F466217

General Info

Members Datasets Scaffolds Average Seq Length
582 226 582 331

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0321994|Ga0501036_0321994_35_988
Length 317
Sequence VLILAGWFGPALAQDVGIITGSEKGTYYRFGLDLQKLLKPSGINVTVHPSRGSVDNIYAVYQRPGVQLGVVQADVLAFITRVQSNPLLMQIAKKTRLVFPLYNEEIHLVGKRGIRDFDDLAGKRVAIGRDGSGTYLTSRILFKLSEVQAEFVLIDTAEALAELKAGRIDAMLYVAGAPVGLFKDDVTEADGLALIPITNKSIGEFYPQVEIPARMYSWQPDVVNTVAVKAVLISYDFRRKDCDTVGKVAQLTNAQIETLRKGGHAKWKVVDLDAQVKGWEQYDCVRKYLGRATPATAAKKRTSDNPVLDAIKQMLDD

Samples

Sample ID Description Type Environment
1 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
178 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 98.97
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1002783 3300003371 Unclassified 1375
2 Ga0058862_12779875 3300004803 Bacteria 1577
3 Ga0065704_10122491 3300005289 Bacteria 1749
4 Ga0065712_10091311 3300005290 Bacteria 2380
5 Ga0065715_10153476 3300005293 Bacteria 1702
6 Ga0065707_10239791 3300005295 Bacteria 1160
7 Ga0070676_10001199 3300005328 Bacteria 12991
8 Ga0070670_100025599 3300005331 Bacteria 5075
9 Ga0068869_100003166 3300005334 Bacteria 10041
10 Ga0070680_100018994 3300005336 Bacteria 5440
11 Ga0070680_100085840 3300005336 Unclassified 2601
12 Ga0070682_100003456 3300005337 Bacteria 8738
13 Ga0068868_100006957 3300005338 Bacteria 8039
14 Ga0070660_100001484 3300005339 Bacteria 16063
15 Ga0070689_100406391 3300005340 Bacteria 1152
16 Ga0070691_10007452 3300005341 Bacteria 5016
17 Ga0070691_10122840 3300005341 Bacteria 1309
18 Ga0070661_100001482 3300005344 Bacteria 16294
19 Ga0070692_10000237 3300005345 Bacteria 15137
20 Ga0070692_10004872 3300005345 Bacteria 5650
21 Ga0070668_100115249 3300005347 Unclassified 2142
22 Ga0070669_100014776 3300005353 Bacteria 5560
23 Ga0070669_100074741 3300005353 Bacteria 2512
24 Ga0070675_100268052 3300005354 Bacteria 1498
25 Ga0070673_100023814 3300005364 Bacteria 4479
26 Ga0070659_100001725 3300005366 Bacteria 15702
27 Ga0070703_10004890 3300005406 Bacteria 3744
28 Ga0070701_10036008 3300005438 Bacteria 2491
29 Ga0070701_10044576 3300005438 Bacteria 2272
30 Ga0070711_100133205 3300005439 Bacteria 1854
31 Ga0070705_100008127 3300005440 Bacteria 5190
32 Ga0070705_100020418 3300005440 Bacteria 3506
33 Ga0070705_100193815 3300005440 Bacteria 1387
34 Ga0070705_100204624 3300005440 Bacteria 1356
35 Ga0070694_100002264 3300005444 Bacteria 11375
36 Ga0070694_100013750 3300005444 Bacteria 5060
37 Ga0070694_100014905 3300005444 Bacteria 4871
38 Ga0070694_100055873 3300005444 Bacteria 2679
39 Ga0070694_100181052 3300005444 Bacteria 1559
40 Ga0070708_100023994 3300005445 Bacteria 5193
41 Ga0070708_100028197 3300005445 Bacteria 4829
42 Ga0070708_100033032 3300005445 Bacteria 4494
43 Ga0070708_100047366 3300005445 Bacteria 3797
44 Ga0070708_100058714 3300005445 Bacteria 3428
45 Ga0070708_100143972 3300005445 Bacteria 2212
46 Ga0070708_100182980 3300005445 Bacteria 1959
47 Ga0070708_100203325 3300005445 Bacteria 1855
48 Ga0070708_100350447 3300005445 Bacteria 1391
49 Ga0070663_100014481 3300005455 Bacteria 5063
50 Ga0070662_100183424 3300005457 Bacteria 1651
51 Ga0070662_100220939 3300005457 Unclassified 1512
52 Ga0070681_10040330 3300005458 Bacteria 4678
53 Ga0068867_100014336 3300005459 Bacteria 5614
54 Ga0068867_100062250 3300005459 Bacteria 2772
55 Ga0068867_100315757 3300005459 Unclassified 1293
56 Ga0070706_100017090 3300005467 Bacteria 6702
57 Ga0070706_100018011 3300005467 Bacteria 6515
58 Ga0070706_100025183 3300005467 Bacteria 5477
59 Ga0070706_100039638 3300005467 Bacteria 4348
60 Ga0070706_100060936 3300005467 Bacteria 3483
61 Ga0070706_100080864 3300005467 Bacteria 3009
62 Ga0070706_100088370 3300005467 Bacteria 2873
63 Ga0070707_100001008 3300005468 Bacteria 27893
64 Ga0070707_100005140 3300005468 Bacteria 12258
65 Ga0070707_100011324 3300005468 Bacteria 8313
66 Ga0070707_100013221 3300005468 Bacteria 7717
67 Ga0070707_100027164 3300005468 Bacteria 5442
68 Ga0070707_100029910 3300005468 Bacteria 5183
69 Ga0070707_100090965 3300005468 Bacteria 2954
70 Ga0070707_100104076 3300005468 Bacteria 2751
71 Ga0070707_100104913 3300005468 Bacteria 2740
72 Ga0070707_100152229 3300005468 Bacteria 2252
73 Ga0070707_100283287 3300005468 Bacteria 1610
74 Ga0070707_100395573 3300005468 Unclassified 1342
75 Ga0070698_100002031 3300005471 Bacteria 22500
76 Ga0070698_100005744 3300005471 Bacteria 13567
77 Ga0070698_100079091 3300005471 Bacteria 3285
78 Ga0070698_100112494 3300005471 Unclassified 2687
79 Ga0070698_100129395 3300005471 Unclassified 2481
80 Ga0070698_100133104 3300005471 Bacteria 2441
81 Ga0070698_100271497 3300005471 Bacteria 1627
82 Ga0070698_100389457 3300005471 Bacteria 1326
83 Ga0070699_100001966 3300005518 Bacteria 18554
84 Ga0070699_100010796 3300005518 Bacteria 7905
85 Ga0070699_100010954 3300005518 Bacteria 7840
86 Ga0070699_100043710 3300005518 Bacteria 3878
87 Ga0070699_100064034 3300005518 Bacteria 3189
88 Ga0070699_100084014 3300005518 Unclassified 2778
89 Ga0070699_100087391 3300005518 Bacteria 2721
90 Ga0070679_100022523 3300005530 Bacteria 6158
91 Ga0070684_100073538 3300005535 Bacteria 3012
92 Ga0070697_100002500 3300005536 Bacteria 14147
93 Ga0070697_100011809 3300005536 Bacteria 6836
94 Ga0070697_100041613 3300005536 Bacteria 3720
95 Ga0068853_100001823 3300005539 Bacteria 15670
96 Ga0070672_100004962 3300005543 Bacteria 8761
97 Ga0070686_100149430 3300005544 Bacteria 1635
98 Ga0070695_100001428 3300005545 Bacteria 13242
99 Ga0070695_100001603 3300005545 Bacteria 12664
100 Ga0070695_100001651 3300005545 Bacteria 12528
101 Ga0070695_100037382 3300005545 Bacteria 3059
102 Ga0070695_100069993 3300005545 Unclassified 2294
103 Ga0070695_100120367 3300005545 Unclassified 1795
104 Ga0070696_100017688 3300005546 Bacteria 4814
105 Ga0070696_100071091 3300005546 Bacteria 2448
106 Ga0070696_100103742 3300005546 Bacteria 2041
107 Ga0070693_100003873 3300005547 Bacteria 7017
108 Ga0070693_100200150 3300005547 Bacteria 1297
109 Ga0070704_100003341 3300005549 Bacteria 9183
110 Ga0070704_100024672 3300005549 Bacteria 3948
111 Ga0070704_100026801 3300005549 Bacteria 3813
112 Ga0070704_100037077 3300005549 Bacteria 3327
113 Ga0070704_100166992 3300005549 Bacteria 1746
114 Ga0070704_100381535 3300005549 Bacteria 1198
115 Ga0068855_100005123 3300005563 Bacteria 15980
116 Ga0070664_100019414 3300005564 Bacteria 5593
117 Ga0068857_100135913 3300005577 Bacteria 2220
118 Ga0068854_100016543 3300005578 Bacteria 4919
119 Ga0068856_100062579 3300005614 Bacteria 3676
120 Ga0070702_100013212 3300005615 Bacteria 4163
121 Ga0070702_100354786 3300005615 Bacteria 1034
122 Ga0068852_100038813 3300005616 Bacteria 4005
123 Ga0068859_100034111 3300005617 Bacteria 5109
124 Ga0068859_100128515 3300005617 Bacteria 2605
125 Ga0068864_100014929 3300005618 Bacteria 6454
126 Ga0068861_100023978 3300005719 Bacteria 4407
127 Ga0068870_10000437 3300005840 Bacteria 15814
128 Ga0068870_10063999 3300005840 Bacteria 1985
129 Ga0068863_100154030 3300005841 Unclassified 2200
130 Ga0068858_100038883 3300005842 Bacteria 4413
131 Ga0068858_100302091 3300005842 Bacteria 1527
132 Ga0068860_100041169 3300005843 Bacteria 4412
133 Ga0068860_100042751 3300005843 Bacteria 4325
134 Ga0068860_100083609 3300005843 Bacteria 3036
135 Ga0068860_100290888 3300005843 Bacteria 1599
136 Ga0068862_100002850 3300005844 Bacteria 15162
137 Ga0068862_100015430 3300005844 Bacteria 6346
138 Ga0068862_100049007 3300005844 Bacteria 3607
139 Ga0068862_100183429 3300005844 Bacteria 1879
140 Ga0081455_10003725 3300005937 Bacteria 17426
141 Ga0081538_10038045 3300005981 Bacteria 3110
142 Ga0081540_1079214 3300005983 Bacteria 1486
143 Ga0081539_10000002 3300005985 Bacteria 601032
144 Ga0081539_10000166 3300005985 Bacteria 153758
145 Ga0070715_10063045 3300006163 Bacteria 1633
146 Ga0070712_100053243 3300006175 Bacteria 2826
147 Ga0075428_100009872 3300006844 Bacteria 10609
148 Ga0075428_100024658 3300006844 Bacteria 6657
149 Ga0075428_100060903 3300006844 Unclassified 4133
150 Ga0075428_100416438 3300006844 Bacteria 1440
151 Ga0075430_100000065 3300006846 Bacteria 56889
152 Ga0075430_100008844 3300006846 Bacteria 8497
153 Ga0075430_100009487 3300006846 Bacteria 8225
154 Ga0075430_100161297 3300006846 Unclassified 1866
155 Ga0075431_100000368 3300006847 Bacteria 35829
156 Ga0075431_100000699 3300006847 Bacteria 28936
