F466222
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 288 | 580 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300053078|Ga0495612_0075367|Ga0495612_0075367_13_777 |
| Length | 254 |
| Sequence | MRRKIMTRNPVTGEDGRSIGTAVDAVVFDVFGTVVDWRSGVIRDGEALAAAKGLTVDWLAFADAWRAGYQPAMQRVRSGEIAWTRIDGLHRAILDTLLPRFGLESLDEGERAALNRVWHRLDPWPDVVAGLRRLKQRFTISTLSNGNVSLLVDMARHAGLPWDCVLSAELFRRYKPDPEVYLGAARLLDVVPAELLMVAAHPSDLAAAAEAGLRTAYVPRPLEHGPGGFRAAPADQRFDFVAQDFGDLAAQLDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 2 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 286 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.45 |
| Nodule | 0 |
| Rhizoplane | 6.87 |
| Rhizosphere | 81.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1001378 | 3300000545 | Bacteria | 1612 |
| 2 | rootL2_10255016 | 3300003322 | Bacteria | 1252 |
| 3 | Ga0055540_1002957 | 3300003792 | Bacteria | 8533 |
| 4 | Ga0055540_1004305 | 3300003792 | Bacteria | 6489 |
| 5 | Ga0070658_10250367 | 3300005327 | Bacteria | 1503 |
| 6 | Ga0070676_10012434 | 3300005328 | Bacteria | 4646 |
| 7 | Ga0070676_10040160 | 3300005328 | Bacteria | 2709 |
| 8 | Ga0070676_10096333 | 3300005328 | Bacteria | 1821 |
| 9 | Ga0070676_10400447 | 3300005328 | Bacteria | 955 |
| 10 | Ga0070683_100141715 | 3300005329 | Bacteria | 2277 |
| 11 | Ga0070683_100213280 | 3300005329 | Bacteria | 1834 |
| 12 | Ga0070683_100433739 | 3300005329 | Bacteria | 1254 |
| 13 | Ga0070690_100014288 | 3300005330 | Bacteria | 4709 |
| 14 | Ga0070670_100003234 | 3300005331 | Bacteria | 13455 |
| 15 | Ga0070670_100192388 | 3300005331 | Bacteria | 1772 |
| 16 | Ga0070670_100373356 | 3300005331 | Bacteria | 1256 |
| 17 | Ga0070670_100470730 | 3300005331 | Bacteria | 1115 |
| 18 | Ga0070677_10061087 | 3300005333 | Bacteria | 1555 |
| 19 | Ga0070677_10086747 | 3300005333 | Bacteria | 1352 |
| 20 | Ga0070677_10110053 | 3300005333 | Bacteria | 1228 |
| 21 | Ga0068869_100046767 | 3300005334 | Bacteria | 3121 |
| 22 | Ga0068869_100049508 | 3300005334 | Bacteria | 3042 |
| 23 | Ga0068869_100092576 | 3300005334 | Bacteria | 2276 |
| 24 | Ga0070666_10119007 | 3300005335 | Bacteria | 1830 |
| 25 | Ga0070680_100148058 | 3300005336 | Bacteria | 1970 |
| 26 | Ga0070682_100194963 | 3300005337 | Bacteria | 1425 |
| 27 | Ga0070682_100230557 | 3300005337 | Bacteria | 1323 |
| 28 | Ga0068868_100043976 | 3300005338 | Bacteria | 3490 |
| 29 | Ga0068868_100053541 | 3300005338 | Bacteria | 3179 |
| 30 | Ga0068868_100149592 | 3300005338 | Bacteria | 1922 |
| 31 | Ga0068868_100295500 | 3300005338 | Bacteria | 1374 |
| 32 | Ga0068868_100330539 | 3300005338 | Bacteria | 1301 |
| 33 | Ga0068868_100413825 | 3300005338 | Bacteria | 1166 |
| 34 | Ga0068868_100774319 | 3300005338 | Bacteria | 864 |
| 35 | Ga0070660_100361189 | 3300005339 | Bacteria | 1197 |
| 36 | Ga0070689_100339561 | 3300005340 | Bacteria | 1258 |
| 37 | Ga0070687_100008435 | 3300005343 | Bacteria | 4366 |
| 38 | Ga0070661_100032687 | 3300005344 | Bacteria | 3766 |
| 39 | Ga0070661_100075252 | 3300005344 | Bacteria | 2487 |
| 40 | Ga0070661_100246817 | 3300005344 | Bacteria | 1376 |
| 41 | Ga0070661_100277419 | 3300005344 | Bacteria | 1299 |
| 42 | Ga0070661_100358379 | 3300005344 | Bacteria | 1146 |
| 43 | Ga0070661_100491884 | 3300005344 | Bacteria | 981 |
| 44 | Ga0070668_100021760 | 3300005347 | Bacteria | 4845 |
| 45 | Ga0070669_100041375 | 3300005353 | Bacteria | 3351 |
| 46 | Ga0070669_100157601 | 3300005353 | Bacteria | 1762 |
| 47 | Ga0070669_100385520 | 3300005353 | Bacteria | 1144 |
| 48 | Ga0070669_100537148 | 3300005353 | Bacteria | 973 |
| 49 | Ga0070675_100027407 | 3300005354 | Bacteria | 4577 |
| 50 | Ga0070675_100111354 | 3300005354 | Bacteria | 2316 |
| 51 | Ga0070675_100131352 | 3300005354 | Bacteria | 2134 |
| 52 | Ga0070675_100260899 | 3300005354 | Bacteria | 1518 |
| 53 | Ga0070671_100000534 | 3300005355 | Bacteria | 26702 |
| 54 | Ga0070671_100016856 | 3300005355 | Bacteria | 5909 |
| 55 | Ga0070671_100064999 | 3300005355 | Bacteria | 3038 |
| 56 | Ga0070671_100131678 | 3300005355 | Bacteria | 2106 |
| 57 | Ga0070671_100134558 | 3300005355 | Bacteria | 2083 |
| 58 | Ga0070674_100008544 | 3300005356 | Bacteria | 6105 |
| 59 | Ga0070674_100076398 | 3300005356 | Bacteria | 2381 |
| 60 | Ga0070673_100017428 | 3300005364 | Bacteria | 5107 |
| 61 | Ga0070673_100222868 | 3300005364 | Bacteria | 1633 |
| 62 | Ga0070673_100266373 | 3300005364 | Bacteria | 1498 |
| 63 | Ga0070673_100358389 | 3300005364 | Bacteria | 1296 |
| 64 | Ga0070659_100004663 | 3300005366 | Bacteria | 9783 |
| 65 | Ga0070667_100041935 | 3300005367 | Bacteria | 3838 |
| 66 | Ga0070667_100066886 | 3300005367 | Bacteria | 3054 |
| 67 | Ga0070667_100097031 | 3300005367 | Bacteria | 2542 |
| 68 | Ga0070667_100233718 | 3300005367 | Bacteria | 1640 |
| 69 | Ga0070667_100332424 | 3300005367 | Bacteria | 1373 |
| 70 | Ga0070667_100360376 | 3300005367 | Bacteria | 1318 |
| 71 | Ga0070709_10010686 | 3300005434 | Bacteria | 5093 |
| 72 | Ga0070713_100054840 | 3300005436 | Bacteria | 3309 |
| 73 | Ga0070713_100368162 | 3300005436 | Bacteria | 1336 |
| 74 | Ga0070710_10022298 | 3300005437 | Bacteria | 3309 |
| 75 | Ga0070701_10143547 | 3300005438 | Bacteria | 1368 |
| 76 | Ga0070705_100244985 | 3300005440 | Bacteria | 1255 |
| 77 | Ga0070700_100022547 | 3300005441 | Bacteria | 3674 |
| 78 | Ga0070663_100061684 | 3300005455 | Bacteria | 2700 |
| 79 | Ga0070663_100088922 | 3300005455 | Bacteria | 2285 |
| 80 | Ga0070678_100077289 | 3300005456 | Bacteria | 2510 |
| 81 | Ga0070678_100077608 | 3300005456 | Bacteria | 2506 |
| 82 | Ga0070678_100086348 | 3300005456 | Bacteria | 2393 |
| 83 | Ga0070678_100145965 | 3300005456 | Bacteria | 1899 |
| 84 | Ga0070678_100325411 | 3300005456 | Bacteria | 1314 |
| 85 | Ga0070662_100003483 | 3300005457 | Bacteria | 9812 |
| 86 | Ga0070662_100190825 | 3300005457 | Bacteria | 1620 |
| 87 | Ga0070681_10042378 | 3300005458 | Bacteria | 4561 |
| 88 | Ga0068867_100011474 | 3300005459 | Bacteria | 6253 |
| 89 | Ga0068867_100047355 | 3300005459 | Bacteria | 3160 |
| 90 | Ga0068867_100133746 | 3300005459 | Bacteria | 1930 |
| 91 | Ga0068867_100259332 | 3300005459 | Bacteria | 1417 |
| 92 | Ga0070706_100008756 | 3300005467 | Bacteria | 9427 |
| 93 | Ga0070706_100041084 | 3300005467 | Bacteria | 4270 |
| 94 | Ga0070707_100361326 | 3300005468 | Bacteria | 1410 |
| 95 | Ga0070698_100007972 | 3300005471 | Bacteria | 11454 |
| 96 | Ga0070698_100022409 | 3300005471 | Bacteria | 6609 |
| 97 | Ga0070684_100720571 | 3300005535 | Bacteria | 930 |
| 98 | Ga0070697_100019641 | 3300005536 | Bacteria | 5338 |
| 99 | Ga0068853_100053645 | 3300005539 | Bacteria | 3471 |
| 100 | Ga0070672_100008701 | 3300005543 | Bacteria | 6963 |
| 101 | Ga0070672_100014712 | 3300005543 | Bacteria | 5551 |
| 102 | Ga0070672_100031397 | 3300005543 | Bacteria | 3997 |
| 103 | Ga0070672_100071450 | 3300005543 | Bacteria | 2761 |
| 104 | Ga0070672_100088994 | 3300005543 | Bacteria | 2487 |
| 105 | Ga0070672_100120221 | 3300005543 | Bacteria | 2149 |
| 106 | Ga0070672_100265119 | 3300005543 | Bacteria | 1449 |
| 107 | Ga0070686_100324488 | 3300005544 | Bacteria | 1149 |
| 108 | Ga0070665_100612577 | 3300005548 | Bacteria | 1102 |
| 109 | Ga0068855_100306222 | 3300005563 | Bacteria | 1759 |
| 110 | Ga0070664_100194983 | 3300005564 | Bacteria | 1805 |
| 111 | Ga0070664_100468118 | 3300005564 | Bacteria | 1158 |
| 112 | Ga0070664_100780557 | 3300005564 | Bacteria | 893 |
| 113 | Ga0068857_100020115 | 3300005577 | Bacteria | 5868 |
| 114 | Ga0068857_100021744 | 3300005577 | Bacteria | 5645 |
| 115 | Ga0068857_100102781 | 3300005577 | Bacteria | 2566 |
| 116 | Ga0068857_100109216 | 3300005577 | Bacteria | 2485 |
| 117 | Ga0068854_100118709 | 3300005578 | Bacteria | 2004 |
| 118 | Ga0068854_100206891 | 3300005578 | Bacteria | 1546 |
| 119 | Ga0068856_100004930 | 3300005614 | Bacteria | 13214 |
| 120 | Ga0068856_100060697 | 3300005614 | Bacteria | 3735 |
| 121 | Ga0068852_100029432 | 3300005616 | Bacteria | 4512 |
| 122 | Ga0068852_100033531 | 3300005616 | Bacteria | 4265 |
| 123 | Ga0068852_100095681 | 3300005616 | Bacteria | 2667 |
| 124 | Ga0068852_100128925 | 3300005616 | Bacteria | 2327 |
| 125 | Ga0068852_100148014 | 3300005616 | Bacteria | 2180 |
| 126 | Ga0068852_100493193 | 3300005616 | Bacteria | 1219 |
| 127 | Ga0068852_100522214 | 3300005616 | Bacteria | 1185 |
| 128 | Ga0068859_100804906 | 3300005617 | Bacteria | 1027 |
| 129 | Ga0068859_100864943 | 3300005617 | Bacteria | 990 |
| 130 | Ga0068864_100063190 | 3300005618 | Bacteria | 3208 |
| 131 | Ga0068864_100128335 | 3300005618 | Bacteria | 2275 |
| 132 | Ga0068864_100244678 | 3300005618 | Bacteria | 1663 |
| 133 | Ga0068864_100324052 | 3300005618 | Bacteria | 1448 |
| 134 | Ga0068864_100375893 | 3300005618 | Bacteria | 1345 |
| 135 | Ga0068866_10124415 | 3300005718 | Bacteria | 1458 |
| 136 | Ga0068861_100022892 | 3300005719 | Bacteria | 4504 |
| 137 | Ga0068861_100103441 | 3300005719 | Bacteria | 2270 |
| 138 | Ga0068851_10013041 | 3300005834 | Bacteria | 3929 |
| 139 | Ga0068851_10102310 | 3300005834 | Bacteria | 1521 |
| 140 | Ga0068851_10148281 | 3300005834 | Bacteria | 1280 |
| 141 | Ga0068851_10162752 | 3300005834 | Bacteria | 1227 |
| 142 | Ga0068870_10151148 | 3300005840 | Bacteria | 1368 |
| 143 | Ga0068863_100235834 | 3300005841 | Bacteria | 1765 |
| 144 | Ga0068863_100421627 | 3300005841 | Bacteria | 1307 |
| 145 | Ga0068863_100450291 | 3300005841 | Bacteria | 1263 |
| 146 | Ga0068858_100014061 | 3300005842 | Bacteria | 7548 |
| 147 | Ga0068858_100019774 | 3300005842 | Bacteria | 6295 |
| 148 | Ga0068860_100033557 | 3300005843 | Bacteria | 4924 |
| 149 | Ga0068860_100034758 | 3300005843 | Bacteria | 4835 |
| 150 | Ga0068862_100100406 | 3300005844 | Bacteria | 2530 |
