PF16868

NMT1_3

NMT1-like family

119

249

0.85

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

66

279

0.84

PF13379

NMT1_2

NMT1-like family

63

295

0.78

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

108

242

0.72

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map