157 Ga0075431_100000779 3300006847 Bacteria 27722
158 Ga0075431_100000849 3300006847 Bacteria 26798
159 Ga0075431_100010200 3300006847 Bacteria 9445
160 Ga0075431_100019718 3300006847 Bacteria 6882
161 Ga0075431_100098611 3300006847 Bacteria 3017
162 Ga0075431_100101824 3300006847 Bacteria 2964
163 Ga0075431_100164429 3300006847 Bacteria 2281
164 Ga0075431_100218854 3300006847 Bacteria 1943
165 Ga0075431_100229039 3300006847 Unclassified 1894
166 Ga0075431_100347576 3300006847 Bacteria 1492
167 Ga0075433_10001084 3300006852 Bacteria 19620
168 Ga0075433_10002091 3300006852 Bacteria 15112
169 Ga0075433_10025504 3300006852 Bacteria 4998
170 Ga0075433_10039454 3300006852 Bacteria 4083
171 Ga0075433_10051298 3300006852 Bacteria 3592
172 Ga0075433_10084662 3300006852 Bacteria 2799
173 Ga0075433_10090168 3300006852 Bacteria 2710
174 Ga0075433_10170124 3300006852 Unclassified 1939
175 Ga0075433_10228164 3300006852 Unclassified 1654
176 Ga0075433_10400082 3300006852 Bacteria 1212
177 Ga0075433_10463657 3300006852 Bacteria 1116
178 Ga0075434_100000547 3300006871 Bacteria 28696
179 Ga0075434_100001341 3300006871 Bacteria 20645
180 Ga0075434_100005550 3300006871 Bacteria 11495
181 Ga0075434_100011474 3300006871 Bacteria 8362
182 Ga0075434_100037759 3300006871 Bacteria 4782
183 Ga0075434_100039134 3300006871 Bacteria 4698
184 Ga0075434_100049631 3300006871 Bacteria 4168
185 Ga0075434_100095865 3300006871 Bacteria 2972
186 Ga0075434_100301611 3300006871 Bacteria 1622
187 Ga0075429_100002129 3300006880 Bacteria 16525
188 Ga0075429_100004971 3300006880 Bacteria 11454
189 Ga0075429_100017882 3300006880 Bacteria 6129
190 Ga0075429_100036837 3300006880 Bacteria 4256
191 Ga0075429_100043471 3300006880 Bacteria 3910
192 Ga0075436_100000259 3300006914 Bacteria 33119
193 Ga0075436_100024493 3300006914 Bacteria 4149
194 Ga0075436_100045274 3300006914 Bacteria 3034
195 Ga0075436_100112330 3300006914 Bacteria 1902
196 Ga0097620_100034111 3300006931 Bacteria 5109
197 Ga0097620_100128510 3300006931 Bacteria 2605
198 Ga0075435_100012260 3300007076 Bacteria 6341
199 Ga0075435_100016888 3300007076 Bacteria 5510
200 Ga0075435_100018527 3300007076 Bacteria 5298
201 Ga0075435_100019309 3300007076 Bacteria 5203
202 Ga0075435_100020824 3300007076 Bacteria 5033
203 Ga0075435_100045866 3300007076 Bacteria 3505
204 Ga0099794_10002556 3300007265 Bacteria 6741
205 Ga0099794_10014631 3300007265 Bacteria 3442
206 Ga0111539_10000055 3300009094 Bacteria 115027
207 Ga0111539_10002932 3300009094 Bacteria 22619
208 Ga0111539_10010465 3300009094 Bacteria 11672
209 Ga0111539_10364015 3300009094 Unclassified 1683
210 Ga0105245_10451112 3300009098 Unclassified 1295
211 Ga0114129_10000868 3300009147 Bacteria 39323
212 Ga0114129_10001900 3300009147 Bacteria 28468
213 Ga0114129_10002275 3300009147 Bacteria 26570
214 Ga0114129_10007974 3300009147 Bacteria 15077
215 Ga0114129_10011416 3300009147 Bacteria 12653
216 Ga0114129_10028983 3300009147 Bacteria 7842
217 Ga0114129_10080279 3300009147 Bacteria 4534
218 Ga0114129_10082816 3300009147 Bacteria 4457
219 Ga0114129_10088964 3300009147 Bacteria 4281
220 Ga0114129_10139646 3300009147 Unclassified 3322
221 Ga0114129_10151251 3300009147 Bacteria 3176
222 Ga0114129_10167397 3300009147 Bacteria 2998
223 Ga0114129_10173505 3300009147 Bacteria 2938
224 Ga0114129_10184660 3300009147 Bacteria 2835
225 Ga0114129_10250237 3300009147 Bacteria 2379
226 Ga0114129_10257227 3300009147 Bacteria 2342
227 Ga0114129_10384679 3300009147 Bacteria 1852
228 Ga0114129_10693406 3300009147 Bacteria 1310
229 Ga0105243_10014492 3300009148 Bacteria 5964
230 Ga0105243_10021874 3300009148 Bacteria 4856
231 Ga0105243_10042407 3300009148 Bacteria 3562
232 Ga0105241_10009467 3300009174 Bacteria 7156
233 Ga0105242_10003482 3300009176 Bacteria 12237
234 Ga0105248_10117545 3300009177 Bacteria 2999
235 Ga0105248_10143732 3300009177 Bacteria 2692
236 Ga0105249_10013108 3300009553 Bacteria 7316
237 Ga0105249_10023700 3300009553 Bacteria 5510
238 Ga0105249_10035793 3300009553 Bacteria 4501
239 Ga0105249_10090404 3300009553 Bacteria 2862
240 Ga0105249_10400631 3300009553 Unclassified 1402
241 Ga0105239_10470966 3300010375 Bacteria 1426
242 Ga0157373_10013951 3300013100 Bacteria 5893
243 Ga0163162_10014997 3300013306 Bacteria 7570
244 Ga0163162_10169986 3300013306 Bacteria 2304
245 Ga0163162_10317519 3300013306 Bacteria 1690
246 Ga0163162_10353447 3300013306 Unclassified 1602
247 Ga0157372_10006881 3300013307 Bacteria 12099
248 Ga0157372_10037276 3300013307 Bacteria 5361
249 Ga0157375_10298850 3300013308 Bacteria 1773
250 Ga0163163_10082969 3300014325 Bacteria 3210
251 Ga0157380_10335564 3300014326 Unclassified 1408
252 Ga0182007_10026525 3300015262 Bacteria 2007
253 Ga0206356_10809313 3300020070 Bacteria 2179
254 Ga0207653_10008474 3300025885 Bacteria 3204
255 Ga0207688_10008520 3300025901 Bacteria 5583
256 Ga0207699_10140249 3300025906 Bacteria 1588
257 Ga0207645_10002226 3300025907 Bacteria 15461
258 Ga0207645_10169277 3300025907 Unclassified 1431
259 Ga0207643_10001163 3300025908 Bacteria 15640
260 Ga0207643_10047210 3300025908 Bacteria 2435
261 Ga0207643_10225039 3300025908 Bacteria 1149
262 Ga0207684_10001116 3300025910 Bacteria 29985
263 Ga0207684_10002980 3300025910 Bacteria 16776
264 Ga0207684_10014976 3300025910 Bacteria 6676
265 Ga0207684_10021253 3300025910 Bacteria 5542
266 Ga0207684_10040381 3300025910 Bacteria 3955
267 Ga0207684_10043226 3300025910 Bacteria 3819
268 Ga0207684_10083220 3300025910 Bacteria 2725
269 Ga0207684_10162730 3300025910 Bacteria 1922
270 Ga0207684_10212355 3300025910 Unclassified 1669
271 Ga0207684_10354813 3300025910 Bacteria 1262
272 Ga0207654_10028205 3300025911 Bacteria 3059
273 Ga0207707_10000556 3300025912 Bacteria 37797
274 Ga0207695_10281834 3300025913 Bacteria 1555
275 Ga0207693_10008098 3300025915 Bacteria 8621
276 Ga0207660_10002844 3300025917 Bacteria 11320
277 Ga0207657_10003869 3300025919 Bacteria 15892
278 Ga0207649_10005083 3300025920 Bacteria 7111
279 Ga0207652_10016524 3300025921 Bacteria 6027
280 Ga0207646_10002268 3300025922 Bacteria 22874
281 Ga0207646_10006525 3300025922 Bacteria 12044
282 Ga0207646_10006933 3300025922 Bacteria 11629
283 Ga0207646_10008264 3300025922 Bacteria 10449
284 Ga0207646_10020665 3300025922 Bacteria 6098
285 Ga0207646_10034070 3300025922 Bacteria 4602
286 Ga0207646_10048108 3300025922 Bacteria 3823
287 Ga0207646_10050940 3300025922 Bacteria 3705
288 Ga0207646_10076506 3300025922 Bacteria 2991
289 Ga0207646_10097597 3300025922 Bacteria 2633
290 Ga0207646_10211807 3300025922 Bacteria 1750
291 Ga0207646_10299299 3300025922 Bacteria 1453
292 Ga0207681_10005627 3300025923 Bacteria 7690
293 Ga0207681_10095006 3300025923 Unclassified 2137
294 Ga0207681_10283922 3300025923 Bacteria 1304
295 Ga0207650_10061110 3300025925 Bacteria 2812
296 Ga0207659_10137256 3300025926 Bacteria 1894
297 Ga0207706_10020487 3300025933 Bacteria 5944
298 Ga0207706_10183071 3300025933 Bacteria 1840
299 Ga0207706_10264508 3300025933 Bacteria 1501
300 Ga0207706_10376303 3300025933 Archaea 1233
301 Ga0207686_10018811 3300025934 Bacteria 3917
302 Ga0207709_10066702 3300025935 Bacteria 2268
303 Ga0207670_10077874 3300025936 Bacteria 2311
304 Ga0207670_10084251 3300025936 Unclassified 2232
305 Ga0207665_10008896 3300025939 Bacteria 6595
306 Ga0207665_10074162 3300025939 Unclassified 2329
307 Ga0207711_10033216 3300025941 Bacteria 4364
308 Ga0207711_10529882 3300025941 Unclassified 1098
309 Ga0207689_10001708 3300025942 Bacteria 20783
310 Ga0207689_10039378 3300025942 Bacteria 3913
311 Ga0207661_10221952 3300025944 Bacteria 1671
312 Ga0207679_10003969 3300025945 Bacteria 9193
313 Ga0207667_10005121 3300025949 Bacteria 16007
314 Ga0207651_10174157 3300025960 Bacteria 1700
315 Ga0207712_10104078 3300025961 Bacteria 2116
316 Ga0207640_10069256 3300025981 Bacteria 2368
317 Ga0207703_10060780 3300026035 Bacteria 3091
318 Ga0207703_10070013 3300026035 Bacteria 2895
319 Ga0207639_10006287 3300026041 Bacteria 8066
320 Ga0207678_10021293 3300026067 Bacteria 5684
321 Ga0207708_10129880 3300026075 Bacteria 1969
322 Ga0207702_10012432 3300026078 Bacteria 7085
323 Ga0207641_10048288 3300026088 Bacteria 3592
324 Ga0207648_10005601 3300026089 Bacteria 12629
325 Ga0207648_10028937 3300026089 Bacteria 4912
326 Ga0207648_10094840 3300026089 Bacteria 2609
327 Ga0207648_10220912 3300026089 Bacteria 1684