| 151 | Ga0070717_10123719 | 3300006028 | Bacteria | 2218 |
| 152 | Ga0070717_10368781 | 3300006028 | Bacteria | 1286 |
| 153 | Ga0075365_10024694 | 3300006038 | Bacteria | 3796 |
| 154 | Ga0075365_10149458 | 3300006038 | Bacteria | 1625 |
| 155 | Ga0075368_10024335 | 3300006042 | Bacteria | 2319 |
| 156 | Ga0075368_10189906 | 3300006042 | Bacteria | 867 |
| 157 | Ga0075363_100005382 | 3300006048 | Bacteria | 5688 |
| 158 | Ga0075363_100010458 | 3300006048 | Bacteria | 4409 |
| 159 | Ga0075363_100139819 | 3300006048 | Bacteria | 1363 |
| 160 | Ga0075364_10032078 | 3300006051 | Bacteria | 3375 |
| 161 | Ga0075364_10085608 | 3300006051 | Bacteria | 2087 |
| 162 | Ga0075364_10087607 | 3300006051 | Bacteria | 2063 |
| 163 | Ga0070716_100035964 | 3300006173 | Bacteria | 2727 |
| 164 | Ga0070716_100168011 | 3300006173 | Bacteria | 1429 |
| 165 | Ga0075362_10012616 | 3300006177 | Bacteria | 3361 |
| 166 | Ga0075367_10009541 | 3300006178 | Bacteria | 5077 |
| 167 | Ga0075367_10014095 | 3300006178 | Bacteria | 4319 |
| 168 | Ga0075367_10019789 | 3300006178 | Bacteria | 3737 |
| 169 | Ga0075369_10037718 | 3300006186 | Bacteria | 2059 |
| 170 | Ga0075369_10081221 | 3300006186 | Bacteria | 1438 |
| 171 | Ga0075366_10004224 | 3300006195 | Bacteria | 7701 |
| 172 | Ga0075366_10059704 | 3300006195 | Bacteria | 2265 |
| 173 | Ga0075366_10112370 | 3300006195 | Bacteria | 1639 |
| 174 | Ga0075366_10145989 | 3300006195 | Bacteria | 1431 |
| 175 | Ga0075366_10166304 | 3300006195 | Bacteria | 1337 |
| 176 | Ga0097621_100026616 | 3300006237 | Bacteria | 4539 |
| 177 | Ga0075370_10000316 | 3300006353 | Bacteria | 17492 |
| 178 | Ga0075370_10000379 | 3300006353 | Bacteria | 16381 |
| 179 | Ga0075370_10003355 | 3300006353 | Bacteria | 7610 |
| 180 | Ga0075370_10094823 | 3300006353 | Bacteria | 1723 |
| 181 | Ga0068871_100032976 | 3300006358 | Bacteria | 4096 |
| 182 | Ga0075428_100001546 | 3300006844 | Bacteria | 24627 |
| 183 | Ga0075430_100000248 | 3300006846 | Bacteria | 37345 |
| 184 | Ga0075430_100006144 | 3300006846 | Bacteria | 10117 |
| 185 | Ga0075431_100001170 | 3300006847 | Bacteria | 23654 |
| 186 | Ga0075431_100219224 | 3300006847 | Bacteria | 1941 |
| 187 | Ga0075433_10002300 | 3300006852 | Bacteria | 14556 |
| 188 | Ga0075434_100044336 | 3300006871 | Bacteria | 4412 |
| 189 | Ga0075434_100103406 | 3300006871 | Bacteria | 2856 |
| 190 | Ga0075429_100000001 | 3300006880 | Bacteria | 139031 |
| 191 | Ga0068865_100211823 | 3300006881 | Bacteria | 1510 |
| 192 | Ga0075436_100102653 | 3300006914 | Bacteria | 1992 |
| 193 | Ga0075436_100139808 | 3300006914 | Bacteria | 1701 |
| 194 | Ga0097620_100805005 | 3300006931 | Bacteria | 1027 |
| 195 | Ga0097620_100864956 | 3300006931 | Bacteria | 990 |
| 196 | Ga0075435_100189751 | 3300007076 | Bacteria | 1739 |
| 197 | Ga0075435_100270318 | 3300007076 | Bacteria | 1450 |
| 198 | Ga0105240_10009086 | 3300009093 | Bacteria | 14109 |
| 199 | Ga0111539_10431901 | 3300009094 | Bacteria | 1534 |
| 200 | Ga0111539_10666156 | 3300009094 | Bacteria | 1212 |
| 201 | Ga0105245_10276799 | 3300009098 | Bacteria | 1639 |
| 202 | Ga0105245_10332560 | 3300009098 | Bacteria | 1500 |
| 203 | Ga0114129_10010984 | 3300009147 | Bacteria | 12901 |
| 204 | Ga0114129_10038978 | 3300009147 | Bacteria | 6698 |
| 205 | Ga0114129_10151673 | 3300009147 | Bacteria | 3171 |
| 206 | Ga0114129_10265788 | 3300009147 | Bacteria | 2297 |
| 207 | Ga0105243_10057538 | 3300009148 | Bacteria | 3096 |
| 208 | Ga0105243_10129069 | 3300009148 | Bacteria | 2142 |
| 209 | Ga0105243_10231385 | 3300009148 | Bacteria | 1640 |
| 210 | Ga0105243_10720840 | 3300009148 | Bacteria | 974 |
| 211 | Ga0105242_10114117 | 3300009176 | Bacteria | 2308 |
| 212 | Ga0105242_10286534 | 3300009176 | Bacteria | 1498 |
| 213 | Ga0105248_10040445 | 3300009177 | Bacteria | 5226 |
| 214 | Ga0105248_10111124 | 3300009177 | Bacteria | 3091 |
| 215 | Ga0105248_10219991 | 3300009177 | Bacteria | 2138 |
| 216 | Ga0105248_10650989 | 3300009177 | Bacteria | 1189 |
| 217 | Ga0105237_10000958 | 3300009545 | Bacteria | 38812 |
| 218 | Ga0105237_10016409 | 3300009545 | Bacteria | 7695 |
| 219 | Ga0105238_10137813 | 3300009551 | Bacteria | 2418 |
| 220 | Ga0105238_10400253 | 3300009551 | Bacteria | 1366 |
| 221 | Ga0105238_11259713 | 3300009551 | Unclassified | 765 |
| 222 | Ga0105249_10086361 | 3300009553 | Bacteria | 2926 |
| 223 | Ga0105249_10121302 | 3300009553 | Bacteria | 2484 |
| 224 | Ga0105249_10196195 | 3300009553 | Bacteria | 1973 |
| 225 | Ga0105239_10006535 | 3300010375 | Bacteria | 13508 |
| 226 | Ga0105246_10532784 | 3300011119 | Bacteria | 1003 |
| 227 | Ga0157373_10060659 | 3300013100 | Bacteria | 2679 |
| 228 | Ga0157370_10181792 | 3300013104 | Bacteria | 1954 |
| 229 | Ga0157374_10111272 | 3300013296 | Bacteria | 2634 |
| 230 | Ga0157374_10308977 | 3300013296 | Bacteria | 1565 |
| 231 | Ga0157378_10130216 | 3300013297 | Bacteria | 2328 |
| 232 | Ga0163162_10037061 | 3300013306 | Bacteria | 4864 |
| 233 | Ga0163162_10957503 | 3300013306 | Bacteria | 967 |
| 234 | Ga0157372_10007234 | 3300013307 | Bacteria | 11820 |
| 235 | Ga0157372_10826900 | 3300013307 | Bacteria | 1075 |
| 236 | Ga0157375_10029461 | 3300013308 | Bacteria | 5162 |
| 237 | Ga0157375_10051348 | 3300013308 | Bacteria | 4049 |
| 238 | Ga0157375_10060766 | 3300013308 | Bacteria | 3749 |
| 239 | Ga0157375_10081183 | 3300013308 | Bacteria | 3282 |
| 240 | Ga0157375_10508793 | 3300013308 | Bacteria | 1368 |
| 241 | Ga0163163_10191236 | 3300014325 | Bacteria | 2095 |
| 242 | Ga0163163_10447942 | 3300014325 | Bacteria | 1351 |
| 243 | Ga0163163_10490049 | 3300014325 | Bacteria | 1291 |
| 244 | Ga0163163_10893621 | 3300014325 | Bacteria | 952 |
| 245 | Ga0157380_10010673 | 3300014326 | Bacteria | 6616 |
| 246 | Ga0157380_10161708 | 3300014326 | Bacteria | 1947 |
| 247 | Ga0157377_10069435 | 3300014745 | Bacteria | 2033 |
| 248 | Ga0157377_10101465 | 3300014745 | Bacteria | 1715 |
| 249 | Ga0157379_10007204 | 3300014968 | Bacteria | 9619 |
| 250 | Ga0157379_10034450 | 3300014968 | Bacteria | 4515 |
| 251 | Ga0157379_10063043 | 3300014968 | Bacteria | 3315 |
| 252 | Ga0157379_10114488 | 3300014968 | Bacteria | 2424 |
| 253 | Ga0157376_10052467 | 3300014969 | Bacteria | 3391 |
| 254 | Ga0157376_10105671 | 3300014969 | Bacteria | 2469 |
| 255 | Ga0163161_10039177 | 3300017792 | Bacteria | 3401 |
| 256 | Ga0163161_10058711 | 3300017792 | Bacteria | 2796 |
| 257 | Ga0163161_10101436 | 3300017792 | Bacteria | 2143 |
| 258 | Ga0209051_1001007 | 3300025303 | Bacteria | 27069 |
| 259 | Ga0209051_1003186 | 3300025303 | Bacteria | 10956 |
| 260 | Ga0209051_1053200 | 3300025303 | Bacteria | 1332 |
| 261 | Ga0207697_10022863 | 3300025315 | Bacteria | 2560 |
| 262 | Ga0207656_10051035 | 3300025321 | Bacteria | 1788 |
| 263 | Ga0207656_10115647 | 3300025321 | Bacteria | 1244 |
| 264 | Ga0207682_10020370 | 3300025893 | Bacteria | 2604 |
| 265 | Ga0207682_10032555 | 3300025893 | Bacteria | 2096 |
| 266 | Ga0207682_10089295 | 3300025893 | Bacteria | 1334 |
| 267 | Ga0207682_10108555 | 3300025893 | Bacteria | 1220 |
| 268 | Ga0207682_10152967 | 3300025893 | Bacteria | 1041 |
| 269 | Ga0207692_10245464 | 3300025898 | Bacteria | 1071 |
| 270 | Ga0207642_10120686 | 3300025899 | Bacteria | 1351 |
| 271 | Ga0207710_10000056 | 3300025900 | Bacteria | 178147 |
| 272 | Ga0207688_10101630 | 3300025901 | Bacteria | 1661 |
| 273 | Ga0207680_10019990 | 3300025903 | Bacteria | 3593 |
| 274 | Ga0207680_10216027 | 3300025903 | Bacteria | 1313 |
| 275 | Ga0207645_10008823 | 3300025907 | Bacteria | 7006 |
| 276 | Ga0207645_10012245 | 3300025907 | Bacteria | 5825 |
| 277 | Ga0207645_10029751 | 3300025907 | Bacteria | 3520 |
| 278 | Ga0207645_10166775 | 3300025907 | Bacteria | 1442 |
| 279 | Ga0207643_10035563 | 3300025908 | Bacteria | 2793 |
| 280 | Ga0207705_10060137 | 3300025909 | Bacteria | 2743 |
| 281 | Ga0207684_10006858 | 3300025910 | Bacteria | 10311 |
| 282 | Ga0207684_10047347 | 3300025910 | Bacteria | 3646 |
| 283 | Ga0207684_10314099 | 3300025910 | Bacteria | 1351 |
| 284 | Ga0207695_10147889 | 3300025913 | Bacteria | 2291 |
| 285 | Ga0207671_10004831 | 3300025914 | Bacteria | 12687 |
| 286 | Ga0207671_10241871 | 3300025914 | Bacteria | 1418 |
| 287 | Ga0207693_10003237 | 3300025915 | Bacteria | 13977 |
| 288 | Ga0207663_10020065 | 3300025916 | Bacteria | 3780 |
| 289 | Ga0207660_10107561 | 3300025917 | Bacteria | 2093 |
| 290 | Ga0207662_10005876 | 3300025918 | Bacteria | 6581 |
| 291 | Ga0207657_10051810 | 3300025919 | Bacteria | 3566 |
| 292 | Ga0207657_10158794 | 3300025919 | Bacteria | 1837 |
| 293 | Ga0207657_10158964 | 3300025919 | Bacteria | 1836 |
| 294 | Ga0207649_10170212 | 3300025920 | Bacteria | 1517 |
| 295 | Ga0207652_10041922 | 3300025921 | Bacteria | 3893 |
| 296 | Ga0207646_10003828 | 3300025922 | Bacteria | 16717 |
| 297 | Ga0207681_10025799 | 3300025923 | Bacteria | 3784 |
| 298 | Ga0207681_10187604 | 3300025923 | Bacteria | 1579 |
| 299 | Ga0207681_10213368 | 3300025923 | Bacteria | 1489 |
| 300 | Ga0207650_10003667 | 3300025925 | Bacteria | 10504 |
| 301 | Ga0207650_10062595 | 3300025925 | Bacteria | 2780 |
| 302 | Ga0207650_10258297 | 3300025925 | Bacteria | 1412 |
| 303 | Ga0207650_10380458 | 3300025925 | Bacteria | 1165 |
| 304 | Ga0207659_10013906 | 3300025926 | Bacteria | 5175 |
| 305 | Ga0207659_10024080 | 3300025926 | Bacteria | 4074 |
| 306 | Ga0207659_10100152 | 3300025926 | Bacteria | 2183 |
| 307 | Ga0207659_10111283 | 3300025926 | Bacteria | 2082 |
| 308 | Ga0207664_10328534 | 3300025929 | Bacteria | 1350 |
| 309 | Ga0207644_10000360 | 3300025931 | Bacteria | 29659 |
| 310 | Ga0207644_10005934 | 3300025931 | Bacteria | 7961 |
| 311 | Ga0207644_10024980 | 3300025931 | Bacteria | 4105 |
| 312 | Ga0207644_10140330 | 3300025931 | Bacteria | 1860 |