328 Ga0207674_10005434 3300026116 Bacteria 15131
329 Ga0207674_10252601 3300026116 Bacteria 1710
330 Ga0207675_100018522 3300026118 Bacteria 6494
331 Ga0207675_100018750 3300026118 Bacteria 6458
332 Ga0207675_100027132 3300026118 Bacteria 5333
333 Ga0207675_100181300 3300026118 Archaea 2016
334 Ga0209981_1002286 3300027378 Bacteria 2436
335 Ga0209996_1003329 3300027395 Bacteria 2017
336 Ga0210000_1004359 3300027462 Bacteria 2045
337 Ga0209995_1002118 3300027471 Bacteria 3115
338 Ga0209968_1001700 3300027526 Bacteria 3324
339 Ga0209999_1000956 3300027543 Bacteria 4865
340 Ga0210002_1002546 3300027617 Bacteria 2635
341 Ga0209983_1000928 3300027665 Bacteria 6438
342 Ga0209588_1003461 3300027671 Bacteria 4380
343 Ga0209588_1016800 3300027671 Bacteria 2263
344 Ga0209971_1000059 3300027682 Bacteria 35248
345 Ga0209966_1000256 3300027695 Bacteria 19430
346 Ga0209998_10000070 3300027717 Bacteria 40919
347 Ga0209974_10000099 3300027876 Bacteria 24483
348 Ga0207428_10000009 3300027907 Bacteria 410565
349 Ga0207428_10000871 3300027907 Bacteria 33913
350 Ga0207428_10005063 3300027907 Bacteria 12384
351 Ga0268265_10006336 3300028380 Bacteria 8019
352 Ga0268265_10139731 3300028380 Bacteria 2026
353 Ga0268265_10178276 3300028380 Bacteria 1823
354 Ga0268264_10010806 3300028381 Bacteria 7541
355 Ga0268264_10038754 3300028381 Bacteria 3935
356 Ga0268264_10065773 3300028381 Bacteria 3056
357 Ga0268264_10078888 3300028381 Unclassified 2808
358 Ga0268264_10181968 3300028381 Bacteria 1909
359 Ga0307408_100028425 3300031548 Bacteria 3864
360 Ga0307408_100159249 3300031548 Bacteria 1791
361 Ga0316575_10037030 3300031665 Bacteria 1920
362 Ga0316579_10037732 3300031691 Bacteria 2232
363 Ga0316576_10022041 3300031727 Bacteria 4417
364 Ga0307405_10145965 3300031731 Bacteria 1657
365 Ga0316577_10061512 3300031733 Bacteria 2095
366 Ga0307410_10011940 3300031852 Unclassified 4994
367 Ga0307412_10180901 3300031911 Bacteria 1586
368 Ga0307412_10304167 3300031911 Bacteria 1262
369 Ga0316583_10004976 3300032133 Bacteria 4751
370 Ga0316583_10010276 3300032133 Bacteria 3373
371 Ga0316583_10023686 3300032133 Bacteria 2191
372 Ga0316585_10003222 3300032137 Bacteria 4464
373 Ga0316585_10005328 3300032137 Bacteria 3627
374 Ga0316593_10055796 3300032168 Unclassified 1343
375 Ga0316592_1022486 3300033524 Unclassified 1348
376 Ga0316592_1022632 3300033524 Unclassified 1345
377 Ga0316596_1032171 3300033541 Unclassified 1364
378 Ga0373940_0011335 3300035088 Bacteria 2115
379 Ga0373940_0024243 3300035088 Bacteria 1572
380 Ga0373932_0007626 3300035112 Bacteria 2580
381 Ga0373939_0018735 3300035114 Bacteria 1860
382 Ga0373960_0025659 3300035121 Bacteria 1604
383 Ga0316574_0031481 3300035398 Bacteria 3217
384 Ga0373931_0016119 3300035691 Bacteria 3674
385 Ga0373931_0032223 3300035691 Unclassified 2711
386 Ga0316582_0255249 3300036647 Bacteria 1202
387 Ga0316584_0005958 3300036712 Bacteria 8230
388 Ga0316584_0009209 3300036712 Bacteria 6839
389 Ga0316584_0023723 3300036712 Bacteria 4482
390 Ga0395899_0177512 3300037312 Unclassified 1497
391 Ga0395900_0046393 3300037418 Bacteria 4474
392 Ga0395900_0182351 3300037418 Unclassified 2133
393 Ga0395900_0372780 3300037418 Bacteria 1397
394 Ga0395900_0387817 3300037418 Bacteria 1364
395 Ga0395905_0045462 3300037471 Unclassified 4118
396 Ga0316581_0041246 3300037588 Bacteria 1407
397 Ga0395901_0114377 3300038443 Bacteria 2834
398 Ga0400488_43236 3300038741 Bacteria 7228
399 Ga0400487_08318 3300039110 Bacteria 4859
400 Ga0439459_0011888 3300042438 Bacteria 1541
401 Ga0439460_0000755 3300042461 Bacteria 7271
402 Ga0451577_0001227 3300042876 Bacteria 35648
403 Ga0451577_0030057 3300042876 Bacteria 4909
404 Ga0453683_0011130 3300044673 Bacteria 5946
405 Ga0453683_0042586 3300044673 Bacteria 2850
406 Ga0453683_0196825 3300044673 Bacteria 1280
407 Ga0451576_0014943 3300045051 Bacteria 8622
408 Ga0451576_0016725 3300045051 Bacteria 8089
409 Ga0451576_0060795 3300045051 Bacteria 3940
410 Ga0451576_0094991 3300045051 Bacteria 3101
411 Ga0451576_0168015 3300045051 Unclassified 2289
412 Ga0451576_0211499 3300045051 Unclassified 2025
413 Ga0451576_0220331 3300045051 Bacteria 1981
414 Ga0451576_0233136 3300045051 Bacteria 1922
415 Ga0451576_0296503 3300045051 Bacteria 1690
416 Ga0495580_0004938 3300046472 Bacteria 11146
417 Ga0495580_0031006 3300046472 Bacteria 3867
418 Ga0495580_0055832 3300046472 Bacteria 2781
419 Ga0496102_0061702 3300048905 Bacteria 3432
420 Ga0496102_0169893 3300048905 Bacteria 2053
421 Ga0496106_0029604 3300048909 Bacteria 4082
422 Ga0496112_0114393 3300048915 Bacteria 2669
423 Ga0501299_007178 3300049522 Bacteria 1770
424 Ga0501031_0002968 3300049568 Bacteria 10859
425 Ga0501032_0397879 3300049569 Bacteria 885
426 Ga0501036_0000221 3300049572 Bacteria 38294
427 Ga0501036_0294932 3300049572 Unclassified 1356
428 Ga0501036_0321994 3300049572 Unclassified 1292
429 Ga0501037_0019082 3300049573 Bacteria 5055
430 Ga0501038_0026094 3300049574 Bacteria 5204
431 Ga0501038_0102409 3300049574 Bacteria 2383
432 Ga0501039_0000788 3300049575 Bacteria 22794
433 Ga0501039_0026091 3300049575 Bacteria 4491
434 Ga0501039_0095026 3300049575 Bacteria 2324
435 Ga0501039_0105528 3300049575 Bacteria 2200
436 Ga0501039_0230447 3300049575 Bacteria 1456
437 Ga0501040_0005623 3300049576 Bacteria 8101
438 Ga0501040_0171994 3300049576 Bacteria 1534
439 Ga0501040_0174658 3300049576 Unclassified 1522
440 Ga0501041_0003061 3300049577 Bacteria 9599
441 Ga0501041_0012076 3300049577 Bacteria 5113
442 Ga0501041_0027976 3300049577 Bacteria 3400
443 Ga0501041_0079959 3300049577 Bacteria 2012
444 Ga0501042_0000501 3300049578 Bacteria 20351
445 Ga0501042_0008561 3300049578 Bacteria 6765
446 Ga0501042_0034062 3300049578 Bacteria 3612
447 Ga0501043_0025021 3300049579 Bacteria 4684
448 Ga0501046_0000494 3300049580 Bacteria 39283
449 Ga0501046_0015336 3300049580 Bacteria 6442
450 Ga0501048_0013914 3300049582 Bacteria 5966
451 Ga0501048_0023148 3300049582 Bacteria 4542
452 Ga0501067_0017245 3300049583 Bacteria 3991
453 Ga0501068_0003149 3300049584 Bacteria 8835
454 Ga0501068_0047969 3300049584 Bacteria 2578
455 Ga0501068_0194480 3300049584 Unclassified 1286
456 Ga0501070_0202304 3300049586 Unclassified 1631
457 Ga0501071_0000692 3300049587 Bacteria 17636
458 Ga0501071_0031434 3300049587 Bacteria 3763
459 Ga0501071_0038217 3300049587 Bacteria 3430
460 Ga0501071_0171508 3300049587 Bacteria 1624
461 Ga0501072_0008873 3300049588 Bacteria 7639
462 Ga0501072_0009148 3300049588 Bacteria 7524
463 Ga0501072_0040891 3300049588 Bacteria 3641
464 Ga0501072_0044510 3300049588 Bacteria 3490
465 Ga0501074_0020933 3300049590 Bacteria 4749
466 Ga0501075_0009540 3300049591 Bacteria 6794
467 Ga0501075_0029267 3300049591 Bacteria 4071
468 Ga0501075_0045449 3300049591 Bacteria 3296
469 Ga0501075_0208585 3300049591 Bacteria 1490
470 Ga0501076_0000002 3300049592 Bacteria 165396
471 Ga0501076_0001052 3300049592 Bacteria 18111
472 Ga0501076_0022489 3300049592 Bacteria 4845
473 Ga0501076_0026693 3300049592 Bacteria 4476
474 Ga0501076_0041509 3300049592 Bacteria 3620
475 Ga0501076_0285901 3300049592 Bacteria 1351
476 Ga0501077_0002612 3300049593 Bacteria 10787
477 Ga0501077_0018523 3300049593 Bacteria 4404
478 Ga0501077_0163506 3300049593 Bacteria 1413
479 Ga0501079_0001113 3300049741 Bacteria 18689
480 Ga0501079_0001727 3300049741 Bacteria 15586
481 Ga0501079_0023060 3300049741 Bacteria 4778
482 Ga0501080_0026746 3300049742 Bacteria 5362
483 Ga0501080_0104088 3300049742 Bacteria 2632
484 Ga0501080_0409840 3300049742 Bacteria 1219
485 Ga0501081_0000600 3300049743 Bacteria 20561
486 Ga0501081_0005345 3300049743 Bacteria 8287
487 Ga0501081_0021574 3300049743 Bacteria 4299
488 Ga0501081_0030834 3300049743 Bacteria 3632
489 Ga0501081_0031757 3300049743 Bacteria 3579
490 Ga0501035_0017069 3300049822 Bacteria 6688
491 Ga0501035_0097743 3300049822 Bacteria 2578
492 Ga0501035_0166329 3300049822 Bacteria 1907
493 Ga0501045_0001815 3300049824 Bacteria 14433
494 Ga0501045_0058795 3300049824 Bacteria 2815
495 Ga0501045_0143920 3300049824 Bacteria 1773
496 Ga0501045_0158992 3300049824 Bacteria 1682
497 nmdc:mga05p37_103174_c1 3300050507 Bacteria 3511
498 nmdc:mga05p37_171284_c1 3300050507 Bacteria 2647
499 nmdc:mga05p37_17682_c1 3300050507 Bacteria 8601
500 nmdc:mga05p37_179985_c1 3300050507 Bacteria 2573
501 nmdc:mga05p37_18674_c1 3300050507 Bacteria 8379