| 313 | Ga0207644_10286181 | 3300025931 | Bacteria | 1324 |
| 314 | Ga0207690_10075785 | 3300025932 | Bacteria | 2334 |
| 315 | Ga0207706_10007080 | 3300025933 | Bacteria | 10371 |
| 316 | Ga0207706_10029157 | 3300025933 | Bacteria | 4928 |
| 317 | Ga0207706_10078331 | 3300025933 | Bacteria | 2907 |
| 318 | Ga0207686_10058342 | 3300025934 | Bacteria | 2433 |
| 319 | Ga0207686_10120280 | 3300025934 | Bacteria | 1786 |
| 320 | Ga0207709_10028538 | 3300025935 | Bacteria | 3227 |
| 321 | Ga0207709_10262823 | 3300025935 | Bacteria | 1266 |
| 322 | Ga0207670_10258672 | 3300025936 | Bacteria | 1348 |
| 323 | Ga0207669_10029992 | 3300025937 | Bacteria | 3016 |
| 324 | Ga0207669_10153627 | 3300025937 | Bacteria | 1616 |
| 325 | Ga0207665_10135222 | 3300025939 | Bacteria | 1754 |
| 326 | Ga0207665_10157952 | 3300025939 | Bacteria | 1629 |
| 327 | Ga0207691_10002225 | 3300025940 | Bacteria | 18972 |
| 328 | Ga0207691_10007668 | 3300025940 | Bacteria | 10387 |
| 329 | Ga0207691_10026718 | 3300025940 | Bacteria | 5416 |
| 330 | Ga0207691_10075841 | 3300025940 | Bacteria | 3031 |
| 331 | Ga0207691_10179193 | 3300025940 | Bacteria | 1852 |
| 332 | Ga0207691_10194949 | 3300025940 | Bacteria | 1765 |
| 333 | Ga0207711_10012084 | 3300025941 | Bacteria | 7176 |
| 334 | Ga0207711_10068738 | 3300025941 | Bacteria | 3069 |
| 335 | Ga0207689_10002313 | 3300025942 | Bacteria | 17849 |
| 336 | Ga0207689_10008764 | 3300025942 | Bacteria | 8795 |
| 337 | Ga0207689_10040238 | 3300025942 | Bacteria | 3869 |
| 338 | Ga0207689_10095638 | 3300025942 | Bacteria | 2440 |
| 339 | Ga0207661_10337522 | 3300025944 | Bacteria | 1357 |
| 340 | Ga0207679_10191127 | 3300025945 | Bacteria | 1702 |
| 341 | Ga0207679_10331541 | 3300025945 | Bacteria | 1321 |
| 342 | Ga0207679_10462990 | 3300025945 | Bacteria | 1126 |
| 343 | Ga0207651_10068520 | 3300025960 | Bacteria | 2502 |
| 344 | Ga0207651_10182923 | 3300025960 | Bacteria | 1664 |
| 345 | Ga0207651_10198630 | 3300025960 | Bacteria | 1605 |
| 346 | Ga0207712_10041716 | 3300025961 | Bacteria | 3155 |
| 347 | Ga0207712_10042191 | 3300025961 | Bacteria | 3140 |
| 348 | Ga0207712_10344183 | 3300025961 | Bacteria | 1237 |
| 349 | Ga0207668_10014922 | 3300025972 | Bacteria | 4818 |
| 350 | Ga0207668_10063888 | 3300025972 | Bacteria | 2599 |
| 351 | Ga0207640_10055476 | 3300025981 | Bacteria | 2596 |
| 352 | Ga0207640_10109695 | 3300025981 | Bacteria | 1953 |
| 353 | Ga0207640_10348441 | 3300025981 | Bacteria | 1189 |
| 354 | Ga0207658_10015968 | 3300025986 | Bacteria | 5157 |
| 355 | Ga0207658_10204100 | 3300025986 | Bacteria | 1652 |
| 356 | Ga0207677_10075883 | 3300026023 | Bacteria | 2391 |
| 357 | Ga0207677_10103839 | 3300026023 | Bacteria | 2099 |
| 358 | Ga0207703_10016405 | 3300026035 | Bacteria | 5775 |
| 359 | Ga0207703_10041922 | 3300026035 | Bacteria | 3669 |
| 360 | Ga0207703_10065929 | 3300026035 | Bacteria | 2977 |
| 361 | Ga0207703_10200556 | 3300026035 | Bacteria | 1773 |
| 362 | Ga0207639_10060734 | 3300026041 | Bacteria | 2917 |
| 363 | Ga0207639_10089738 | 3300026041 | Bacteria | 2457 |
| 364 | Ga0207639_10221187 | 3300026041 | Bacteria | 1635 |
| 365 | Ga0207678_10045486 | 3300026067 | Bacteria | 3796 |
| 366 | Ga0207678_10067290 | 3300026067 | Bacteria | 3075 |
| 367 | Ga0207678_10180056 | 3300026067 | Bacteria | 1805 |
| 368 | Ga0207678_10589009 | 3300026067 | Bacteria | 974 |
| 369 | Ga0207708_10019575 | 3300026075 | Bacteria | 5103 |
| 370 | Ga0207702_10776027 | 3300026078 | Unclassified | 947 |
| 371 | Ga0207702_10969910 | 3300026078 | Bacteria | 843 |
| 372 | Ga0207641_10024652 | 3300026088 | Bacteria | 4957 |
| 373 | Ga0207641_10157530 | 3300026088 | Bacteria | 2061 |
| 374 | Ga0207641_10244169 | 3300026088 | Bacteria | 1674 |
| 375 | Ga0207648_10006265 | 3300026089 | Bacteria | 11842 |
| 376 | Ga0207648_10017650 | 3300026089 | Bacteria | 6482 |
| 377 | Ga0207648_10035407 | 3300026089 | Bacteria | 4397 |
| 378 | Ga0207648_10086539 | 3300026089 | Bacteria | 2734 |
| 379 | Ga0207648_10665670 | 3300026089 | Bacteria | 963 |
| 380 | Ga0207676_10053196 | 3300026095 | Bacteria | 3168 |
| 381 | Ga0207676_10153757 | 3300026095 | Bacteria | 1984 |
| 382 | Ga0207676_10184776 | 3300026095 | Bacteria | 1828 |
| 383 | Ga0207676_10303559 | 3300026095 | Bacteria | 1458 |
| 384 | Ga0207676_10328670 | 3300026095 | Bacteria | 1406 |
| 385 | Ga0207676_10828196 | 3300026095 | Bacteria | 904 |
| 386 | Ga0207674_10004884 | 3300026116 | Bacteria | 16046 |
| 387 | Ga0207674_10022988 | 3300026116 | Bacteria | 6686 |
| 388 | Ga0207674_10033847 | 3300026116 | Bacteria | 5346 |
| 389 | Ga0207674_10101455 | 3300026116 | Bacteria | 2858 |
| 390 | Ga0207675_100003645 | 3300026118 | Bacteria | 15012 |
| 391 | Ga0207675_100005117 | 3300026118 | Bacteria | 12625 |
| 392 | Ga0207683_10110011 | 3300026121 | Bacteria | 2467 |
| 393 | Ga0207683_10134907 | 3300026121 | Bacteria | 2222 |
| 394 | Ga0207683_10156058 | 3300026121 | Bacteria | 2061 |
| 395 | Ga0207683_10180626 | 3300026121 | Bacteria | 1913 |
| 396 | Ga0207683_10332643 | 3300026121 | Bacteria | 1392 |
| 397 | Ga0207683_10518567 | 3300026121 | Bacteria | 1101 |
| 398 | Ga0207698_10059527 | 3300026142 | Bacteria | 2966 |
| 399 | Ga0207698_10102215 | 3300026142 | Bacteria | 2379 |
| 400 | Ga0207698_10150004 | 3300026142 | Bacteria | 2022 |
| 401 | Ga0207698_10335401 | 3300026142 | Bacteria | 1422 |
| 402 | Ga0207698_10352329 | 3300026142 | Bacteria | 1391 |
| 403 | Ga0207698_10528706 | 3300026142 | Bacteria | 1152 |
| 404 | Ga0207698_10678750 | 3300026142 | Bacteria | 1023 |
| 405 | Ga0209974_10017294 | 3300027876 | Bacteria | 2392 |
| 406 | Ga0268266_10523804 | 3300028379 | Bacteria | 1134 |
| 407 | Ga0268266_10531913 | 3300028379 | Bacteria | 1125 |
| 408 | Ga0268265_10028550 | 3300028380 | Bacteria | 3995 |
| 409 | Ga0268264_10033475 | 3300028381 | Bacteria | 4222 |
| 410 | Ga0307408_100240680 | 3300031548 | Bacteria | 1487 |
| 411 | Ga0307508_10284445 | 3300031616 | Bacteria | 1247 |
| 412 | Ga0307516_10017915 | 3300031730 | Bacteria | 7375 |
| 413 | Ga0307410_10157981 | 3300031852 | Bacteria | 1696 |
| 414 | Ga0307407_10092469 | 3300031903 | Bacteria | 1858 |
| 415 | Ga0307412_10026475 | 3300031911 | Bacteria | 3605 |
| 416 | Ga0307409_100105829 | 3300031995 | Bacteria | 2346 |
| 417 | Ga0307416_100003176 | 3300032002 | Bacteria | 9632 |
| 418 | Ga0307411_10173873 | 3300032005 | Bacteria | 1627 |
| 419 | Ga0307415_100137194 | 3300032126 | Bacteria | 1862 |
| 420 | Ga0373928_0055213 | 3300035084 | Bacteria | 948 |
| 421 | Ga0373934_0037371 | 3300035086 | Bacteria | 1912 |
| 422 | Ga0373945_0042063 | 3300035116 | Bacteria | 1655 |
| 423 | Ga0373954_0000008 | 3300035118 | Bacteria | 79963 |
| 424 | Ga0373954_0102464 | 3300035118 | Bacteria | 1382 |
| 425 | Ga0373956_0112478 | 3300035119 | Bacteria | 1268 |
| 426 | Ga0373943_0042851 | 3300035170 | Bacteria | 2195 |
| 427 | Ga0373943_0109302 | 3300035170 | Bacteria | 1456 |
| 428 | Ga0373946_0103217 | 3300035171 | Bacteria | 1281 |
| 429 | Ga0373955_0085465 | 3300035172 | Bacteria | 1791 |
| 430 | Ga0373924_0225101 | 3300035410 | Unclassified | 829 |
| 431 | Ga0373935_0102430 | 3300035692 | Bacteria | 1889 |
| 432 | Ga0373927_0255811 | 3300035695 | Bacteria | 1151 |
| 433 | Ga0373927_0260354 | 3300035695 | Bacteria | 1141 |
| 434 | Ga0373933_0001883 | 3300035724 | Bacteria | 12112 |
| 435 | Ga0373933_0221824 | 3300035724 | Bacteria | 1213 |
| 436 | Ga0373933_0447879 | 3300035724 | Bacteria | 844 |
| 437 | Ga0373947_0522577 | 3300035725 | Bacteria | 807 |
| 438 | Ga0373937_0000551 | 3300036401 | Bacteria | 33238 |
| 439 | Ga0373937_0176412 | 3300036401 | Bacteria | 2006 |
| 440 | Ga0373937_0417423 | 3300036401 | Bacteria | 1273 |
| 441 | Ga0395899_0132320 | 3300037312 | Bacteria | 1780 |
| 442 | Ga0395900_0024502 | 3300037418 | Bacteria | 6179 |
| 443 | Ga0395898_0009183 | 3300037466 | Bacteria | 10408 |
| 444 | Ga0395901_0035138 | 3300038443 | Bacteria | 5179 |
| 445 | Ga0436363_0460634 | 3300039450 | Bacteria | 1801 |
| 446 | Ga0466972_0002980 | 3300044658 | Bacteria | 8379 |
| 447 | Ga0466965_0002399 | 3300044683 | Bacteria | 7948 |
| 448 | Ga0466960_0000211 | 3300044901 | Bacteria | 20062 |
| 449 | Ga0451576_0553619 | 3300045051 | Bacteria | 1208 |
| 450 | Ga0466967_0269183 | 3300045976 | Bacteria | 1632 |
| 451 | Ga0495592_0001414 | 3300046454 | Bacteria | 16651 |
| 452 | Ga0495603_0118207 | 3300046455 | Bacteria | 1545 |
| 453 | Ga0495603_0152287 | 3300046455 | Bacteria | 1343 |
| 454 | Ga0495629_0242866 | 3300046459 | Bacteria | 1240 |
| 455 | Ga0495638_0266130 | 3300046460 | Bacteria | 938 |
| 456 | Ga0495582_0040706 | 3300046473 | Bacteria | 2560 |
| 457 | Ga0495584_0139059 | 3300046491 | Unclassified | 1233 |
| 458 | Ga0495606_0028883 | 3300046507 | Bacteria | 3904 |
| 459 | Ga0495608_0234906 | 3300046511 | Unclassified | 1147 |
| 460 | Ga0495610_0114836 | 3300046512 | Bacteria | 1188 |
| 461 | Ga0495616_0061881 | 3300046513 | Bacteria | 1835 |
| 462 | Ga0495628_0134425 | 3300046516 | Bacteria | 1891 |
| 463 | Ga0495637_0210051 | 3300046520 | Bacteria | 712 |
| 464 | Ga0495644_0138593 | 3300046523 | Bacteria | 929 |
| 465 | Ga0495648_0000833 | 3300046524 | Bacteria | 32602 |
| 466 | Ga0495642_0021404 | 3300046528 | Bacteria | 2543 |
| 467 | Ga0495640_0306759 | 3300046533 | Bacteria | 985 |
| 468 | Ga0495586_0190872 | 3300046535 | Bacteria | 1160 |
| 469 | Ga0495597_0074256 | 3300046542 | Bacteria | 1460 |
| 470 | Ga0495645_0018188 | 3300046543 | Bacteria | 5046 |
| 471 | Ga0495667_0302690 | 3300046559 | Bacteria | 1013 |
| 472 | Ga0495668_0018534 | 3300046616 | Bacteria | 4023 |
| 473 | Ga0495623_0273696 | 3300046679 | Bacteria | 942 |
| 474 | Ga0495647_0089514 | 3300046681 | Bacteria | 1260 |
| 475 | Ga0495658_0021873 | 3300046683 | Bacteria | 3376 |
| 476 | Ga0495658_0037987 | 3300046683 | Bacteria | 2664 |