502 nmdc:mga05p37_21499_c1 3300050507 Bacteria 7815
503 nmdc:mga05p37_2152_c1 3300050507 Bacteria 22581
504 nmdc:mga05p37_315466_c1 3300050507 Bacteria 1852
505 nmdc:mga05p37_381604_c1 3300050507 Bacteria 1651
506 nmdc:mga05p37_54611_c1 3300050507 Bacteria 4914
507 nmdc:mga05p37_8252_c1 3300050507 Bacteria 12315
508 nmdc:mga05p37_8847_c1 3300050507 Bacteria 11897
509 nmdc:mga05p37_94380_c1 3300050507 Bacteria 3686
510 nmdc:mga05p37_9954_c1 3300050507 Bacteria 11291
511 nmdc:mga09592_111445_c1 3300050508 Bacteria 2348
512 nmdc:mga09592_111848_c1 3300050508 Bacteria 2343
513 nmdc:mga09592_131495_c1 3300050508 Bacteria 2153
514 nmdc:mga09592_36915_c1 3300050508 Bacteria 4095
515 nmdc:mga09592_5414_c1 3300050508 Bacteria 10372
516 nmdc:mga09592_8769_c1 3300050508 Bacteria 8228
517 nmdc:mga0qj67_18797_c1 3300050509 Bacteria 5270
518 nmdc:mga0qj67_221318_c1 3300050509 Unclassified 1537
519 nmdc:mga0qj67_22819_c1 3300050509 Unclassified 4808
520 nmdc:mga0qj67_59122_c1 3300050509 Bacteria 3039
521 nmdc:mga0qj67_76310_c1 3300050509 Bacteria 2680
522 nmdc:mga06r32_10748_c1 3300050510 Bacteria 8244
523 nmdc:mga06r32_278956_c1 3300050510 Bacteria 1658
524 nmdc:mga06r32_4657_c1 3300050510 Bacteria 12309
525 nmdc:mga06r32_58340_c1 3300050510 Bacteria 3710
526 nmdc:mga06r32_5892_c1 3300050510 Bacteria 11031
527 nmdc:mga06r32_64574_c1 3300050510 Bacteria 3530
528 nmdc:mga06r32_6782_c1 3300050510 Bacteria 10291
529 nmdc:mga06r32_76081_c1 3300050510 Bacteria 3259
530 nmdc:mga06r32_92283_c1 3300050510 Bacteria 2960
531 nmdc:mga08y16_12345_c1 3300050511 Bacteria 8984
532 nmdc:mga08y16_1317_c1 3300050511 Bacteria 24673
533 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
534 nmdc:mga0n895_113464_c1 3300050512 Bacteria 2728
535 nmdc:mga0n895_17404_c1 3300050512 Bacteria 6622
536 nmdc:mga0n895_178020_c1 3300050512 Bacteria 2158
537 nmdc:mga0n895_202970_c1 3300050512 Unclassified 2013
538 nmdc:mga0n895_25133_c1 3300050512 Bacteria 5624
539 nmdc:mga0n895_25299_c1 3300050512 Unclassified 5607
540 nmdc:mga0n895_265904_c1 3300050512 Bacteria 1740
541 nmdc:mga0n895_282383_c1 3300050512 Bacteria 1683
542 nmdc:mga0n895_28430_c1 3300050512 Bacteria 5318
543 nmdc:mga0n895_49997_c1 3300050512 Bacteria 4098
544 nmdc:mga0n895_533_c1 3300050512 Bacteria 25951
545 nmdc:mga0n895_54176_c1 3300050512 Bacteria 3944
546 nmdc:mga0n895_5522_c1 3300050512 Bacteria 10586
547 nmdc:mga0n895_72200_c1 3300050512 Bacteria 3424
548 nmdc:mga0rr50_151160_c1 3300050513 Bacteria 1876
549 nmdc:mga0rr50_20874_c1 3300050513 Bacteria 4459
550 nmdc:mga0rr50_30113_c1 3300050513 Bacteria 3839
551 nmdc:mga0rr50_4261_c1 3300050513 Bacteria 8376
552 nmdc:mga0rr50_6053_c1 3300050513 Bacteria 7310
553 nmdc:mga0rr50_666_c1 3300050513 Bacteria 18401
554 nmdc:mga08x19_11181_c1 3300050514 Bacteria 5403
555 nmdc:mga08x19_185923_c1 3300050514 Bacteria 1420
556 nmdc:mga08x19_301_c1 3300050514 Bacteria 36353
557 nmdc:mga08x19_34176_c1 3300050514 Bacteria 3213
558 nmdc:mga0a205_100705_c1 3300050515 Bacteria 2788
559 nmdc:mga0a205_195634_c1 3300050515 Unclassified 1913
560 nmdc:mga0a205_196136_c1 3300050515 Bacteria 1910
561 nmdc:mga0a205_317038_c1 3300050515 Bacteria 1430
562 nmdc:mga0a205_3549_c1 3300050515 Bacteria 13958
563 nmdc:mga0a205_3744_c1 3300050515 Bacteria 13617
564 nmdc:mga0a205_381052_c1 3300050515 Unclassified 1276
565 nmdc:mga0a205_50014_c1 3300050515 Bacteria 4036
566 nmdc:mga0a205_5597_c1 3300050515 Bacteria 11322
567 nmdc:mga0a205_7301_c1 3300050515 Bacteria 6084
568 nmdc:mga0a205_76493_c1 3300050515 Bacteria 3235
569 nmdc:mga0a205_9201_c1 3300050515 Bacteria 9018
570 Ga0501084_0000799 3300054114 Bacteria 24093
571 Ga0501084_0001912 3300054114 Bacteria 16622
572 Ga0501084_0008168 3300054114 Bacteria 8632
573 Ga0501084_0075905 3300054114 Bacteria 2816
574 Ga0501084_0167239 3300054114 Bacteria 1856
575 Ga0501082_0001643 3300060353 Bacteria 19706
576 Ga0501082_0011620 3300060353 Bacteria 7569
577 Ga0501082_0011720 3300060353 Bacteria 7537
578 Ga0530510_0000024 3300061734 Bacteria 68684
579 Ga0530510_0012338 3300061734 Bacteria 6001
580 Ga0530510_0021408 3300061734 Bacteria 4600
581 Ga0530510_0024049 3300061734 Bacteria 4345
582 Ga0530510_0227660 3300061734 Bacteria 1386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0397879 Ga0501032_0397879_43_873 276
2 3300036712 Ga0316584_0023723 Ga0316584_0023723_1945_2856 301
3 3300049742 Ga0501080_0026746 Ga0501080_0026746_35_946 302
4 3300050508 nmdc:mga09592_36915_c1 nmdc:mga09592_36915_c1_3157_4074 303
5 3300035691 Ga0373931_0032223 Ga0373931_0032223_1327_2244 304
6 3300048905 Ga0496102_0061702 Ga0496102_0061702_2149_3066 304
7 3300050508 nmdc:mga09592_111445_c1 nmdc:mga09592_111445_c1_1420_2334 304
8 3300005445 Ga0070708_100023994 Ga0070708_1000239943 308
9 3300005467 Ga0070706_100018011 Ga0070706_1000180113 308
10 3300005468 Ga0070707_100005140 Ga0070707_1000051403 308
11 3300005471 Ga0070698_100112494 Ga0070698_1001124942 308
12 3300005518 Ga0070699_100010796 Ga0070699_1000107966 308
13 3300006847 Ga0075431_100347576 Ga0075431_1003475762 308
14 3300006852 Ga0075433_10002091 Ga0075433_1000209112 308
15 3300006871 Ga0075434_100011474 Ga0075434_10001147410 308
16 3300006914 Ga0075436_100000259 Ga0075436_10000025915 308
17 3300007076 Ga0075435_100018527 Ga0075435_1000185274 308
18 3300009147 Ga0114129_10173505 Ga0114129_101735052 308
19 3300025910 Ga0207684_10212355 Ga0207684_102123551 308
20 3300025922 Ga0207646_10008264 Ga0207646_100082645 308
21 3300050507 nmdc:mga05p37_171284_c1 nmdc:mga05p37_171284_c1_468_1478 308
22 3300050510 nmdc:mga06r32_278956_c1 nmdc:mga06r32_278956_c1_333_1343 308
23 3300006847 Ga0075431_100229039 Ga0075431_1002290392 309
24 3300009094 Ga0111539_10364015 Ga0111539_103640151 312
25 3300009147 Ga0114129_10250237 Ga0114129_102502372 312
26 3300037418 Ga0395900_0387817 Ga0395900_0387817_312_1253 312
27 3300005467 Ga0070706_100039638 Ga0070706_1000396383 313
28 3300005468 Ga0070707_100152229 Ga0070707_1001522293 313
29 3300005471 Ga0070698_100271497 Ga0070698_1002714972 313
30 3300005518 Ga0070699_100087391 Ga0070699_1000873912 313
31 3300025910 Ga0207684_10083220 Ga0207684_100832202 313
32 3300026089 Ga0207648_10094840 Ga0207648_100948404 313
33 3300031665 Ga0316575_10037030 Ga0316575_100370301 313
34 3300031691 Ga0316579_10037732 Ga0316579_100377322 313
35 3300031733 Ga0316577_10061512 Ga0316577_100615122 313
36 3300032133 Ga0316583_10010276 Ga0316583_100102762 313
37 3300032137 Ga0316585_10003222 Ga0316585_100032224 313
38 3300032168 Ga0316593_10055796 Ga0316593_100557962 313
39 3300033524 Ga0316592_1022486 Ga0316592_10224862 313
40 3300033541 Ga0316596_1032171 Ga0316596_10321711 313
41 3300005844 Ga0068862_100183429 Ga0068862_1001834291 314
42 3300005985 Ga0081539_10000166 Ga0081539_100001668 314
43 3300009553 Ga0105249_10090404 Ga0105249_100904042 314
44 3300013306 Ga0163162_10353447 Ga0163162_103534471 314
45 3300025936 Ga0207670_10084251 Ga0207670_100842512 314
46 3300028381 Ga0268264_10078888 Ga0268264_100788881 314
47 3300006847 Ga0075431_100218854 Ga0075431_1002188542 315
48 3300006852 Ga0075433_10090168 Ga0075433_100901682 315
49 3300049575 Ga0501039_0095026 Ga0501039_0095026_536_1498 315
50 3300049577 Ga0501041_0027976 Ga0501041_0027976_905_1867 315
51 3300049587 Ga0501071_0031434 Ga0501071_0031434_1178_2140 315
52 3300049588 Ga0501072_0009148 Ga0501072_0009148_1689_2651 315
53 3300049591 Ga0501075_0029267 Ga0501075_0029267_1316_2278 315
54 3300049592 Ga0501076_0000002 Ga0501076_0000002_120433_121395 315
55 3300049593 Ga0501077_0018523 Ga0501077_0018523_1455_2417 315
56 3300049742 Ga0501080_0104088 Ga0501080_0104088_374_1336 315
57 3300049743 Ga0501081_0021574 Ga0501081_0021574_1622_2584 315
58 3300050507 nmdc:mga05p37_8847_c1 nmdc:mga05p37_8847_c1_6767_7828 315
59 3300050510 nmdc:mga06r32_76081_c1 nmdc:mga06r32_76081_c1_1552_2613 315
60 3300050515 nmdc:mga0a205_100705_c1 nmdc:mga0a205_100705_c1_192_1253 315
61 3300054114 Ga0501084_0001912 Ga0501084_0001912_14135_15097 315
62 3300061734 Ga0530510_0000024 Ga0530510_0000024_55195_56157 315
63 3300005295 Ga0065707_10239791 Ga0065707_102397911 316
64 3300007265 Ga0099794_10014631 Ga0099794_100146312 316
65 3300009147 Ga0114129_10384679 Ga0114129_103846791 316
66 3300027671 Ga0209588_1016800 Ga0209588_10168002 316
67 3300028381 Ga0268264_10181968 Ga0268264_101819681 316
68 3300050507 nmdc:mga05p37_315466_c1 nmdc:mga05p37_315466_c1_335_1339 316