| 477 | Ga0495613_0129227 | 3300046689 | Bacteria | 1810 |
| 478 | Ga0495670_0228320 | 3300046691 | Bacteria | 990 |
| 479 | Ga0495649_0023324 | 3300046694 | Bacteria | 3458 |
| 480 | Ga0495604_0001385 | 3300047317 | Bacteria | 19854 |
| 481 | Ga0495674_0140689 | 3300047319 | Bacteria | 2029 |
| 482 | Ga0495672_0001133 | 3300047320 | Bacteria | 27015 |
| 483 | Ga0495680_0010119 | 3300047322 | Bacteria | 8431 |
| 484 | Ga0495687_000359 | 3300047443 | Bacteria | 57119 |
| 485 | Ga0495687_006702 | 3300047443 | Bacteria | 6983 |
| 486 | Ga0495673_0000856 | 3300047469 | Bacteria | 28247 |
| 487 | Ga0495602_0590210 | 3300048088 | Bacteria | 765 |
| 488 | Ga0496100_0006224 | 3300048903 | Bacteria | 6493 |
| 489 | Ga0496100_0203877 | 3300048903 | Bacteria | 1443 |
| 490 | Ga0496101_0000026 | 3300048904 | Bacteria | 199963 |
| 491 | Ga0496101_0066482 | 3300048904 | Bacteria | 2630 |
| 492 | Ga0496101_0239538 | 3300048904 | Bacteria | 1412 |
| 493 | Ga0496102_0000031 | 3300048905 | Bacteria | 217389 |
| 494 | Ga0496102_0262822 | 3300048905 | Bacteria | 1627 |
| 495 | Ga0496103_0000025 | 3300048906 | Bacteria | 221144 |
| 496 | Ga0496104_0004547 | 3300048907 | Bacteria | 12085 |
| 497 | Ga0496104_0109243 | 3300048907 | Bacteria | 2651 |
| 498 | Ga0496105_0078955 | 3300048908 | Bacteria | 2718 |
| 499 | Ga0496105_0120845 | 3300048908 | Bacteria | 2160 |
| 500 | Ga0496105_0215579 | 3300048908 | Bacteria | 1564 |
| 501 | Ga0496106_0016267 | 3300048909 | Bacteria | 5504 |
| 502 | Ga0496106_0155013 | 3300048909 | Bacteria | 1808 |
| 503 | Ga0496106_0421502 | 3300048909 | Bacteria | 1073 |
| 504 | Ga0496107_0016047 | 3300048910 | Bacteria | 5256 |
| 505 | Ga0496107_0110352 | 3300048910 | Bacteria | 2021 |
| 506 | Ga0496108_0002743 | 3300048911 | Bacteria | 14087 |
| 507 | Ga0496108_0029782 | 3300048911 | Bacteria | 4523 |
| 508 | Ga0496108_0137690 | 3300048911 | Bacteria | 2102 |
| 509 | Ga0496108_0141037 | 3300048911 | Bacteria | 2076 |
| 510 | Ga0496109_0035154 | 3300048912 | Bacteria | 4518 |
| 511 | Ga0496109_0098714 | 3300048912 | Bacteria | 2708 |
| 512 | Ga0496110_0009808 | 3300048913 | Bacteria | 7757 |
| 513 | Ga0496111_0005697 | 3300048914 | Bacteria | 8026 |
| 514 | Ga0496111_0092615 | 3300048914 | Bacteria | 2215 |
| 515 | Ga0496111_0160002 | 3300048914 | Bacteria | 1672 |
| 516 | Ga0496112_0008259 | 3300048915 | Bacteria | 9315 |
| 517 | Ga0496112_0021084 | 3300048915 | Bacteria | 6190 |
| 518 | Ga0496112_0038071 | 3300048915 | Bacteria | 4696 |
| 519 | Ga0496112_0075635 | 3300048915 | Bacteria | 3330 |
| 520 | Ga0496112_0107705 | 3300048915 | Bacteria | 2757 |
| 521 | Ga0496112_0237020 | 3300048915 | Bacteria | 1778 |
| 522 | Ga0496113_0058385 | 3300048916 | Bacteria | 2903 |
| 523 | Ga0496113_0101427 | 3300048916 | Bacteria | 2231 |
| 524 | Ga0496114_0035499 | 3300048917 | Bacteria | 4117 |
| 525 | Ga0496114_0038925 | 3300048917 | Bacteria | 3935 |
| 526 | Ga0496115_0227552 | 3300048918 | Bacteria | 1538 |
| 527 | Ga0496115_0229450 | 3300048918 | Bacteria | 1531 |
| 528 | Ga0496116_0000084 | 3300048919 | Bacteria | 219579 |
| 529 | Ga0496117_0000018 | 3300048920 | Bacteria | 479613 |
| 530 | Ga0496118_0000013 | 3300048921 | Bacteria | 574008 |
| 531 | Ga0496119_0020835 | 3300048922 | Bacteria | 4761 |
| 532 | Ga0496119_0032380 | 3300048922 | Bacteria | 3485 |
| 533 | Ga0496120_0012709 | 3300048923 | Bacteria | 5710 |
| 534 | Ga0496121_0000056 | 3300048924 | Bacteria | 296250 |
| 535 | Ga0496126_0000089 | 3300048929 | Bacteria | 211348 |
| 536 | Ga0501075_0167270 | 3300049591 | Bacteria | 1678 |
| 537 | nmdc:mga03683_109201_c1 | 3300050489 | Bacteria | 1222 |
| 538 | nmdc:mga03683_6219_c1 | 3300050489 | Bacteria | 4075 |
| 539 | nmdc:mga00v17_320381_c1 | 3300050491 | Bacteria | 1007 |
| 540 | nmdc:mga00v17_379019_c1 | 3300050491 | Bacteria | 919 |
| 541 | nmdc:mga00v17_46657_c1 | 3300050491 | Bacteria | 2622 |
| 542 | nmdc:mga0k408_104669_c1 | 3300050493 | Bacteria | 1670 |
| 543 | nmdc:mga0k408_25900_c1 | 3300050493 | Bacteria | 3324 |
| 544 | nmdc:mga0k408_26927_c1 | 3300050493 | Bacteria | 3262 |
| 545 | nmdc:mga0k408_3366_c1 | 3300050493 | Bacteria | 8468 |
| 546 | nmdc:mga06z11_128152_c1 | 3300050494 | Bacteria | 1422 |
| 547 | nmdc:mga06z11_68378_c1 | 3300050494 | Bacteria | 1872 |
| 548 | nmdc:mga07m45_105892_c1 | 3300050496 | Bacteria | 1618 |
| 549 | nmdc:mga07m45_1246_c1 | 3300050496 | Bacteria | 11554 |
| 550 | nmdc:mga07m45_196303_c1 | 3300050496 | Bacteria | 1174 |
| 551 | nmdc:mga07m45_27321_c1 | 3300050496 | Bacteria | 1804 |
| 552 | nmdc:mga07m45_35155_c1 | 3300050496 | Bacteria | 2787 |
| 553 | nmdc:mga07m45_4005_c1 | 3300050496 | Bacteria | 7168 |
| 554 | nmdc:mga07m45_63808_c1 | 3300050496 | Bacteria | 2089 |
| 555 | nmdc:mga07m45_9134_c1 | 3300050496 | Bacteria | 5122 |
| 556 | nmdc:mga05p37_13321_c1 | 3300050507 | Bacteria | 9849 |
| 557 | nmdc:mga05p37_319019_c1 | 3300050507 | Bacteria | 1840 |
| 558 | nmdc:mga05p37_76654_c1 | 3300050507 | Bacteria | 4116 |
| 559 | nmdc:mga05p37_94154_c1 | 3300050507 | Bacteria | 3691 |
| 560 | nmdc:mga09592_21395_c1 | 3300050508 | Bacteria | 5330 |
| 561 | nmdc:mga0qj67_1083_c1 | 3300050509 | Bacteria | 18865 |
| 562 | nmdc:mga0qj67_2840_c1 | 3300050509 | Bacteria | 12419 |
| 563 | nmdc:mga06r32_149545_c1 | 3300050510 | Bacteria | 1961 |
| 564 | nmdc:mga06r32_1957_c1 | 3300050510 | Bacteria | 18373 |
| 565 | nmdc:mga0n895_11206_c1 | 3300050512 | Bacteria | 7985 |
| 566 | nmdc:mga0rr50_177709_c1 | 3300050513 | Bacteria | 1739 |
| 567 | nmdc:mga0rr50_229073_c1 | 3300050513 | Bacteria | 1537 |
| 568 | nmdc:mga08x19_35324_c1 | 3300050514 | Bacteria | 3162 |
| 569 | nmdc:mga0a205_149149_c1 | 3300050515 | Bacteria | 2239 |
| 570 | nmdc:mga0a205_185_c2 | 3300050515 | Bacteria | 42551 |
| 571 | nmdc:mga0sz30_76537_c1 | 3300050516 | Bacteria | 1445 |
| 572 | Ga0495601_0025287 | 3300053077 | Bacteria | 3661 |
| 573 | Ga0495601_0256133 | 3300053077 | Bacteria | 1143 |
| 574 | Ga0495612_0075367 | 3300053078 | Bacteria | 1412 |
| 575 | Ga0495595_0067278 | 3300053084 | Bacteria | 1688 |
| 576 | Ga0500644_0048224 | 3300053088 | Bacteria | 1448 |
| 577 | Ga0500651_0023491 | 3300053093 | Bacteria | 3862 |
| 578 | Ga0500594_0002652 | 3300053118 | Bacteria | 3887 |
| 579 | Ga0500658_0001540 | 3300053134 | Bacteria | 9213 |
| 580 | Ga0500622_0008232 | 3300053156 | Bacteria | 5852 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0042063 | Ga0373945_0042063_1004_1639 | 206 |
| 2 | 3300046533 | Ga0495640_0306759 | Ga0495640_0306759_325_969 | 213 |
| 3 | 3300048911 | Ga0496108_0137690 | Ga0496108_0137690_1132_1797 | 221 |
| 4 | 3300048915 | Ga0496112_0008259 | Ga0496112_0008259_8107_8772 | 221 |
| 5 | 3300005334 | Ga0068869_100092576 | Ga0068869_1000925762 | 223 |
| 6 | 3300005364 | Ga0070673_100358389 | Ga0070673_1003583892 | 223 |
| 7 | 3300005577 | Ga0068857_100102781 | Ga0068857_1001027812 | 223 |
| 8 | 3300005578 | Ga0068854_100118709 | Ga0068854_1001187092 | 223 |
| 9 | 3300005616 | Ga0068852_100128925 | Ga0068852_1001289252 | 223 |
| 10 | 3300006051 | Ga0075364_10087607 | Ga0075364_100876072 | 223 |
| 11 | 3300006177 | Ga0075362_10012616 | Ga0075362_100126163 | 223 |
| 12 | 3300006178 | Ga0075367_10019789 | Ga0075367_100197895 | 223 |
| 13 | 3300006186 | Ga0075369_10081221 | Ga0075369_100812212 | 223 |
| 14 | 3300006195 | Ga0075366_10145989 | Ga0075366_101459892 | 223 |
| 15 | 3300009093 | Ga0105240_10009086 | Ga0105240_1000908615 | 223 |
| 16 | 3300009545 | Ga0105237_10016409 | Ga0105237_100164099 | 223 |
| 17 | 3300025913 | Ga0207695_10147889 | Ga0207695_101478891 | 223 |
| 18 | 3300025914 | Ga0207671_10241871 | Ga0207671_102418712 | 223 |
| 19 | 3300025919 | Ga0207657_10158964 | Ga0207657_101589641 | 223 |
| 20 | 3300025933 | Ga0207706_10007080 | Ga0207706_100070809 | 223 |
| 21 | 3300025942 | Ga0207689_10095638 | Ga0207689_100956383 | 223 |
| 22 | 3300025960 | Ga0207651_10068520 | Ga0207651_100685202 | 223 |
| 23 | 3300025981 | Ga0207640_10348441 | Ga0207640_103484412 | 223 |
| 24 | 3300026116 | Ga0207674_10033847 | Ga0207674_100338475 | 223 |
| 25 | 3300026142 | Ga0207698_10678750 | Ga0207698_106787502 | 223 |
| 26 | 3300050489 | nmdc:mga03683_6219_c1 | nmdc:mga03683_6219_c1_2615_3331 | 223 |
| 27 | 3300050494 | nmdc:mga06z11_68378_c1 | nmdc:mga06z11_68378_c1_12_728 | 223 |
| 28 | 3300050496 | nmdc:mga07m45_105892_c1 | nmdc:mga07m45_105892_c1_716_1432 | 223 |
| 29 | 3300050516 | nmdc:mga0sz30_76537_c1 | nmdc:mga0sz30_76537_c1_242_958 | 223 |
| 30 | 3300009551 | Ga0105238_11259713 | Ga0105238_112597131 | 224 |
| 31 | 3300005328 | Ga0070676_10096333 | Ga0070676_100963332 | 225 |
| 32 | 3300006195 | Ga0075366_10059704 | Ga0075366_100597042 | 225 |
| 33 | 3300006914 | Ga0075436_100102653 | Ga0075436_1001026531 | 225 |
| 34 | 3300007076 | Ga0075435_100270318 | Ga0075435_1002703182 | 225 |
| 35 | 3300009147 | Ga0114129_10038978 | Ga0114129_100389786 | 225 |
| 36 | 3300025907 | Ga0207645_10166775 | Ga0207645_101667752 | 225 |
| 37 | 3300025937 | Ga0207669_10153627 | Ga0207669_101536272 | 225 |
| 38 | 3300026089 | Ga0207648_10035407 | Ga0207648_100354072 | 225 |
| 39 | 3300031730 | Ga0307516_10017915 | Ga0307516_100179155 | 225 |
| 40 | 3300046542 | Ga0495597_0074256 | Ga0495597_0074256_703_1419 | 225 |
| 41 | 3300047443 | Ga0495687_000359 | Ga0495687_000359_50120_50836 | 225 |
| 42 | 3300050491 | nmdc:mga00v17_320381_c1 | nmdc:mga00v17_320381_c1_24_701 | 225 |
| 43 | 3300050493 | nmdc:mga0k408_25900_c1 | nmdc:mga0k408_25900_c1_2244_2999 | 225 |
| 44 | 3300050496 | nmdc:mga07m45_196303_c1 | nmdc:mga07m45_196303_c1_326_1081 | 225 |
| 45 | 3300050507 | nmdc:mga05p37_94154_c1 | nmdc:mga05p37_94154_c1_1368_2048 | 225 |
| 46 | 3300050513 | nmdc:mga0rr50_229073_c1 | nmdc:mga0rr50_229073_c1_418_1098 | 225 |
| 47 | 3300050515 | nmdc:mga0a205_149149_c1 | nmdc:mga0a205_149149_c1_16_696 | 225 |
| 48 | 3300005434 | Ga0070709_10010686 | Ga0070709_100106866 | 226 |
| 49 | 3300005436 | Ga0070713_100054840 | Ga0070713_1000548402 | 226 |
| 50 | 3300005436 | Ga0070713_100368162 | Ga0070713_1003681622 | 226 |
| 51 | 3300005437 | Ga0070710_10022298 | Ga0070710_100222982 | 226 |
| 52 | 3300005614 | Ga0068856_100060697 | Ga0068856_1000606974 | 226 |
| 53 | 3300006028 | Ga0070717_10123719 | Ga0070717_101237192 | 226 |
| 54 | 3300009177 | Ga0105248_10650989 | Ga0105248_106509892 | 226 |
| 55 | 3300009553 | Ga0105249_10121302 | Ga0105249_101213024 | 226 |
| 56 | 3300025321 | Ga0207656_10115647 | Ga0207656_101156473 | 226 |
| 57 | 3300025898 | Ga0207692_10245464 | Ga0207692_102454642 | 226 |
| 58 | 3300025915 | Ga0207693_10003237 | Ga0207693_100032377 | 226 |
| 59 | 3300025916 | Ga0207663_10020065 | Ga0207663_100200654 | 226 |
| 60 | 3300025929 | Ga0207664_10328534 | Ga0207664_103285342 | 226 |
| 61 | 3300025972 | Ga0207668_10063888 | Ga0207668_100638885 | 226 |
| 62 | 3300025981 | Ga0207640_10109695 | Ga0207640_101096953 | 226 |
| 63 | 3300026078 | Ga0207702_10776027 | Ga0207702_107760271 | 226 |
| 64 | 3300026078 | Ga0207702_10969910 | Ga0207702_109699102 | 226 |
| 65 | 3300035170 | Ga0373943_0042851 | Ga0373943_0042851_479_1162 | 226 |
| 66 | 3300035172 | Ga0373955_0085465 | Ga0373955_0085465_128_811 | 226 |
| 67 | 3300035410 | Ga0373924_0225101 | Ga0373924_0225101_43_726 | 226 |
| 68 | 3300035725 | Ga0373947_0522577 | Ga0373947_0522577_95_778 | 226 |
| 69 | 3300036401 | Ga0373937_0176412 | Ga0373937_0176412_968_1651 | 226 |
| 70 | 3300044658 | Ga0466972_0002980 | Ga0466972_0002980_6425_7126 | 226 |
| 71 | 3300044683 | Ga0466965_0002399 | Ga0466965_0002399_6150_6851 | 226 |
| 72 | 3300044901 | Ga0466960_0000211 | Ga0466960_0000211_2082_2783 | 226 |
| 73 | 3300046455 | Ga0495603_0118207 | Ga0495603_0118207_556_1239 | 226 |
| 74 | 3300046491 | Ga0495584_0139059 | Ga0495584_0139059_17_700 | 226 |
| 75 | 3300046516 | Ga0495628_0134425 | Ga0495628_0134425_591_1274 | 226 |
| 76 | 3300046520 | Ga0495637_0210051 | Ga0495637_0210051_17_700 | 226 |
| 77 | 3300046523 | Ga0495644_0138593 | Ga0495644_0138593_62_745 | 226 |
| 78 | 3300047317 | Ga0495604_0001385 | Ga0495604_0001385_18326_19009 | 226 |
| 79 | 3300047319 | Ga0495674_0140689 | Ga0495674_0140689_50_739 | 226 |
| 80 | 3300047322 | Ga0495680_0010119 | Ga0495680_0010119_26_709 | 226 |
| 81 | 3300048903 | Ga0496100_0203877 | Ga0496100_0203877_369_1055 | 226 |
| 82 | 3300048904 | Ga0496101_0239538 | Ga0496101_0239538_616_1302 | 226 |
| 83 | 3300048907 | Ga0496104_0004547 | Ga0496104_0004547_5389_6075 | 226 |
| 84 | 3300048907 | Ga0496104_0109243 | Ga0496104_0109243_1530_2219 | 226 |
| 85 | 3300048908 | Ga0496105_0078955 | Ga0496105_0078955_56_739 | 226 |
| 86 | 3300048908 | Ga0496105_0120845 | Ga0496105_0120845_59_745 | 226 |
| 87 | 3300048911 | Ga0496108_0002743 | Ga0496108_0002743_8456_9142 | 226 |
| 88 | 3300048911 | Ga0496108_0029782 | Ga0496108_0029782_3302_3991 | 226 |
| 89 | 3300048912 | Ga0496109_0035154 | Ga0496109_0035154_2545_3231 | 226 |
| 90 | 3300048913 | Ga0496110_0009808 | Ga0496110_0009808_1697_2383 | 226 |
| 91 | 3300048914 | Ga0496111_0005697 | Ga0496111_0005697_1928_2614 | 226 |
| 92 | 3300048914 | Ga0496111_0092615 | Ga0496111_0092615_1334_2023 | 226 |
| 93 | 3300048915 | Ga0496112_0038071 | Ga0496112_0038071_2528_3214 | 226 |
| 94 | 3300048915 | Ga0496112_0107705 | Ga0496112_0107705_1393_2082 | 226 |
| 95 | 3300048915 | Ga0496112_0237020 | Ga0496112_0237020_452_1141 | 226 |
| 96 | 3300048916 | Ga0496113_0058385 | Ga0496113_0058385_622_1311 | 226 |
| 97 | 3300048916 | Ga0496113_0101427 | Ga0496113_0101427_1148_1834 | 226 |
| 98 | 3300048918 | Ga0496115_0227552 | Ga0496115_0227552_737_1426 | 226 |
| 99 | 3300050491 | nmdc:mga00v17_379019_c1 | nmdc:mga00v17_379019_c1_110_802 | 226 |
| 100 | 3300053084 | Ga0495595_0067278 | Ga0495595_0067278_11_694 | 226 |
| 101 | iso_pu_bacteria | 2671180139 | 2671695425 | 226 |
| 102 | 3300005333 | Ga0070677_10061087 | Ga0070677_100610872 | 227 |
| 103 | 3300005334 | Ga0068869_100049508 | Ga0068869_1000495082 | 227 |
| 104 | 3300005338 | Ga0068868_100043976 | Ga0068868_1000439762 | 227 |
| 105 | 3300005355 | Ga0070671_100064999 | Ga0070671_1000649993 | 227 |
| 106 | 3300005364 | Ga0070673_100017428 | Ga0070673_1000174282 | 227 |
| 107 | 3300005367 | Ga0070667_100233718 | Ga0070667_1002337182 | 227 |
| 108 | 3300005456 | Ga0070678_100325411 | Ga0070678_1003254112 | 227 |
| 109 | 3300005459 | Ga0068867_100011474 | Ga0068867_1000114745 | 227 |
| 110 | 3300005543 | Ga0070672_100008701 | Ga0070672_1000087012 | 227 |
| 111 | 3300005577 | Ga0068857_100021744 | Ga0068857_1000217442 | 227 |
| 112 | 3300005840 | Ga0068870_10151148 | Ga0068870_101511482 | 227 |
| 113 | 3300006195 | Ga0075366_10112370 | Ga0075366_101123702 | 227 |
| 114 | 3300009098 | Ga0105245_10332560 | Ga0105245_103325602 | 227 |
| 115 | 3300009148 | Ga0105243_10129069 | Ga0105243_101290692 | 227 |
| 116 | 3300011119 | Ga0105246_10532784 | Ga0105246_105327842 | 227 |
| 117 | 3300013308 | Ga0157375_10081183 | Ga0157375_100811833 | 227 |
| 118 | 3300014745 | Ga0157377_10101465 | Ga0157377_101014652 | 227 |
| 119 | 3300025893 | Ga0207682_10152967 | Ga0207682_101529671 | 227 |
| 120 | 3300025907 | Ga0207645_10012245 | Ga0207645_100122452 | 227 |
| 121 | 3300025925 | Ga0207650_10380458 | Ga0207650_103804582 | 227 |
| 122 | 3300025931 | Ga0207644_10140330 | Ga0207644_101403302 | 227 |
| 123 | 3300025942 | Ga0207689_10040238 | Ga0207689_100402382 | 227 |
| 124 | 3300025960 | Ga0207651_10198630 | Ga0207651_101986301 | 227 |
| 125 | 3300026089 | Ga0207648_10006265 | Ga0207648_100062656 | 227 |
| 126 | 3300026116 | Ga0207674_10004884 | Ga0207674_100048849 | 227 |
| 127 | 3300026121 | Ga0207683_10180626 | Ga0207683_101806262 | 227 |
| 128 | 3300031616 | Ga0307508_10284445 | Ga0307508_102844452 | 227 |
| 129 | 3300046454 | Ga0495592_0001414 | Ga0495592_0001414_125_820 | 227 |
| 130 | 3300046460 | Ga0495638_0266130 | Ga0495638_0266130_48_770 | 227 |
| 131 | 3300046512 | Ga0495610_0114836 | Ga0495610_0114836_126_821 | 227 |
| 132 | 3300046513 | Ga0495616_0061881 | Ga0495616_0061881_467_1189 | 227 |
| 133 | 3300046528 | Ga0495642_0021404 | Ga0495642_0021404_743_1465 | 227 |
| 134 | 3300046691 | Ga0495670_0228320 | Ga0495670_0228320_255_953 | 227 |
| 135 | 3300046694 | Ga0495649_0023324 | Ga0495649_0023324_1911_2633 | 227 |
| 136 | 3300047443 | Ga0495687_006702 | Ga0495687_006702_3986_4708 | 227 |
| 137 | 3300050493 | nmdc:mga0k408_26927_c1 | nmdc:mga0k408_26927_c1_343_1065 | 227 |
| 138 | 3300053088 | Ga0500644_0048224 | Ga0500644_0048224_145_840 | 227 |
| 139 | 3300053093 | Ga0500651_0023491 | Ga0500651_0023491_203_898 | 227 |
| 140 | 3300053118 | Ga0500594_0002652 | Ga0500594_0002652_1287_1982 | 227 |
| 141 | 3300053134 | Ga0500658_0001540 | Ga0500658_0001540_5754_6476 | 227 |
| 142 | 3300053156 | Ga0500622_0008232 | Ga0500622_0008232_2443_3138 | 227 |
| 143 | 3300005440 | Ga0070705_100244985 | Ga0070705_1002449851 | 228 |
| 144 | 3300013306 | Ga0163162_10957503 | Ga0163162_109575031 | 228 |
| 145 | 3300014325 | Ga0163163_10490049 | Ga0163163_104900492 | 228 |
| 146 | 3300026067 | Ga0207678_10589009 | Ga0207678_105890092 | 228 |
| 147 | 3300050496 | nmdc:mga07m45_63808_c1 | nmdc:mga07m45_63808_c1_810_1532 | 228 |
| 148 | 3300005367 | Ga0070667_100041935 | Ga0070667_1000419352 | 229 |
| 149 | 3300006051 | Ga0075364_10032078 | Ga0075364_100320782 | 229 |
| 150 | 3300006871 | Ga0075434_100103406 | Ga0075434_1001034062 | 229 |
| 151 | 3300035086 | Ga0373934_0037371 | Ga0373934_0037371_736_1431 | 229 |
| 152 | 3300035118 | Ga0373954_0000008 | Ga0373954_0000008_38506_39201 | 229 |
| 153 | 3300035724 | Ga0373933_0001883 | Ga0373933_0001883_1081_1776 | 229 |
| 154 | 3300036401 | Ga0373937_0000551 | Ga0373937_0000551_31737_32432 | 229 |
| 155 | 3300045976 | Ga0466967_0269183 | Ga0466967_0269183_173_877 | 229 |
| 156 | 3300046559 | Ga0495667_0302690 | Ga0495667_0302690_83_778 | 229 |
| 157 | 3300048088 | Ga0495602_0590210 | Ga0495602_0590210_42_737 | 229 |
| 158 | 3300050507 | nmdc:mga05p37_13321_c1 | nmdc:mga05p37_13321_c1_5974_6663 | 229 |
| 159 | 3300050509 | nmdc:mga0qj67_1083_c1 | nmdc:mga0qj67_1083_c1_10801_11490 | 229 |
| 160 | 3300050510 | nmdc:mga06r32_149545_c1 | nmdc:mga06r32_149545_c1_247_936 | 229 |
| 161 | 3300005458 | Ga0070681_10042378 | Ga0070681_100423785 | 230 |
| 162 | 3300006038 | Ga0075365_10149458 | Ga0075365_101494582 | 230 |
| 163 | 3300006042 | Ga0075368_10024335 | Ga0075368_100243352 | 230 |
| 164 | 3300006048 | Ga0075363_100010458 | Ga0075363_1000104583 | 230 |
| 165 | 3300006051 | Ga0075364_10085608 | Ga0075364_100856083 | 230 |
| 166 | 3300006178 | Ga0075367_10014095 | Ga0075367_100140955 | 230 |
| 167 | 3300006195 | Ga0075366_10166304 | Ga0075366_101663042 | 230 |
| 168 | 3300006353 | Ga0075370_10000316 | Ga0075370_100003166 | 230 |
| 169 | 3300006353 | Ga0075370_10094823 | Ga0075370_100948232 | 230 |
| 170 | 3300050489 | nmdc:mga03683_109201_c1 | nmdc:mga03683_109201_c1_28_744 | 230 |
| 171 | 3300050493 | nmdc:mga0k408_3366_c1 | nmdc:mga0k408_3366_c1_673_1389 | 230 |
| 172 | 3300050496 | nmdc:mga07m45_1246_c1 | nmdc:mga07m45_1246_c1_7287_8003 | 230 |
| 173 | 3300050496 | nmdc:mga07m45_9134_c1 | nmdc:mga07m45_9134_c1_3452_4168 | 230 |
| 174 | 3300013308 | Ga0157375_10508793 | Ga0157375_105087931 | 231 |
| 175 | 3300050496 | nmdc:mga07m45_27321_c1 | nmdc:mga07m45_27321_c1_830_1525 | 231 |
| 176 | 3300003322 | rootL2_10255016 | rootL2_102550162 | 232 |
| 177 | 3300005327 | Ga0070658_10250367 | Ga0070658_102503672 | 232 |
| 178 | 3300005328 | Ga0070676_10012434 | Ga0070676_100124343 | 232 |
| 179 | 3300005328 | Ga0070676_10400447 | Ga0070676_104004471 | 232 |