69 3300005353 Ga0070669_100074741 Ga0070669_1000747411 317
70 3300005444 Ga0070694_100055873 Ga0070694_1000558731 317
71 3300005459 Ga0068867_100062250 Ga0068867_1000622502 317
72 3300005545 Ga0070695_100120367 Ga0070695_1001203672 317
73 3300005546 Ga0070696_100103742 Ga0070696_1001037422 317
74 3300005844 Ga0068862_100015430 Ga0068862_1000154305 317
75 3300006871 Ga0075434_100001341 Ga0075434_1000013419 317
76 3300025923 Ga0207681_10283922 Ga0207681_102839221 317
77 3300028380 Ga0268265_10139731 Ga0268265_101397311 317
78 3300037418 Ga0395900_0372780 Ga0395900_0372780_109_1167 317
79 3300049572 Ga0501036_0321994 Ga0501036_0321994_35_988 317
80 3300049575 Ga0501039_0026091 Ga0501039_0026091_2670_3647 317
81 3300049576 Ga0501040_0171994 Ga0501040_0171994_295_1272 317
82 3300005445 Ga0070708_100033032 Ga0070708_1000330323 318
83 3300005445 Ga0070708_100203325 Ga0070708_1002033252 318
84 3300005468 Ga0070707_100395573 Ga0070707_1003955731 318
85 3300005518 Ga0070699_100084014 Ga0070699_1000840142 318
86 3300025910 Ga0207684_10162730 Ga0207684_101627302 318
87 3300025922 Ga0207646_10211807 Ga0207646_102118072 318
88 3300050512 nmdc:mga0n895_282383_c1 nmdc:mga0n895_282383_c1_493_1479 318
89 3300050513 nmdc:mga0rr50_20874_c1 nmdc:mga0rr50_20874_c1_2961_3947 318
90 3300006852 Ga0075433_10170124 Ga0075433_101701242 319
91 3300049576 Ga0501040_0174658 Ga0501040_0174658_497_1456 319
92 3300049584 Ga0501068_0194480 Ga0501068_0194480_314_1273 319
93 3300049741 Ga0501079_0023060 Ga0501079_0023060_1435_2394 319
94 3300049743 Ga0501081_0005345 Ga0501081_0005345_3287_4246 319
95 3300049824 Ga0501045_0143920 Ga0501045_0143920_45_1004 319
96 3300054114 Ga0501084_0008168 Ga0501084_0008168_5163_6122 319
97 3300060353 Ga0501082_0011620 Ga0501082_0011620_1992_2951 319
98 3300049587 Ga0501071_0171508 Ga0501071_0171508_595_1557 320
99 3300049743 Ga0501081_0030834 Ga0501081_0030834_576_1538 320
100 3300009148 Ga0105243_10042407 Ga0105243_100424073 322
101 3300013306 Ga0163162_10317519 Ga0163162_103175191 322
102 3300025939 Ga0207665_10074162 Ga0207665_100741622 322
103 3300026089 Ga0207648_10220912 Ga0207648_102209121 322
104 3300039110 Ga0400487_08318 Ga0400487_08318_170_1162 322
105 3300049568 Ga0501031_0002968 Ga0501031_0002968_4220_5206 322
106 3300049572 Ga0501036_0000221 Ga0501036_0000221_23115_24101 322
107 3300049573 Ga0501037_0019082 Ga0501037_0019082_3480_4466 322
108 3300049574 Ga0501038_0026094 Ga0501038_0026094_3043_4029 322
109 3300049575 Ga0501039_0000788 Ga0501039_0000788_3019_4005 322
110 3300049576 Ga0501040_0005623 Ga0501040_0005623_3650_4636 322
111 3300049577 Ga0501041_0003061 Ga0501041_0003061_4628_5614 322
112 3300049578 Ga0501042_0000501 Ga0501042_0000501_1184_2170 322
113 3300049579 Ga0501043_0025021 Ga0501043_0025021_1502_2488 322
114 3300049580 Ga0501046_0000494 Ga0501046_0000494_15987_16973 322
115 3300049582 Ga0501048_0023148 Ga0501048_0023148_724_1710 322
116 3300049584 Ga0501068_0003149 Ga0501068_0003149_4803_5789 322
117 3300049587 Ga0501071_0000692 Ga0501071_0000692_3480_4466 322
118 3300049588 Ga0501072_0008873 Ga0501072_0008873_2561_3547 322
119 3300049590 Ga0501074_0020933 Ga0501074_0020933_724_1710 322
120 3300049591 Ga0501075_0009540 Ga0501075_0009540_4511_5497 322
121 3300049592 Ga0501076_0001052 Ga0501076_0001052_4089_5075 322
122 3300049593 Ga0501077_0002612 Ga0501077_0002612_8592_9578 322
123 3300049741 Ga0501079_0001727 Ga0501079_0001727_14173_15159 322
124 3300049743 Ga0501081_0000600 Ga0501081_0000600_3630_4616 322
125 3300049822 Ga0501035_0017069 Ga0501035_0017069_1305_2291 322
126 3300049824 Ga0501045_0001815 Ga0501045_0001815_3385_4371 322
127 3300050512 nmdc:mga0n895_5522_c1 nmdc:mga0n895_5522_c1_9349_10323 322
128 3300050515 nmdc:mga0a205_195634_c1 nmdc:mga0a205_195634_c1_441_1415 322
129 3300050515 nmdc:mga0a205_76493_c1 nmdc:mga0a205_76493_c1_2212_3180 322
130 3300054114 Ga0501084_0000799 Ga0501084_0000799_22018_23004 322
131 3300060353 Ga0501082_0011720 Ga0501082_0011720_2922_3908 322
132 3300061734 Ga0530510_0012338 Ga0530510_0012338_3508_4494 322
133 3300009147 Ga0114129_10011416 Ga0114129_1001141613 323
134 3300036712 Ga0316584_0009209 Ga0316584_0009209_557_1549 323
135 3300046472 Ga0495580_0004938 Ga0495580_0004938_2450_3421 323
136 3300049742 Ga0501080_0409840 Ga0501080_0409840_168_1139 323
137 3300050507 nmdc:mga05p37_9954_c1 nmdc:mga05p37_9954_c1_2294_3337 323
138 3300050512 nmdc:mga0n895_178020_c1 nmdc:mga0n895_178020_c1_177_1148 323
139 3300050512 nmdc:mga0n895_533_c1 nmdc:mga0n895_533_c1_22174_23217 323
140 3300050513 nmdc:mga0rr50_666_c1 nmdc:mga0rr50_666_c1_14624_15667 323
141 3300050514 nmdc:mga08x19_301_c1 nmdc:mga08x19_301_c1_19690_20733 323
142 3300050515 nmdc:mga0a205_3744_c1 nmdc:mga0a205_3744_c1_5029_6072 323
143 3300050515 nmdc:mga0a205_50014_c1 nmdc:mga0a205_50014_c1_1236_2207 323
144 3300005439 Ga0070711_100133205 Ga0070711_1001332051 324
145 3300005440 Ga0070705_100204624 Ga0070705_1002046241 324
146 3300005445 Ga0070708_100047366 Ga0070708_1000473663 324
147 3300005445 Ga0070708_100058714 Ga0070708_1000587143 324
148 3300005467 Ga0070706_100017090 Ga0070706_1000170907 324
149 3300005467 Ga0070706_100088370 Ga0070706_1000883702 324
150 3300005468 Ga0070707_100013221 Ga0070707_1000132212 324
151 3300005468 Ga0070707_100029910 Ga0070707_1000299103 324
152 3300005471 Ga0070698_100005744 Ga0070698_10000574415 324
153 3300005518 Ga0070699_100010954 Ga0070699_1000109549 324
154 3300005536 Ga0070697_100002500 Ga0070697_10000250015 324
155 3300005549 Ga0070704_100166992 Ga0070704_1001669922 324
156 3300006175 Ga0070712_100053243 Ga0070712_1000532432 324
157 3300006847 Ga0075431_100101824 Ga0075431_1001018241 324
158 3300025910 Ga0207684_10002980 Ga0207684_100029804 324
159 3300025915 Ga0207693_10008098 Ga0207693_100080984 324
160 3300025922 Ga0207646_10006525 Ga0207646_100065252 324
161 3300025922 Ga0207646_10020665 Ga0207646_100206653 324
162 3300036647 Ga0316582_0255249 Ga0316582_0255249_203_1186 324
163 3300037471 Ga0395905_0045462 Ga0395905_0045462_2398_3387 324
164 3300049572 Ga0501036_0294932 Ga0501036_0294932_265_1242 324
165 3300049574 Ga0501038_0102409 Ga0501038_0102409_160_1137 324
166 3300049575 Ga0501039_0105528 Ga0501039_0105528_204_1181 324
167 3300049577 Ga0501041_0079959 Ga0501041_0079959_117_1094 324
168 3300049578 Ga0501042_0034062 Ga0501042_0034062_1354_2331 324
169 3300049582 Ga0501048_0013914 Ga0501048_0013914_943_1920 324
170 3300049584 Ga0501068_0047969 Ga0501068_0047969_177_1154 324
171 3300049587 Ga0501071_0038217 Ga0501071_0038217_1097_2074 324
172 3300049588 Ga0501072_0044510 Ga0501072_0044510_1007_1984 324
173 3300049591 Ga0501075_0045449 Ga0501075_0045449_938_1915 324
174 3300049592 Ga0501076_0041509 Ga0501076_0041509_2217_3194 324
175 3300049822 Ga0501035_0097743 Ga0501035_0097743_898_1875 324
176 3300050510 nmdc:mga06r32_92283_c1 nmdc:mga06r32_92283_c1_1520_2521 324
177 3300054114 Ga0501084_0075905 Ga0501084_0075905_1434_2411 324
178 3300054114 Ga0501084_0167239 Ga0501084_0167239_45_1019 324
179 3300061734 Ga0530510_0024049 Ga0530510_0024049_2775_3749 324
180 3300005445 Ga0070708_100350447 Ga0070708_1003504471 325
181 3300005459 Ga0068867_100315757 Ga0068867_1003157571 325
182 3300005468 Ga0070707_100283287 Ga0070707_1002832871 325
183 3300005842 Ga0068858_100302091 Ga0068858_1003020912 325
184 3300005985 Ga0081539_10000002 Ga0081539_10000002350 325
185 3300006844 Ga0075428_100024658 Ga0075428_1000246585 325
186 3300006846 Ga0075430_100161297 Ga0075430_1001612972 325
187 3300006847 Ga0075431_100010200 Ga0075431_1000102003 325
188 3300006852 Ga0075433_10228164 Ga0075433_102281642 325
189 3300006871 Ga0075434_100037759 Ga0075434_1000377594 325
190 3300006871 Ga0075434_100049631 Ga0075434_1000496314 325
191 3300006914 Ga0075436_100024493 Ga0075436_1000244933 325
192 3300007076 Ga0075435_100020824 Ga0075435_1000208245 325
193 3300009098 Ga0105245_10451112 Ga0105245_104511122 325
194 3300009147 Ga0114129_10007974 Ga0114129_100079742 325
195 3300025906 Ga0207699_10140249 Ga0207699_101402491 325
196 3300025910 Ga0207684_10354813 Ga0207684_103548131 325
197 3300025922 Ga0207646_10299299 Ga0207646_102992991 325
198 3300026089 Ga0207648_10028937 Ga0207648_100289374 325
199 3300035114 Ga0373939_0018735 Ga0373939_0018735_256_1233 325
200 3300038741 Ga0400488_43236 Ga0400488_43236_1463_2449 325