| 180 | 3300005329 | Ga0070683_100433739 | Ga0070683_1004337392 | 232 |
| 181 | 3300005330 | Ga0070690_100014288 | Ga0070690_1000142882 | 232 |
| 182 | 3300005331 | Ga0070670_100003234 | Ga0070670_1000032342 | 232 |
| 183 | 3300005331 | Ga0070670_100192388 | Ga0070670_1001923883 | 232 |
| 184 | 3300005331 | Ga0070670_100373356 | Ga0070670_1003733562 | 232 |
| 185 | 3300005331 | Ga0070670_100470730 | Ga0070670_1004707302 | 232 |
| 186 | 3300005333 | Ga0070677_10086747 | Ga0070677_100867471 | 232 |
| 187 | 3300005333 | Ga0070677_10110053 | Ga0070677_101100532 | 232 |
| 188 | 3300005334 | Ga0068869_100046767 | Ga0068869_1000467673 | 232 |
| 189 | 3300005335 | Ga0070666_10119007 | Ga0070666_101190073 | 232 |
| 190 | 3300005338 | Ga0068868_100053541 | Ga0068868_1000535412 | 232 |
| 191 | 3300005338 | Ga0068868_100295500 | Ga0068868_1002955002 | 232 |
| 192 | 3300005338 | Ga0068868_100330539 | Ga0068868_1003305392 | 232 |
| 193 | 3300005338 | Ga0068868_100413825 | Ga0068868_1004138252 | 232 |
| 194 | 3300005338 | Ga0068868_100774319 | Ga0068868_1007743191 | 232 |
| 195 | 3300005340 | Ga0070689_100339561 | Ga0070689_1003395612 | 232 |
| 196 | 3300005343 | Ga0070687_100008435 | Ga0070687_1000084353 | 232 |
| 197 | 3300005344 | Ga0070661_100246817 | Ga0070661_1002468171 | 232 |
| 198 | 3300005344 | Ga0070661_100277419 | Ga0070661_1002774191 | 232 |
| 199 | 3300005344 | Ga0070661_100358379 | Ga0070661_1003583791 | 232 |
| 200 | 3300005344 | Ga0070661_100491884 | Ga0070661_1004918841 | 232 |
| 201 | 3300005347 | Ga0070668_100021760 | Ga0070668_1000217604 | 232 |
| 202 | 3300005353 | Ga0070669_100041375 | Ga0070669_1000413753 | 232 |
| 203 | 3300005353 | Ga0070669_100385520 | Ga0070669_1003855202 | 232 |
| 204 | 3300005353 | Ga0070669_100537148 | Ga0070669_1005371482 | 232 |
| 205 | 3300005354 | Ga0070675_100027407 | Ga0070675_1000274076 | 232 |
| 206 | 3300005354 | Ga0070675_100111354 | Ga0070675_1001113542 | 232 |
| 207 | 3300005354 | Ga0070675_100260899 | Ga0070675_1002608992 | 232 |
| 208 | 3300005355 | Ga0070671_100000534 | Ga0070671_1000005349 | 232 |
| 209 | 3300005355 | Ga0070671_100131678 | Ga0070671_1001316783 | 232 |
| 210 | 3300005355 | Ga0070671_100134558 | Ga0070671_1001345582 | 232 |
| 211 | 3300005356 | Ga0070674_100008544 | Ga0070674_1000085444 | 232 |
| 212 | 3300005356 | Ga0070674_100076398 | Ga0070674_1000763982 | 232 |
| 213 | 3300005364 | Ga0070673_100222868 | Ga0070673_1002228682 | 232 |
| 214 | 3300005364 | Ga0070673_100266373 | Ga0070673_1002663732 | 232 |
| 215 | 3300005367 | Ga0070667_100066886 | Ga0070667_1000668863 | 232 |
| 216 | 3300005367 | Ga0070667_100360376 | Ga0070667_1003603762 | 232 |
| 217 | 3300005441 | Ga0070700_100022547 | Ga0070700_1000225472 | 232 |
| 218 | 3300005456 | Ga0070678_100077289 | Ga0070678_1000772892 | 232 |
| 219 | 3300005456 | Ga0070678_100077608 | Ga0070678_1000776082 | 232 |
| 220 | 3300005456 | Ga0070678_100086348 | Ga0070678_1000863482 | 232 |
| 221 | 3300005456 | Ga0070678_100145965 | Ga0070678_1001459652 | 232 |
| 222 | 3300005457 | Ga0070662_100190825 | Ga0070662_1001908252 | 232 |
| 223 | 3300005459 | Ga0068867_100047355 | Ga0068867_1000473552 | 232 |
| 224 | 3300005459 | Ga0068867_100133746 | Ga0068867_1001337462 | 232 |
| 225 | 3300005459 | Ga0068867_100259332 | Ga0068867_1002593322 | 232 |
| 226 | 3300005467 | Ga0070706_100041084 | Ga0070706_1000410846 | 232 |
| 227 | 3300005543 | Ga0070672_100014712 | Ga0070672_1000147124 | 232 |
| 228 | 3300005543 | Ga0070672_100031397 | Ga0070672_1000313973 | 232 |
| 229 | 3300005543 | Ga0070672_100071450 | Ga0070672_1000714503 | 232 |
| 230 | 3300005543 | Ga0070672_100088994 | Ga0070672_1000889943 | 232 |
| 231 | 3300005543 | Ga0070672_100120221 | Ga0070672_1001202213 | 232 |
| 232 | 3300005543 | Ga0070672_100265119 | Ga0070672_1002651192 | 232 |
| 233 | 3300005544 | Ga0070686_100324488 | Ga0070686_1003244882 | 232 |
| 234 | 3300005564 | Ga0070664_100194983 | Ga0070664_1001949832 | 232 |
| 235 | 3300005564 | Ga0070664_100468118 | Ga0070664_1004681182 | 232 |
| 236 | 3300005564 | Ga0070664_100780557 | Ga0070664_1007805571 | 232 |
| 237 | 3300005616 | Ga0068852_100029432 | Ga0068852_1000294322 | 232 |
| 238 | 3300005616 | Ga0068852_100033531 | Ga0068852_1000335314 | 232 |
| 239 | 3300005616 | Ga0068852_100148014 | Ga0068852_1001480142 | 232 |
| 240 | 3300005616 | Ga0068852_100493193 | Ga0068852_1004931932 | 232 |
| 241 | 3300005616 | Ga0068852_100522214 | Ga0068852_1005222142 | 232 |
| 242 | 3300005618 | Ga0068864_100063190 | Ga0068864_1000631903 | 232 |
| 243 | 3300005618 | Ga0068864_100128335 | Ga0068864_1001283352 | 232 |
| 244 | 3300005618 | Ga0068864_100324052 | Ga0068864_1003240522 | 232 |
| 245 | 3300005618 | Ga0068864_100375893 | Ga0068864_1003758931 | 232 |
| 246 | 3300005718 | Ga0068866_10124415 | Ga0068866_101244152 | 232 |
| 247 | 3300005719 | Ga0068861_100022892 | Ga0068861_1000228924 | 232 |
| 248 | 3300005834 | Ga0068851_10148281 | Ga0068851_101482812 | 232 |
| 249 | 3300005834 | Ga0068851_10162752 | Ga0068851_101627522 | 232 |
| 250 | 3300005841 | Ga0068863_100235834 | Ga0068863_1002358342 | 232 |
| 251 | 3300005842 | Ga0068858_100014061 | Ga0068858_1000140617 | 232 |
| 252 | 3300005843 | Ga0068860_100034758 | Ga0068860_1000347583 | 232 |
| 253 | 3300005844 | Ga0068862_100100406 | Ga0068862_1001004062 | 232 |
| 254 | 3300006038 | Ga0075365_10024694 | Ga0075365_100246942 | 232 |
| 255 | 3300006042 | Ga0075368_10189906 | Ga0075368_101899061 | 232 |
| 256 | 3300006048 | Ga0075363_100005382 | Ga0075363_1000053825 | 232 |
| 257 | 3300006173 | Ga0070716_100168011 | Ga0070716_1001680112 | 232 |
| 258 | 3300006178 | Ga0075367_10009541 | Ga0075367_100095414 | 232 |
| 259 | 3300006195 | Ga0075366_10004224 | Ga0075366_100042244 | 232 |
| 260 | 3300006237 | Ga0097621_100026616 | Ga0097621_1000266164 | 232 |
| 261 | 3300006353 | Ga0075370_10000379 | Ga0075370_100003796 | 232 |
| 262 | 3300006353 | Ga0075370_10003355 | Ga0075370_100033555 | 232 |
| 263 | 3300006358 | Ga0068871_100032976 | Ga0068871_1000329764 | 232 |
| 264 | 3300006881 | Ga0068865_100211823 | Ga0068865_1002118232 | 232 |
| 265 | 3300009094 | Ga0111539_10431901 | Ga0111539_104319012 | 232 |
| 266 | 3300009148 | Ga0105243_10057538 | Ga0105243_100575382 | 232 |
| 267 | 3300009148 | Ga0105243_10231385 | Ga0105243_102313852 | 232 |
| 268 | 3300009148 | Ga0105243_10720840 | Ga0105243_107208402 | 232 |
| 269 | 3300009176 | Ga0105242_10114117 | Ga0105242_101141172 | 232 |
| 270 | 3300009176 | Ga0105242_10286534 | Ga0105242_102865342 | 232 |
| 271 | 3300009177 | Ga0105248_10040445 | Ga0105248_100404453 | 232 |
| 272 | 3300009177 | Ga0105248_10111124 | Ga0105248_101111243 | 232 |
| 273 | 3300009177 | Ga0105248_10219991 | Ga0105248_102199911 | 232 |
| 274 | 3300009545 | Ga0105237_10000958 | Ga0105237_100009589 | 232 |
| 275 | 3300009551 | Ga0105238_10400253 | Ga0105238_104002532 | 232 |
| 276 | 3300009553 | Ga0105249_10086361 | Ga0105249_100863613 | 232 |
| 277 | 3300009553 | Ga0105249_10196195 | Ga0105249_101961952 | 232 |
| 278 | 3300010375 | Ga0105239_10006535 | Ga0105239_1000653511 | 232 |
| 279 | 3300013296 | Ga0157374_10111272 | Ga0157374_101112722 | 232 |
| 280 | 3300013297 | Ga0157378_10130216 | Ga0157378_101302162 | 232 |
| 281 | 3300013306 | Ga0163162_10037061 | Ga0163162_100370613 | 232 |
| 282 | 3300013308 | Ga0157375_10029461 | Ga0157375_100294614 | 232 |
| 283 | 3300013308 | Ga0157375_10060766 | Ga0157375_100607663 | 232 |
| 284 | 3300014325 | Ga0163163_10191236 | Ga0163163_101912363 | 232 |
| 285 | 3300014325 | Ga0163163_10447942 | Ga0163163_104479422 | 232 |
| 286 | 3300014325 | Ga0163163_10893621 | Ga0163163_108936212 | 232 |
| 287 | 3300014326 | Ga0157380_10010673 | Ga0157380_100106734 | 232 |
| 288 | 3300014968 | Ga0157379_10034450 | Ga0157379_100344503 | 232 |
| 289 | 3300014968 | Ga0157379_10063043 | Ga0157379_100630433 | 232 |
| 290 | 3300014969 | Ga0157376_10052467 | Ga0157376_100524673 | 232 |
| 291 | 3300017792 | Ga0163161_10039177 | Ga0163161_100391773 | 232 |
| 292 | 3300017792 | Ga0163161_10101436 | Ga0163161_101014363 | 232 |
| 293 | 3300025315 | Ga0207697_10022863 | Ga0207697_100228631 | 232 |
| 294 | 3300025321 | Ga0207656_10051035 | Ga0207656_100510352 | 232 |
| 295 | 3300025893 | Ga0207682_10020370 | Ga0207682_100203702 | 232 |
| 296 | 3300025893 | Ga0207682_10032555 | Ga0207682_100325552 | 232 |
| 297 | 3300025893 | Ga0207682_10108555 | Ga0207682_101085552 | 232 |
| 298 | 3300025899 | Ga0207642_10120686 | Ga0207642_101206862 | 232 |
| 299 | 3300025903 | Ga0207680_10019990 | Ga0207680_100199904 | 232 |
| 300 | 3300025903 | Ga0207680_10216027 | Ga0207680_102160272 | 232 |
| 301 | 3300025907 | Ga0207645_10008823 | Ga0207645_100088237 | 232 |
| 302 | 3300025908 | Ga0207643_10035563 | Ga0207643_100355632 | 232 |
| 303 | 3300025909 | Ga0207705_10060137 | Ga0207705_100601372 | 232 |
| 304 | 3300025910 | Ga0207684_10006858 | Ga0207684_100068581 | 232 |
| 305 | 3300025914 | Ga0207671_10004831 | Ga0207671_1000483113 | 232 |
| 306 | 3300025918 | Ga0207662_10005876 | Ga0207662_100058764 | 232 |
| 307 | 3300025919 | Ga0207657_10158794 | Ga0207657_101587942 | 232 |
| 308 | 3300025920 | Ga0207649_10170212 | Ga0207649_101702122 | 232 |
| 309 | 3300025923 | Ga0207681_10187604 | Ga0207681_101876042 | 232 |
| 310 | 3300025923 | Ga0207681_10213368 | Ga0207681_102133682 | 232 |
| 311 | 3300025925 | Ga0207650_10003667 | Ga0207650_1000366710 | 232 |
| 312 | 3300025925 | Ga0207650_10062595 | Ga0207650_100625953 | 232 |
| 313 | 3300025925 | Ga0207650_10258297 | Ga0207650_102582972 | 232 |
| 314 | 3300025926 | Ga0207659_10013906 | Ga0207659_100139067 | 232 |
| 315 | 3300025926 | Ga0207659_10024080 | Ga0207659_100240803 | 232 |
| 316 | 3300025926 | Ga0207659_10111283 | Ga0207659_101112832 | 232 |