201 3300049583 Ga0501067_0017245 Ga0501067_0017245_663_1652 325
202 3300049824 Ga0501045_0158992 Ga0501045_0158992_582_1565 325
203 3300050507 nmdc:mga05p37_2152_c1 nmdc:mga05p37_2152_c1_1195_2253 325
204 3300050510 nmdc:mga06r32_4657_c1 nmdc:mga06r32_4657_c1_10363_11421 325
205 3300050512 nmdc:mga0n895_202970_c1 nmdc:mga0n895_202970_c1_18_1013 325
206 3300050512 nmdc:mga0n895_25133_c1 nmdc:mga0n895_25133_c1_3343_4398 325
207 3300050512 nmdc:mga0n895_54176_c1 nmdc:mga0n895_54176_c1_1760_2749 325
208 3300050513 nmdc:mga0rr50_4261_c1 nmdc:mga0rr50_4261_c1_1287_2342 325
209 3300050515 nmdc:mga0a205_381052_c1 nmdc:mga0a205_381052_c1_32_1027 325
210 3300006847 Ga0075431_100000699 Ga0075431_1000006991 326
211 3300006880 Ga0075429_100002129 Ga0075429_10000212915 326
212 3300031727 Ga0316576_10022041 Ga0316576_100220412 326
213 3300032133 Ga0316583_10004976 Ga0316583_100049762 326
214 3300032133 Ga0316583_10023686 Ga0316583_100236861 326
215 3300032137 Ga0316585_10005328 Ga0316585_100053283 326
216 3300033524 Ga0316592_1022632 Ga0316592_10226322 326
217 3300035398 Ga0316574_0031481 Ga0316574_0031481_1634_2674 326
218 3300036712 Ga0316584_0005958 Ga0316584_0005958_915_1955 326
219 3300037588 Ga0316581_0041246 Ga0316581_0041246_118_1158 326
220 3300049588 Ga0501072_0040891 Ga0501072_0040891_1094_2074 326
221 3300049592 Ga0501076_0022489 Ga0501076_0022489_3576_4556 326
222 3300049592 Ga0501076_0285901 Ga0501076_0285901_143_1132 326
223 3300050507 nmdc:mga05p37_179985_c1 nmdc:mga05p37_179985_c1_499_1641 326
224 3300050510 nmdc:mga06r32_10748_c1 nmdc:mga06r32_10748_c1_6466_7608 326
225 3300005289 Ga0065704_10122491 Ga0065704_101224911 327
226 3300005444 Ga0070694_100181052 Ga0070694_1001810522 327
227 3300005445 Ga0070708_100143972 Ga0070708_1001439722 327
228 3300005467 Ga0070706_100025183 Ga0070706_1000251832 327
229 3300005467 Ga0070706_100060936 Ga0070706_1000609363 327
230 3300005468 Ga0070707_100001008 Ga0070707_10000100817 327
231 3300005471 Ga0070698_100389457 Ga0070698_1003894571 327
232 3300005544 Ga0070686_100149430 Ga0070686_1001494301 327
233 3300005545 Ga0070695_100069993 Ga0070695_1000699931 327
234 3300005549 Ga0070704_100024672 Ga0070704_1000246722 327
235 3300005615 Ga0070702_100354786 Ga0070702_1003547861 327
236 3300005617 Ga0068859_100034111 Ga0068859_1000341112 327
237 3300005617 Ga0068859_100128515 Ga0068859_1001285152 327
238 3300005843 Ga0068860_100042751 Ga0068860_1000427512 327
239 3300005844 Ga0068862_100049007 Ga0068862_1000490073 327
240 3300006846 Ga0075430_100008844 Ga0075430_1000088446 327
241 3300006847 Ga0075431_100000779 Ga0075431_10000077920 327
242 3300006880 Ga0075429_100004971 Ga0075429_1000049715 327
243 3300006931 Ga0097620_100034111 Ga0097620_1000341112 327
244 3300006931 Ga0097620_100128510 Ga0097620_1001285102 327
245 3300007265 Ga0099794_10002556 Ga0099794_100025564 327
246 3300009147 Ga0114129_10000868 Ga0114129_100008684 327
247 3300009147 Ga0114129_10028983 Ga0114129_100289832 327
248 3300009147 Ga0114129_10139646 Ga0114129_101396462 327
249 3300009147 Ga0114129_10693406 Ga0114129_106934061 327
250 3300009553 Ga0105249_10035793 Ga0105249_100357932 327
251 3300025910 Ga0207684_10021253 Ga0207684_100212536 327
252 3300025910 Ga0207684_10043226 Ga0207684_100432264 327
253 3300025922 Ga0207646_10006933 Ga0207646_1000693315 327
254 3300025936 Ga0207670_10077874 Ga0207670_100778741 327
255 3300025941 Ga0207711_10529882 Ga0207711_105298821 327
256 3300026035 Ga0207703_10070013 Ga0207703_100700131 327
257 3300026118 Ga0207675_100181300 Ga0207675_1001813003 327
258 3300027671 Ga0209588_1003461 Ga0209588_10034612 327
259 3300028380 Ga0268265_10178276 Ga0268265_101782762 327
260 3300028381 Ga0268264_10010806 Ga0268264_100108064 327
261 3300031548 Ga0307408_100159249 Ga0307408_1001592492 327
262 3300031911 Ga0307412_10304167 Ga0307412_103041671 327
263 3300035088 Ga0373940_0024243 Ga0373940_0024243_93_1127 327
264 3300045051 Ga0451576_0014943 Ga0451576_0014943_3672_4673 327
265 3300045051 Ga0451576_0168015 Ga0451576_0168015_204_1196 327
266 3300046472 Ga0495580_0031006 Ga0495580_0031006_2644_3651 327
267 3300050507 nmdc:mga05p37_17682_c1 nmdc:mga05p37_17682_c1_1775_2773 327
268 3300050507 nmdc:mga05p37_54611_c1 nmdc:mga05p37_54611_c1_757_1746 327
269 3300050507 nmdc:mga05p37_8252_c1 nmdc:mga05p37_8252_c1_3355_4353 327
270 3300050508 nmdc:mga09592_8769_c1 nmdc:mga09592_8769_c1_3575_4573 327
271 3300050509 nmdc:mga0qj67_22819_c1 nmdc:mga0qj67_22819_c1_2155_3153 327
272 3300050510 nmdc:mga06r32_5892_c1 nmdc:mga06r32_5892_c1_8365_9363 327
273 3300050512 nmdc:mga0n895_265904_c1 nmdc:mga0n895_265904_c1_424_1422 327
274 3300050515 nmdc:mga0a205_317038_c1 nmdc:mga0a205_317038_c1_402_1391 327
275 3300005445 Ga0070708_100182980 Ga0070708_1001829802 328
276 3300005468 Ga0070707_100011324 Ga0070707_10001132411 328
277 3300005468 Ga0070707_100104076 Ga0070707_1001040761 328
278 3300005549 Ga0070704_100026801 Ga0070704_1000268013 328
279 3300005843 Ga0068860_100290888 Ga0068860_1002908882 328
280 3300005981 Ga0081538_10038045 Ga0081538_100380452 328
281 3300006844 Ga0075428_100060903 Ga0075428_1000609032 328
282 3300006847 Ga0075431_100019718 Ga0075431_1000197186 328
283 3300006847 Ga0075431_100098611 Ga0075431_1000986113 328
284 3300006852 Ga0075433_10025504 Ga0075433_100255043 328
285 3300006852 Ga0075433_10051298 Ga0075433_100512982 328
286 3300006871 Ga0075434_100095865 Ga0075434_1000958654 328
287 3300006880 Ga0075429_100043471 Ga0075429_1000434712 328
288 3300009094 Ga0111539_10000055 Ga0111539_10000055110 328
289 3300009147 Ga0114129_10002275 Ga0114129_1000227524 328
290 3300009147 Ga0114129_10082816 Ga0114129_100828165 328
291 3300009147 Ga0114129_10151251 Ga0114129_101512512 328
292 3300009177 Ga0105248_10143732 Ga0105248_101437322 328
293 3300013306 Ga0163162_10169986 Ga0163162_101699862 328
294 3300014326 Ga0157380_10335564 Ga0157380_103355641 328
295 3300025908 Ga0207643_10225039 Ga0207643_102250391 328
296 3300025922 Ga0207646_10034070 Ga0207646_100340702 328
297 3300025922 Ga0207646_10097597 Ga0207646_100975971 328
298 3300025933 Ga0207706_10183071 Ga0207706_101830712 328
299 3300025933 Ga0207706_10376303 Ga0207706_103763031 328
300 3300025941 Ga0207711_10033216 Ga0207711_100332162 328
301 3300026118 Ga0207675_100027132 Ga0207675_1000271324 328
302 3300027907 Ga0207428_10000871 Ga0207428_100008712 328
303 3300042876 Ga0451577_0001227 Ga0451577_0001227_1462_2454 328
304 3300044673 Ga0453683_0011130 Ga0453683_0011130_3940_4932 328
305 3300045051 Ga0451576_0016725 Ga0451576_0016725_6824_7816 328
306 3300045051 Ga0451576_0060795 Ga0451576_0060795_1953_2945 328
307 3300045051 Ga0451576_0094991 Ga0451576_0094991_1089_2081 328
308 3300050507 nmdc:mga05p37_18674_c1 nmdc:mga05p37_18674_c1_6401_7411 328
309 3300050507 nmdc:mga05p37_381604_c1 nmdc:mga05p37_381604_c1_388_1380 328
310 3300050508 nmdc:mga09592_111848_c1 nmdc:mga09592_111848_c1_1206_2195 328
311 3300050508 nmdc:mga09592_131495_c1 nmdc:mga09592_131495_c1_1141_2133 328
312 3300050509 nmdc:mga0qj67_59122_c1 nmdc:mga0qj67_59122_c1_1358_2347 328
313 3300050510 nmdc:mga06r32_58340_c1 nmdc:mga06r32_58340_c1_2016_3005 328
314 3300050510 nmdc:mga06r32_64574_c1 nmdc:mga06r32_64574_c1_1264_2256 328
315 3300050511 nmdc:mga08y16_1317_c1 nmdc:mga08y16_1317_c1_19192_20184 328
316 3300050512 nmdc:mga0n895_17404_c1 nmdc:mga0n895_17404_c1_5331_6323 328
317 3300050512 nmdc:mga0n895_25299_c1 nmdc:mga0n895_25299_c1_429_1421 328
318 3300050515 nmdc:mga0a205_7301_c1 nmdc:mga0a205_7301_c1_893_1885 328
319 3300061734 Ga0530510_0021408 Ga0530510_0021408_771_1778 328
320 3300005471 Ga0070698_100129395 Ga0070698_1001293952 329
321 3300005518 Ga0070699_100043710 Ga0070699_1000437102 329
322 3300006847 Ga0075431_100000368 Ga0075431_10000036831 329
323 3300031548 Ga0307408_100028425 Ga0307408_1000284252 329
324 3300031731 Ga0307405_10145965 Ga0307405_101459652 329
325 3300031852 Ga0307410_10011940 Ga0307410_100119403 329
326 3300031911 Ga0307412_10180901 Ga0307412_101809012 329
327 3300037418 Ga0395900_0182351 Ga0395900_0182351_695_1690 329
328 3300044673 Ga0453683_0196825 Ga0453683_0196825_87_1082 329
329 3300049522 Ga0501299_007178 Ga0501299_007178_664_1659 329
330 3300050509 nmdc:mga0qj67_76310_c1 nmdc:mga0qj67_76310_c1_574_1569 329
331 3300050510 nmdc:mga06r32_6782_c1 nmdc:mga06r32_6782_c1_1226_2221 329