| 317 | 3300025931 | Ga0207644_10000360 | Ga0207644_1000036020 | 232 |
| 318 | 3300025931 | Ga0207644_10024980 | Ga0207644_100249802 | 232 |
| 319 | 3300025931 | Ga0207644_10286181 | Ga0207644_102861812 | 232 |
| 320 | 3300025933 | Ga0207706_10078331 | Ga0207706_100783313 | 232 |
| 321 | 3300025934 | Ga0207686_10058342 | Ga0207686_100583422 | 232 |
| 322 | 3300025934 | Ga0207686_10120280 | Ga0207686_101202802 | 232 |
| 323 | 3300025935 | Ga0207709_10028538 | Ga0207709_100285383 | 232 |
| 324 | 3300025935 | Ga0207709_10262823 | Ga0207709_102628231 | 232 |
| 325 | 3300025936 | Ga0207670_10258672 | Ga0207670_102586722 | 232 |
| 326 | 3300025937 | Ga0207669_10029992 | Ga0207669_100299922 | 232 |
| 327 | 3300025939 | Ga0207665_10157952 | Ga0207665_101579522 | 232 |
| 328 | 3300025940 | Ga0207691_10002225 | Ga0207691_1000222517 | 232 |
| 329 | 3300025940 | Ga0207691_10026718 | Ga0207691_100267184 | 232 |
| 330 | 3300025940 | Ga0207691_10075841 | Ga0207691_100758414 | 232 |
| 331 | 3300025940 | Ga0207691_10179193 | Ga0207691_101791932 | 232 |
| 332 | 3300025940 | Ga0207691_10194949 | Ga0207691_101949492 | 232 |
| 333 | 3300025941 | Ga0207711_10012084 | Ga0207711_100120847 | 232 |
| 334 | 3300025941 | Ga0207711_10068738 | Ga0207711_100687383 | 232 |
| 335 | 3300025942 | Ga0207689_10008764 | Ga0207689_100087648 | 232 |
| 336 | 3300025945 | Ga0207679_10331541 | Ga0207679_103315412 | 232 |
| 337 | 3300025945 | Ga0207679_10462990 | Ga0207679_104629902 | 232 |
| 338 | 3300025960 | Ga0207651_10182923 | Ga0207651_101829232 | 232 |
| 339 | 3300025961 | Ga0207712_10041716 | Ga0207712_100417163 | 232 |
| 340 | 3300025961 | Ga0207712_10042191 | Ga0207712_100421912 | 232 |
| 341 | 3300025961 | Ga0207712_10344183 | Ga0207712_103441832 | 232 |
| 342 | 3300025972 | Ga0207668_10014922 | Ga0207668_100149222 | 232 |
| 343 | 3300025986 | Ga0207658_10015968 | Ga0207658_100159684 | 232 |
| 344 | 3300026023 | Ga0207677_10075883 | Ga0207677_100758832 | 232 |
| 345 | 3300026023 | Ga0207677_10103839 | Ga0207677_101038392 | 232 |
| 346 | 3300026035 | Ga0207703_10016405 | Ga0207703_100164054 | 232 |
| 347 | 3300026041 | Ga0207639_10221187 | Ga0207639_102211872 | 232 |
| 348 | 3300026067 | Ga0207678_10067290 | Ga0207678_100672903 | 232 |
| 349 | 3300026075 | Ga0207708_10019575 | Ga0207708_100195754 | 232 |
| 350 | 3300026088 | Ga0207641_10024652 | Ga0207641_100246524 | 232 |
| 351 | 3300026088 | Ga0207641_10244169 | Ga0207641_102441692 | 232 |
| 352 | 3300026089 | Ga0207648_10017650 | Ga0207648_100176502 | 232 |
| 353 | 3300026089 | Ga0207648_10086539 | Ga0207648_100865394 | 232 |
| 354 | 3300026095 | Ga0207676_10053196 | Ga0207676_100531963 | 232 |
| 355 | 3300026095 | Ga0207676_10153757 | Ga0207676_101537572 | 232 |
| 356 | 3300026095 | Ga0207676_10184776 | Ga0207676_101847762 | 232 |
| 357 | 3300026095 | Ga0207676_10303559 | Ga0207676_103035592 | 232 |
| 358 | 3300026118 | Ga0207675_100005117 | Ga0207675_10000511712 | 232 |
| 359 | 3300026121 | Ga0207683_10110011 | Ga0207683_101100112 | 232 |
| 360 | 3300026121 | Ga0207683_10134907 | Ga0207683_101349072 | 232 |
| 361 | 3300026121 | Ga0207683_10156058 | Ga0207683_101560583 | 232 |
| 362 | 3300026121 | Ga0207683_10332643 | Ga0207683_103326432 | 232 |
| 363 | 3300026121 | Ga0207683_10518567 | Ga0207683_105185671 | 232 |
| 364 | 3300026142 | Ga0207698_10059527 | Ga0207698_100595272 | 232 |
| 365 | 3300026142 | Ga0207698_10102215 | Ga0207698_101022152 | 232 |
| 366 | 3300026142 | Ga0207698_10335401 | Ga0207698_103354012 | 232 |
| 367 | 3300026142 | Ga0207698_10352329 | Ga0207698_103523292 | 232 |
| 368 | 3300026142 | Ga0207698_10528706 | Ga0207698_105287061 | 232 |
| 369 | 3300027876 | Ga0209974_10017294 | Ga0209974_100172942 | 232 |
| 370 | 3300028380 | Ga0268265_10028550 | Ga0268265_100285502 | 232 |
| 371 | 3300028381 | Ga0268264_10033475 | Ga0268264_100334753 | 232 |
| 372 | 3300035118 | Ga0373954_0102464 | Ga0373954_0102464_141_881 | 232 |
| 373 | 3300035119 | Ga0373956_0112478 | Ga0373956_0112478_184_924 | 232 |
| 374 | 3300035170 | Ga0373943_0109302 | Ga0373943_0109302_502_1242 | 232 |
| 375 | 3300035171 | Ga0373946_0103217 | Ga0373946_0103217_174_914 | 232 |
| 376 | 3300035692 | Ga0373935_0102430 | Ga0373935_0102430_560_1300 | 232 |
| 377 | 3300035695 | Ga0373927_0255811 | Ga0373927_0255811_297_1037 | 232 |
| 378 | 3300035695 | Ga0373927_0260354 | Ga0373927_0260354_54_767 | 232 |
| 379 | 3300035724 | Ga0373933_0221824 | Ga0373933_0221824_408_1148 | 232 |
| 380 | 3300035724 | Ga0373933_0447879 | Ga0373933_0447879_97_819 | 232 |
| 381 | 3300036401 | Ga0373937_0417423 | Ga0373937_0417423_105_845 | 232 |
| 382 | 3300046455 | Ga0495603_0152287 | Ga0495603_0152287_560_1300 | 232 |
| 383 | 3300046459 | Ga0495629_0242866 | Ga0495629_0242866_83_823 | 232 |
| 384 | 3300046473 | Ga0495582_0040706 | Ga0495582_0040706_969_1709 | 232 |
| 385 | 3300046507 | Ga0495606_0028883 | Ga0495606_0028883_2246_2962 | 232 |
| 386 | 3300046511 | Ga0495608_0234906 | Ga0495608_0234906_143_871 | 232 |
| 387 | 3300046524 | Ga0495648_0000833 | Ga0495648_0000833_26908_27624 | 232 |
| 388 | 3300046535 | Ga0495586_0190872 | Ga0495586_0190872_296_1036 | 232 |
| 389 | 3300046543 | Ga0495645_0018188 | Ga0495645_0018188_901_1641 | 232 |
| 390 | 3300046616 | Ga0495668_0018534 | Ga0495668_0018534_2447_3163 | 232 |
| 391 | 3300046679 | Ga0495623_0273696 | Ga0495623_0273696_12_752 | 232 |
| 392 | 3300046681 | Ga0495647_0089514 | Ga0495647_0089514_474_1214 | 232 |
| 393 | 3300046683 | Ga0495658_0021873 | Ga0495658_0021873_2031_2753 | 232 |
| 394 | 3300046683 | Ga0495658_0037987 | Ga0495658_0037987_320_1060 | 232 |
| 395 | 3300046689 | Ga0495613_0129227 | Ga0495613_0129227_143_883 | 232 |
| 396 | 3300047320 | Ga0495672_0001133 | Ga0495672_0001133_22426_23142 | 232 |
| 397 | 3300047469 | Ga0495673_0000856 | Ga0495673_0000856_17818_18534 | 232 |
| 398 | 3300048903 | Ga0496100_0006224 | Ga0496100_0006224_1312_2028 | 232 |
| 399 | 3300048904 | Ga0496101_0000026 | Ga0496101_0000026_50235_50951 | 232 |
| 400 | 3300048905 | Ga0496102_0000031 | Ga0496102_0000031_51403_52119 | 232 |
| 401 | 3300048906 | Ga0496103_0000025 | Ga0496103_0000025_50211_50927 | 232 |
| 402 | 3300048909 | Ga0496106_0016267 | Ga0496106_0016267_1344_2060 | 232 |
| 403 | 3300048910 | Ga0496107_0016047 | Ga0496107_0016047_875_1591 | 232 |
| 404 | 3300048911 | Ga0496108_0141037 | Ga0496108_0141037_429_1157 | 232 |
| 405 | 3300048912 | Ga0496109_0098714 | Ga0496109_0098714_575_1297 | 232 |
| 406 | 3300048917 | Ga0496114_0035499 | Ga0496114_0035499_1636_2376 | 232 |
| 407 | 3300048919 | Ga0496116_0000084 | Ga0496116_0000084_167484_168200 | 232 |
| 408 | 3300048920 | Ga0496117_0000018 | Ga0496117_0000018_169480_170196 | 232 |
| 409 | 3300048921 | Ga0496118_0000013 | Ga0496118_0000013_309418_310134 | 232 |
| 410 | 3300048922 | Ga0496119_0020835 | Ga0496119_0020835_2777_3493 | 232 |
| 411 | 3300048922 | Ga0496119_0032380 | Ga0496119_0032380_1657_2373 | 232 |
| 412 | 3300048923 | Ga0496120_0012709 | Ga0496120_0012709_664_1380 | 232 |
| 413 | 3300048924 | Ga0496121_0000056 | Ga0496121_0000056_50276_50992 | 232 |
| 414 | 3300048929 | Ga0496126_0000089 | Ga0496126_0000089_125252_125968 | 232 |
| 415 | 3300049591 | Ga0501075_0167270 | Ga0501075_0167270_374_1093 | 232 |
| 416 | 3300050493 | nmdc:mga0k408_104669_c1 | nmdc:mga0k408_104669_c1_664_1386 | 232 |
| 417 | 3300050494 | nmdc:mga06z11_128152_c1 | nmdc:mga06z11_128152_c1_386_1114 | 232 |
| 418 | 3300050496 | nmdc:mga07m45_35155_c1 | nmdc:mga07m45_35155_c1_817_1539 | 232 |
| 419 | 3300050496 | nmdc:mga07m45_4005_c1 | nmdc:mga07m45_4005_c1_2833_3555 | 232 |
| 420 | 3300053077 | Ga0495601_0025287 | Ga0495601_0025287_2192_2914 | 232 |
| 421 | 3300053077 | Ga0495601_0256133 | Ga0495601_0256133_384_1124 | 232 |
| 422 | iso_pu_bacteria | 2902837492 | 2902841208 | 232 |
| 423 | 3300005328 | Ga0070676_10040160 | Ga0070676_100401603 | 233 |
| 424 | 3300005329 | Ga0070683_100141715 | Ga0070683_1001417152 | 233 |
| 425 | 3300005329 | Ga0070683_100213280 | Ga0070683_1002132802 | 233 |
| 426 | 3300005336 | Ga0070680_100148058 | Ga0070680_1001480583 | 233 |
| 427 | 3300005337 | Ga0070682_100194963 | Ga0070682_1001949632 | 233 |
| 428 | 3300005344 | Ga0070661_100032687 | Ga0070661_1000326873 | 233 |
| 429 | 3300005344 | Ga0070661_100075252 | Ga0070661_1000752522 | 233 |
| 430 | 3300005353 | Ga0070669_100157601 | Ga0070669_1001576012 | 233 |
| 431 | 3300005354 | Ga0070675_100131352 | Ga0070675_1001313523 | 233 |
| 432 | 3300005355 | Ga0070671_100016856 | Ga0070671_1000168564 | 233 |
| 433 | 3300005366 | Ga0070659_100004663 | Ga0070659_10000466311 | 233 |
| 434 | 3300005367 | Ga0070667_100097031 | Ga0070667_1000970312 | 233 |
| 435 | 3300005438 | Ga0070701_10143547 | Ga0070701_101435471 | 233 |
| 436 | 3300005455 | Ga0070663_100061684 | Ga0070663_1000616842 | 233 |
| 437 | 3300005457 | Ga0070662_100003483 | Ga0070662_1000034832 | 233 |
| 438 | 3300005467 | Ga0070706_100008756 | Ga0070706_1000087565 | 233 |
| 439 | 3300005468 | Ga0070707_100361326 | Ga0070707_1003613262 | 233 |
| 440 | 3300005471 | Ga0070698_100007972 | Ga0070698_1000079725 | 233 |
| 441 | 3300005471 | Ga0070698_100022409 | Ga0070698_1000224092 | 233 |
| 442 | 3300005535 | Ga0070684_100720571 | Ga0070684_1007205711 | 233 |
| 443 | 3300005536 | Ga0070697_100019641 | Ga0070697_1000196414 | 233 |
| 444 | 3300005539 | Ga0068853_100053645 | Ga0068853_1000536453 | 233 |
| 445 | 3300005548 | Ga0070665_100612577 | Ga0070665_1006125772 | 233 |
| 446 | 3300005563 | Ga0068855_100306222 | Ga0068855_1003062222 | 233 |
| 447 | 3300005577 | Ga0068857_100020115 | Ga0068857_1000201153 | 233 |
| 448 | 3300005577 | Ga0068857_100109216 | Ga0068857_1001092162 | 233 |
| 449 | 3300005578 | Ga0068854_100206891 | Ga0068854_1002068912 | 233 |