332 3300050515 nmdc:mga0a205_9201_c1 nmdc:mga0a205_9201_c1_7082_8077 329
333 3300005336 Ga0070680_100085840 Ga0070680_1000858402 330
334 3300005341 Ga0070691_10122840 Ga0070691_101228401 330
335 3300005345 Ga0070692_10004872 Ga0070692_100048727 330
336 3300005438 Ga0070701_10044576 Ga0070701_100445761 330
337 3300005444 Ga0070694_100013750 Ga0070694_1000137506 330
338 3300005468 Ga0070707_100090965 Ga0070707_1000909653 330
339 3300005471 Ga0070698_100133104 Ga0070698_1001331042 330
340 3300005545 Ga0070695_100001603 Ga0070695_10000160312 330
341 3300005546 Ga0070696_100017688 Ga0070696_1000176882 330
342 3300005547 Ga0070693_100200150 Ga0070693_1002001502 330
343 3300005549 Ga0070704_100037077 Ga0070704_1000370771 330
344 3300005577 Ga0068857_100135913 Ga0068857_1001359132 330
345 3300005840 Ga0068870_10063999 Ga0068870_100639992 330
346 3300005843 Ga0068860_100041169 Ga0068860_1000411693 330
347 3300005983 Ga0081540_1079214 Ga0081540_10792142 330
348 3300006844 Ga0075428_100416438 Ga0075428_1004164381 330
349 3300006846 Ga0075430_100009487 Ga0075430_1000094877 330
350 3300006847 Ga0075431_100164429 Ga0075431_1001644292 330
351 3300006852 Ga0075433_10400082 Ga0075433_104000822 330
352 3300006871 Ga0075434_100000547 Ga0075434_10000054720 330
353 3300006880 Ga0075429_100017882 Ga0075429_1000178823 330
354 3300006880 Ga0075429_100036837 Ga0075429_1000368372 330
355 3300007076 Ga0075435_100012260 Ga0075435_1000122607 330
356 3300009094 Ga0111539_10010465 Ga0111539_100104653 330
357 3300009147 Ga0114129_10001900 Ga0114129_100019007 330
358 3300009147 Ga0114129_10088964 Ga0114129_100889644 330
359 3300009147 Ga0114129_10184660 Ga0114129_101846602 330
360 3300009148 Ga0105243_10014492 Ga0105243_100144927 330
361 3300009176 Ga0105242_10003482 Ga0105242_1000348211 330
362 3300009553 Ga0105249_10013108 Ga0105249_100131087 330
363 3300013308 Ga0157375_10298850 Ga0157375_102988502 330
364 3300025908 Ga0207643_10047210 Ga0207643_100472102 330
365 3300025910 Ga0207684_10014976 Ga0207684_100149765 330
366 3300025922 Ga0207646_10050940 Ga0207646_100509403 330
367 3300025922 Ga0207646_10076506 Ga0207646_100765062 330
368 3300025934 Ga0207686_10018811 Ga0207686_100188112 330
369 3300025935 Ga0207709_10066702 Ga0207709_100667022 330
370 3300025942 Ga0207689_10039378 Ga0207689_100393783 330
371 3300025961 Ga0207712_10104078 Ga0207712_101040781 330
372 3300026075 Ga0207708_10129880 Ga0207708_101298802 330
373 3300026116 Ga0207674_10252601 Ga0207674_102526012 330
374 3300027907 Ga0207428_10000009 Ga0207428_10000009162 330
375 3300028381 Ga0268264_10065773 Ga0268264_100657734 330
376 3300035088 Ga0373940_0011335 Ga0373940_0011335_994_1986 330
377 3300035112 Ga0373932_0007626 Ga0373932_0007626_1559_2551 330
378 3300037312 Ga0395899_0177512 Ga0395899_0177512_274_1269 330
379 3300037418 Ga0395900_0046393 Ga0395900_0046393_2673_3668 330
380 3300038443 Ga0395901_0114377 Ga0395901_0114377_582_1577 330
381 3300050507 nmdc:mga05p37_103174_c1 nmdc:mga05p37_103174_c1_2404_3399 330
382 3300050507 nmdc:mga05p37_21499_c1 nmdc:mga05p37_21499_c1_2351_3343 330
383 3300050508 nmdc:mga09592_5414_c1 nmdc:mga09592_5414_c1_5550_6542 330
384 3300050509 nmdc:mga0qj67_18797_c1 nmdc:mga0qj67_18797_c1_2859_3851 330
385 3300050509 nmdc:mga0qj67_221318_c1 nmdc:mga0qj67_221318_c1_516_1511 330
386 3300050511 nmdc:mga08y16_40_c1 nmdc:mga08y16_40_c1_119952_120944 330
387 3300050512 nmdc:mga0n895_49997_c1 nmdc:mga0n895_49997_c1_2862_3854 330
388 3300050513 nmdc:mga0rr50_151160_c1 nmdc:mga0rr50_151160_c1_225_1217 330
389 3300050515 nmdc:mga0a205_3549_c1 nmdc:mga0a205_3549_c1_12479_13471 330
390 3300005347 Ga0070668_100115249 Ga0070668_1001152493 331
391 3300005440 Ga0070705_100020418 Ga0070705_1000204183 331
392 3300005457 Ga0070662_100220939 Ga0070662_1002209392 331
393 3300005549 Ga0070704_100381535 Ga0070704_1003815351 331
394 3300005841 Ga0068863_100154030 Ga0068863_1001540302 331
395 3300005843 Ga0068860_100083609 Ga0068860_1000836091 331
396 3300006844 Ga0075428_100009872 Ga0075428_1000098725 331
397 3300006846 Ga0075430_100000065 Ga0075430_10000006535 331
398 3300006847 Ga0075431_100000849 Ga0075431_10000084913 331
399 3300006852 Ga0075433_10039454 Ga0075433_100394542 331
400 3300006852 Ga0075433_10084662 Ga0075433_100846622 331
401 3300006871 Ga0075434_100039134 Ga0075434_1000391342 331
402 3300006914 Ga0075436_100112330 Ga0075436_1001123302 331
403 3300007076 Ga0075435_100045866 Ga0075435_1000458662 331
404 3300009094 Ga0111539_10002932 Ga0111539_100029323 331
405 3300009147 Ga0114129_10257227 Ga0114129_102572273 331
406 3300009148 Ga0105243_10021874 Ga0105243_100218742 331
407 3300009553 Ga0105249_10023700 Ga0105249_100237006 331
408 3300013306 Ga0163162_10014997 Ga0163162_100149971 331
409 3300025923 Ga0207681_10095006 Ga0207681_100950062 331
410 3300025933 Ga0207706_10020487 Ga0207706_100204874 331
411 3300026118 Ga0207675_100018750 Ga0207675_1000187505 331
412 3300027907 Ga0207428_10005063 Ga0207428_100050636 331
413 3300028381 Ga0268264_10038754 Ga0268264_100387541 331
414 3300035691 Ga0373931_0016119 Ga0373931_0016119_456_1451 331
415 3300045051 Ga0451576_0296503 Ga0451576_0296503_539_1534 331
416 3300050511 nmdc:mga08y16_12345_c1 nmdc:mga08y16_12345_c1_6499_7497 331
417 3300050512 nmdc:mga0n895_113464_c1 nmdc:mga0n895_113464_c1_1265_2260 331
418 3300050515 nmdc:mga0a205_196136_c1 nmdc:mga0a205_196136_c1_468_1463 331
419 3300005444 Ga0070694_100002264 Ga0070694_10000226412 332
420 3300005445 Ga0070708_100028197 Ga0070708_1000281975 332
421 3300005467 Ga0070706_100080864 Ga0070706_1000808641 332
422 3300005468 Ga0070707_100104913 Ga0070707_1001049131 332
423 3300005471 Ga0070698_100079091 Ga0070698_1000790912 332
424 3300005518 Ga0070699_100064034 Ga0070699_1000640343 332
425 3300005536 Ga0070697_100011809 Ga0070697_1000118094 332
426 3300005536 Ga0070697_100041613 Ga0070697_1000416132 332
427 3300005545 Ga0070695_100001651 Ga0070695_10000165111 332
428 3300005937 Ga0081455_10003725 Ga0081455_100037255 332
429 3300025910 Ga0207684_10001116 Ga0207684_1000111633 332
430 3300025922 Ga0207646_10002268 Ga0207646_1000226827 332
431 3300042876 Ga0451577_0030057 Ga0451577_0030057_318_1316 332
432 3300044673 Ga0453683_0042586 Ga0453683_0042586_1024_2028 332
433 3300045051 Ga0451576_0211499 Ga0451576_0211499_561_1559 332
434 3300045051 Ga0451576_0220331 Ga0451576_0220331_288_1286 332
435 3300046472 Ga0495580_0055832 Ga0495580_0055832_441_1439 332
436 3300003371 JGI26145J50221_1002783 JGI26145J50221_10027831 333
437 3300004803 Ga0058862_12779875 Ga0058862_127798751 333
438 3300005290 Ga0065712_10091311 Ga0065712_100913112 333
439 3300005293 Ga0065715_10153476 Ga0065715_101534761 333
440 3300005328 Ga0070676_10001199 Ga0070676_1000119912 333
441 3300005331 Ga0070670_100025599 Ga0070670_1000255991 333
442 3300005334 Ga0068869_100003166 Ga0068869_1000031665 333
443 3300005336 Ga0070680_100018994 Ga0070680_1000189945 333
444 3300005337 Ga0070682_100003456 Ga0070682_1000034565 333
445 3300005338 Ga0068868_100006957 Ga0068868_1000069577 333
446 3300005339 Ga0070660_100001484 Ga0070660_1000014845 333
447 3300005340 Ga0070689_100406391 Ga0070689_1004063911 333
448 3300005341 Ga0070691_10007452 Ga0070691_100074521 333
449 3300005344 Ga0070661_100001482 Ga0070661_1000014825 333
450 3300005345 Ga0070692_10000237 Ga0070692_100002375 333
451 3300005353 Ga0070669_100014776 Ga0070669_1000147766 333
452 3300005354 Ga0070675_100268052 Ga0070675_1002680521 333
453 3300005364 Ga0070673_100023814 Ga0070673_1000238143 333
454 3300005366 Ga0070659_100001725 Ga0070659_1000017255 333
455 3300005406 Ga0070703_10004890 Ga0070703_100048902 333
456 3300005438 Ga0070701_10036008 Ga0070701_100360082 333
457 3300005440 Ga0070705_100008127 Ga0070705_1000081275 333
458 3300005440 Ga0070705_100193815 Ga0070705_1001938151 333
459 3300005444 Ga0070694_100014905 Ga0070694_1000149052 333
460 3300005455 Ga0070663_100014481 Ga0070663_1000144811 333
461 3300005457 Ga0070662_100183424 Ga0070662_1001834241 333
462 3300005458 Ga0070681_10040330 Ga0070681_100403305 333
463 3300005459 Ga0068867_100014336 Ga0068867_1000143365 333
464 3300005468 Ga0070707_100027164 Ga0070707_1000271642 333
465 3300005471 Ga0070698_100002031 Ga0070698_10000203125 333
466 3300005518 Ga0070699_100001966 Ga0070699_1000019662 333
467 3300005530 Ga0070679_100022523 Ga0070679_1000225233 333
468 3300005535 Ga0070684_100073538 Ga0070684_1000735384 333
469 3300005539 Ga0068853_100001823 Ga0068853_10000182314 333
470 3300005543 Ga0070672_100004962 Ga0070672_10000496212 333
471 3300005545 Ga0070695_100001428 Ga0070695_10000142815 333
472 3300005545 Ga0070695_100037382 Ga0070695_1000373823 333
473 3300005546 Ga0070696_100071091 Ga0070696_1000710913 333
474 3300005547 Ga0070693_100003873 Ga0070693_1000038735 333
475 3300005549 Ga0070704_100003341 Ga0070704_1000033416 333
476 3300005563 Ga0068855_100005123 Ga0068855_10000512316 333
477 3300005564 Ga0070664_100019414 Ga0070664_1000194145 333
478 3300005578 Ga0068854_100016543 Ga0068854_1000165432 333
479 3300005614 Ga0068856_100062579 Ga0068856_1000625793 333
480 3300005615 Ga0070702_100013212 Ga0070702_1000132123 333
481 3300005616 Ga0068852_100038813 Ga0068852_1000388132 333
482 3300005618 Ga0068864_100014929 Ga0068864_1000149292 333
483 3300005719 Ga0068861_100023978 Ga0068861_1000239783 333
484 3300005840 Ga0068870_10000437 Ga0068870_1000043712 333
485 3300005842 Ga0068858_100038883 Ga0068858_1000388832 333
486 3300005844 Ga0068862_100002850 Ga0068862_10000285014 333
487 3300006163 Ga0070715_10063045 Ga0070715_100630451 333
488 3300006852 Ga0075433_10001084 Ga0075433_1000108419 333
489 3300006852 Ga0075433_10463657 Ga0075433_104636571 333
490 3300006871 Ga0075434_100005550 Ga0075434_1000055504 333
491 3300006871 Ga0075434_100301611 Ga0075434_1003016112 333
492 3300006914 Ga0075436_100045274 Ga0075436_1000452741 333
493 3300007076 Ga0075435_100016888 Ga0075435_1000168886 333
494 3300007076 Ga0075435_100019309 Ga0075435_1000193093 333
495 3300009147 Ga0114129_10080279 Ga0114129_100802795 333
496 3300009147 Ga0114129_10167397 Ga0114129_101673972 333
497 3300009174 Ga0105241_10009467 Ga0105241_100094677 333
498 3300009177 Ga0105248_10117545 Ga0105248_101175452 333
499 3300009553 Ga0105249_10400631 Ga0105249_104006311 333
500 3300010375 Ga0105239_10470966 Ga0105239_104709662 333
501 3300013100 Ga0157373_10013951 Ga0157373_100139513 333
502 3300013307 Ga0157372_10006881 Ga0157372_1000688111 333
503 3300013307 Ga0157372_10037276 Ga0157372_100372765 333
504 3300014325 Ga0163163_10082969 Ga0163163_100829692 333
505 3300015262 Ga0182007_10026525 Ga0182007_100265252 333
506 3300020070 Ga0206356_10809313 Ga0206356_108093132 333
507 3300025885 Ga0207653_10008474 Ga0207653_100084743 333
508 3300025901 Ga0207688_10008520 Ga0207688_100085204 333
509 3300025907 Ga0207645_10002226 Ga0207645_100022265 333
510 3300025907 Ga0207645_10169277 Ga0207645_101692772 333
511 3300025908 Ga0207643_10001163 Ga0207643_1000116313 333
512 3300025910 Ga0207684_10040381 Ga0207684_100403811 333
513 3300025911 Ga0207654_10028205 Ga0207654_100282052 333
514 3300025912 Ga0207707_10000556 Ga0207707_1000055618 333
515 3300025913 Ga0207695_10281834 Ga0207695_102818342 333
516 3300025917 Ga0207660_10002844 Ga0207660_1000284411 333
517 3300025919 Ga0207657_10003869 Ga0207657_100038695 333
518 3300025920 Ga0207649_10005083 Ga0207649_100050834 333
519 3300025921 Ga0207652_10016524 Ga0207652_100165244 333
520 3300025922 Ga0207646_10048108 Ga0207646_100481083 333
521 3300025923 Ga0207681_10005627 Ga0207681_100056276 333
522 3300025925 Ga0207650_10061110 Ga0207650_100611102 333
523 3300025926 Ga0207659_10137256 Ga0207659_101372562 333
524 3300025933 Ga0207706_10264508 Ga0207706_102645081 333
525 3300025939 Ga0207665_10008896 Ga0207665_100088966 333
526 3300025942 Ga0207689_10001708 Ga0207689_100017085 333
527 3300025944 Ga0207661_10221952 Ga0207661_102219522 333
528 3300025945 Ga0207679_10003969 Ga0207679_100039692 333
529 3300025949 Ga0207667_10005121 Ga0207667_1000512114 333
530 3300025960 Ga0207651_10174157 Ga0207651_101741572 333
531 3300025981 Ga0207640_10069256 Ga0207640_100692562 333
532 3300026035 Ga0207703_10060780 Ga0207703_100607804 333
533 3300026041 Ga0207639_10006287 Ga0207639_100062875 333
534 3300026067 Ga0207678_10021293 Ga0207678_100212934 333
535 3300026078 Ga0207702_10012432 Ga0207702_100124322 333
536 3300026088 Ga0207641_10048288 Ga0207641_100482881 333
537 3300026089 Ga0207648_10005601 Ga0207648_100056012 333
538 3300026116 Ga0207674_10005434 Ga0207674_1000543414 333
539 3300026118 Ga0207675_100018522 Ga0207675_1000185225 333
540 3300027378 Ga0209981_1002286 Ga0209981_10022862 333
541 3300027395 Ga0209996_1003329 Ga0209996_10033291 333
542 3300027462 Ga0210000_1004359 Ga0210000_10043592 333
543 3300027471 Ga0209995_1002118 Ga0209995_10021183 333
544 3300027526 Ga0209968_1001700 Ga0209968_10017003 333
545 3300027543 Ga0209999_1000956 Ga0209999_10009565 333
546 3300027617 Ga0210002_1002546 Ga0210002_10025462 333
547 3300027665 Ga0209983_1000928 Ga0209983_10009285 333
548 3300027682 Ga0209971_1000059 Ga0209971_10000591 333
549 3300027695 Ga0209966_1000256 Ga0209966_100025615 333
550 3300027717 Ga0209998_10000070 Ga0209998_1000007037 333
551 3300027876 Ga0209974_10000099 Ga0209974_100000992 333
552 3300028380 Ga0268265_10006336 Ga0268265_100063361 333
553 3300035121 Ga0373960_0025659 Ga0373960_0025659_358_1392 333
554 3300042438 Ga0439459_0011888 Ga0439459_0011888_306_1340 333
555 3300042461 Ga0439460_0000755 Ga0439460_0000755_922_1923 333
556 3300045051 Ga0451576_0233136 Ga0451576_0233136_229_1362 333
557 3300048905 Ga0496102_0169893 Ga0496102_0169893_361_1395 333
558 3300048909 Ga0496106_0029604 Ga0496106_0029604_229_1263 333
559 3300048915 Ga0496112_0114393 Ga0496112_0114393_221_1255 333
560 3300049575 Ga0501039_0230447 Ga0501039_0230447_48_1049 333
561 3300049577 Ga0501041_0012076 Ga0501041_0012076_1104_2105 333
562 3300049578 Ga0501042_0008561 Ga0501042_0008561_2166_3167 333
563 3300049580 Ga0501046_0015336 Ga0501046_0015336_2232_3233 333
564 3300049586 Ga0501070_0202304 Ga0501070_0202304_73_1074 333
565 3300049591 Ga0501075_0208585 Ga0501075_0208585_342_1343 333
566 3300049592 Ga0501076_0026693 Ga0501076_0026693_1357_2358 333
567 3300049593 Ga0501077_0163506 Ga0501077_0163506_10_1011 333
568 3300049741 Ga0501079_0001113 Ga0501079_0001113_13998_14999 333
569 3300049743 Ga0501081_0031757 Ga0501081_0031757_2459_3460 333
570 3300049822 Ga0501035_0166329 Ga0501035_0166329_399_1400 333
571 3300049824 Ga0501045_0058795 Ga0501045_0058795_1514_2515 333
572 3300050507 nmdc:mga05p37_94380_c1 nmdc:mga05p37_94380_c1_1857_2891 333
573 3300050512 nmdc:mga0n895_28430_c1 nmdc:mga0n895_28430_c1_441_1442 333
574 3300050512 nmdc:mga0n895_72200_c1 nmdc:mga0n895_72200_c1_1622_2656 333
575 3300050513 nmdc:mga0rr50_30113_c1 nmdc:mga0rr50_30113_c1_1259_2260 333
576 3300050513 nmdc:mga0rr50_6053_c1 nmdc:mga0rr50_6053_c1_4938_5972 333
577 3300050514 nmdc:mga08x19_11181_c1 nmdc:mga08x19_11181_c1_721_1722 333
578 3300050514 nmdc:mga08x19_185923_c1 nmdc:mga08x19_185923_c1_358_1392 333
579 3300050514 nmdc:mga08x19_34176_c1 nmdc:mga08x19_34176_c1_1444_2445 333
580 3300050515 nmdc:mga0a205_5597_c1 nmdc:mga0a205_5597_c1_8128_9129 333
581 3300060353 Ga0501082_0001643 Ga0501082_0001643_2687_3688 333
582 3300061734 Ga0530510_0227660 Ga0530510_0227660_93_1094 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

18

278

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.8194 26 303
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7898 24 303
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7693 26 303
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7405 24 303
4yb6-assembly1.cif.gz_F adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine 0.7147 28 265
ID Description Score Start End Superfamily
3eeqB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8972 28 61 3.40.50.11220
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8727 114 241 3.40.190.10
af_Q2FZZ0_32_109_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8436 28 72 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8376 114 240 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8083 114 241 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A444J0D3-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.9594 21 303
AF-A0A547Q6J9-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9393 23 300
AF-A0A401IDS4-F1-model_v4 Uncharacterized protein 0.9308 21 297
AF-W4M479-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9304 20 301
AF-A0A1D2QSB2-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9292 22 301

Feature Viewer

pLDDT pTM Quality
87.63 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map