| 450 | 3300005614 | Ga0068856_100004930 | Ga0068856_1000049308 | 233 |
| 451 | 3300005616 | Ga0068852_100095681 | Ga0068852_1000956813 | 233 |
| 452 | 3300005617 | Ga0068859_100864943 | Ga0068859_1008649432 | 233 |
| 453 | 3300005719 | Ga0068861_100103441 | Ga0068861_1001034412 | 233 |
| 454 | 3300005834 | Ga0068851_10013041 | Ga0068851_100130413 | 233 |
| 455 | 3300005834 | Ga0068851_10102310 | Ga0068851_101023102 | 233 |
| 456 | 3300005841 | Ga0068863_100421627 | Ga0068863_1004216272 | 233 |
| 457 | 3300005841 | Ga0068863_100450291 | Ga0068863_1004502912 | 233 |
| 458 | 3300005843 | Ga0068860_100033557 | Ga0068860_1000335573 | 233 |
| 459 | 3300006846 | Ga0075430_100000248 | Ga0075430_10000024826 | 233 |
| 460 | 3300006847 | Ga0075431_100001170 | Ga0075431_1000011702 | 233 |
| 461 | 3300006852 | Ga0075433_10002300 | Ga0075433_100023005 | 233 |
| 462 | 3300006871 | Ga0075434_100044336 | Ga0075434_1000443363 | 233 |
| 463 | 3300006880 | Ga0075429_100000001 | Ga0075429_10000000128 | 233 |
| 464 | 3300006914 | Ga0075436_100139808 | Ga0075436_1001398082 | 233 |
| 465 | 3300006931 | Ga0097620_100864956 | Ga0097620_1008649562 | 233 |
| 466 | 3300007076 | Ga0075435_100189751 | Ga0075435_1001897512 | 233 |
| 467 | 3300009098 | Ga0105245_10276799 | Ga0105245_102767992 | 233 |
| 468 | 3300009147 | Ga0114129_10151673 | Ga0114129_101516733 | 233 |
| 469 | 3300009147 | Ga0114129_10265788 | Ga0114129_102657883 | 233 |
| 470 | 3300009551 | Ga0105238_10137813 | Ga0105238_101378133 | 233 |
| 471 | 3300013100 | Ga0157373_10060659 | Ga0157373_100606592 | 233 |
| 472 | 3300013104 | Ga0157370_10181792 | Ga0157370_101817922 | 233 |
| 473 | 3300013296 | Ga0157374_10308977 | Ga0157374_103089772 | 233 |
| 474 | 3300013307 | Ga0157372_10007234 | Ga0157372_100072349 | 233 |
| 475 | 3300013308 | Ga0157375_10051348 | Ga0157375_100513483 | 233 |
| 476 | 3300014326 | Ga0157380_10161708 | Ga0157380_101617082 | 233 |
| 477 | 3300014745 | Ga0157377_10069435 | Ga0157377_100694352 | 233 |
| 478 | 3300014968 | Ga0157379_10007204 | Ga0157379_100072042 | 233 |
| 479 | 3300014968 | Ga0157379_10114488 | Ga0157379_101144883 | 233 |
| 480 | 3300014969 | Ga0157376_10105671 | Ga0157376_101056713 | 233 |
| 481 | 3300017792 | Ga0163161_10058711 | Ga0163161_100587113 | 233 |
| 482 | 3300025893 | Ga0207682_10089295 | Ga0207682_100892952 | 233 |
| 483 | 3300025901 | Ga0207688_10101630 | Ga0207688_101016303 | 233 |
| 484 | 3300025907 | Ga0207645_10029751 | Ga0207645_100297513 | 233 |
| 485 | 3300025910 | Ga0207684_10047347 | Ga0207684_100473472 | 233 |
| 486 | 3300025910 | Ga0207684_10314099 | Ga0207684_103140991 | 233 |
| 487 | 3300025917 | Ga0207660_10107561 | Ga0207660_101075612 | 233 |
| 488 | 3300025919 | Ga0207657_10051810 | Ga0207657_100518103 | 233 |
| 489 | 3300025921 | Ga0207652_10041922 | Ga0207652_100419222 | 233 |
| 490 | 3300025922 | Ga0207646_10003828 | Ga0207646_100038286 | 233 |
| 491 | 3300025926 | Ga0207659_10100152 | Ga0207659_101001522 | 233 |
| 492 | 3300025931 | Ga0207644_10005934 | Ga0207644_100059347 | 233 |
| 493 | 3300025932 | Ga0207690_10075785 | Ga0207690_100757852 | 233 |
| 494 | 3300025933 | Ga0207706_10029157 | Ga0207706_100291573 | 233 |
| 495 | 3300025940 | Ga0207691_10007668 | Ga0207691_100076689 | 233 |
| 496 | 3300025942 | Ga0207689_10002313 | Ga0207689_1000231317 | 233 |
| 497 | 3300025944 | Ga0207661_10337522 | Ga0207661_103375222 | 233 |
| 498 | 3300025945 | Ga0207679_10191127 | Ga0207679_101911272 | 233 |
| 499 | 3300026035 | Ga0207703_10065929 | Ga0207703_100659292 | 233 |
| 500 | 3300026035 | Ga0207703_10200556 | Ga0207703_102005562 | 233 |
| 501 | 3300026041 | Ga0207639_10060734 | Ga0207639_100607343 | 233 |
| 502 | 3300026067 | Ga0207678_10045486 | Ga0207678_100454863 | 233 |
| 503 | 3300026088 | Ga0207641_10157530 | Ga0207641_101575302 | 233 |
| 504 | 3300026089 | Ga0207648_10665670 | Ga0207648_106656702 | 233 |
| 505 | 3300026095 | Ga0207676_10328670 | Ga0207676_103286702 | 233 |
| 506 | 3300026116 | Ga0207674_10022988 | Ga0207674_100229884 | 233 |
| 507 | 3300026116 | Ga0207674_10101455 | Ga0207674_101014552 | 233 |
| 508 | 3300026118 | Ga0207675_100003645 | Ga0207675_10000364512 | 233 |
| 509 | 3300026142 | Ga0207698_10150004 | Ga0207698_101500042 | 233 |
| 510 | 3300028379 | Ga0268266_10531913 | Ga0268266_105319132 | 233 |
| 511 | 3300031548 | Ga0307408_100240680 | Ga0307408_1002406802 | 233 |
| 512 | 3300031852 | Ga0307410_10157981 | Ga0307410_101579812 | 233 |
| 513 | 3300031903 | Ga0307407_10092469 | Ga0307407_100924692 | 233 |
| 514 | 3300031911 | Ga0307412_10026475 | Ga0307412_100264753 | 233 |
| 515 | 3300031995 | Ga0307409_100105829 | Ga0307409_1001058292 | 233 |
| 516 | 3300032002 | Ga0307416_100003176 | Ga0307416_1000031767 | 233 |
| 517 | 3300032005 | Ga0307411_10173873 | Ga0307411_101738732 | 233 |
| 518 | 3300032126 | Ga0307415_100137194 | Ga0307415_1001371943 | 233 |
| 519 | 3300035084 | Ga0373928_0055213 | Ga0373928_0055213_129_854 | 233 |
| 520 | 3300037312 | Ga0395899_0132320 | Ga0395899_0132320_664_1383 | 233 |
| 521 | 3300037418 | Ga0395900_0024502 | Ga0395900_0024502_678_1397 | 233 |
| 522 | 3300037466 | Ga0395898_0009183 | Ga0395898_0009183_2862_3581 | 233 |
| 523 | 3300038443 | Ga0395901_0035138 | Ga0395901_0035138_420_1139 | 233 |
| 524 | 3300039450 | Ga0436363_0460634 | Ga0436363_0460634_443_1144 | 233 |
| 525 | 3300045051 | Ga0451576_0553619 | Ga0451576_0553619_280_1002 | 233 |
| 526 | 3300048904 | Ga0496101_0066482 | Ga0496101_0066482_892_1617 | 233 |
| 527 | 3300048905 | Ga0496102_0262822 | Ga0496102_0262822_557_1282 | 233 |
| 528 | 3300048908 | Ga0496105_0215579 | Ga0496105_0215579_133_858 | 233 |
| 529 | 3300048909 | Ga0496106_0155013 | Ga0496106_0155013_147_872 | 233 |
| 530 | 3300048910 | Ga0496107_0110352 | Ga0496107_0110352_237_962 | 233 |
| 531 | 3300048915 | Ga0496112_0075635 | Ga0496112_0075635_513_1238 | 233 |
| 532 | 3300048917 | Ga0496114_0038925 | Ga0496114_0038925_217_942 | 233 |
| 533 | 3300048918 | Ga0496115_0229450 | Ga0496115_0229450_791_1516 | 233 |
| 534 | 3300050507 | nmdc:mga05p37_319019_c1 | nmdc:mga05p37_319019_c1_525_1241 | 233 |
| 535 | 3300050507 | nmdc:mga05p37_76654_c1 | nmdc:mga05p37_76654_c1_3196_3915 | 233 |
| 536 | 3300050508 | nmdc:mga09592_21395_c1 | nmdc:mga09592_21395_c1_347_1066 | 233 |
| 537 | 3300050509 | nmdc:mga0qj67_2840_c1 | nmdc:mga0qj67_2840_c1_8075_8794 | 233 |
| 538 | 3300050510 | nmdc:mga06r32_1957_c1 | nmdc:mga06r32_1957_c1_17441_18160 | 233 |
| 539 | 3300050512 | nmdc:mga0n895_11206_c1 | nmdc:mga0n895_11206_c1_4159_4875 | 233 |
| 540 | 3300050513 | nmdc:mga0rr50_177709_c1 | nmdc:mga0rr50_177709_c1_408_1124 | 233 |
| 541 | 3300050514 | nmdc:mga08x19_35324_c1 | nmdc:mga08x19_35324_c1_1864_2580 | 233 |
| 542 | 3300050515 | nmdc:mga0a205_185_c2 | nmdc:mga0a205_185_c2_22058_22774 | 233 |
| 543 | 3300053078 | Ga0495612_0075367 | Ga0495612_0075367_13_777 | 233 |
| 544 | 3300000545 | CNXas_1001378 | CNXas_10013782 | 234 |
| 545 | 3300003792 | Ga0055540_1002957 | Ga0055540_10029573 | 234 |
| 546 | 3300003792 | Ga0055540_1004305 | Ga0055540_10043056 | 234 |
| 547 | 3300005337 | Ga0070682_100230557 | Ga0070682_1002305572 | 234 |
| 548 | 3300005338 | Ga0068868_100149592 | Ga0068868_1001495922 | 234 |
| 549 | 3300005339 | Ga0070660_100361189 | Ga0070660_1003611892 | 234 |
| 550 | 3300005367 | Ga0070667_100332424 | Ga0070667_1003324242 | 234 |
| 551 | 3300005455 | Ga0070663_100088922 | Ga0070663_1000889223 | 234 |
| 552 | 3300005617 | Ga0068859_100804906 | Ga0068859_1008049061 | 234 |
| 553 | 3300005618 | Ga0068864_100244678 | Ga0068864_1002446782 | 234 |
| 554 | 3300005842 | Ga0068858_100019774 | Ga0068858_1000197747 | 234 |
| 555 | 3300006028 | Ga0070717_10368781 | Ga0070717_103687812 | 234 |
| 556 | 3300006048 | Ga0075363_100139819 | Ga0075363_1001398192 | 234 |
| 557 | 3300006173 | Ga0070716_100035964 | Ga0070716_1000359642 | 234 |
| 558 | 3300006186 | Ga0075369_10037718 | Ga0075369_100377182 | 234 |
| 559 | 3300006844 | Ga0075428_100001546 | Ga0075428_1000015468 | 234 |
| 560 | 3300006846 | Ga0075430_100006144 | Ga0075430_10000614410 | 234 |
| 561 | 3300006847 | Ga0075431_100219224 | Ga0075431_1002192242 | 234 |
| 562 | 3300006931 | Ga0097620_100805005 | Ga0097620_1008050051 | 234 |
| 563 | 3300009094 | Ga0111539_10666156 | Ga0111539_106661562 | 234 |
| 564 | 3300009147 | Ga0114129_10010984 | Ga0114129_1001098410 | 234 |
| 565 | 3300013307 | Ga0157372_10826900 | Ga0157372_108269002 | 234 |
| 566 | 3300025303 | Ga0209051_1001007 | Ga0209051_100100710 | 234 |
| 567 | 3300025303 | Ga0209051_1003186 | Ga0209051_10031867 | 234 |
| 568 | 3300025303 | Ga0209051_1053200 | Ga0209051_10532002 | 234 |
| 569 | 3300025900 | Ga0207710_10000056 | Ga0207710_1000005665 | 234 |
| 570 | 3300025923 | Ga0207681_10025799 | Ga0207681_100257992 | 234 |
| 571 | 3300025939 | Ga0207665_10135222 | Ga0207665_101352222 | 234 |
| 572 | 3300025981 | Ga0207640_10055476 | Ga0207640_100554762 | 234 |
| 573 | 3300025986 | Ga0207658_10204100 | Ga0207658_102041002 | 234 |
| 574 | 3300026035 | Ga0207703_10041922 | Ga0207703_100419222 | 234 |
| 575 | 3300026041 | Ga0207639_10089738 | Ga0207639_100897384 | 234 |
| 576 | 3300026067 | Ga0207678_10180056 | Ga0207678_101800562 | 234 |
| 577 | 3300026095 | Ga0207676_10828196 | Ga0207676_108281962 | 234 |
| 578 | 3300028379 | Ga0268266_10523804 | Ga0268266_105238042 | 234 |
| 579 | 3300048909 | Ga0496106_0421502 | Ga0496106_0421502_288_992 | 234 |
| 580 | 3300048914 | Ga0496111_0160002 | Ga0496111_0160002_925_1629 | 234 |
| 581 | 3300048915 | Ga0496112_0021084 | Ga0496112_0021084_2527_3231 | 234 |
| 582 | 3300050491 | nmdc:mga00v17_46657_c1 | nmdc:mga00v17_46657_c1_774_1481 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3umg-assembly2.cif.gz_C | crystal structure of the defluorinating l-2-haloacid dehalogenase rha0230 | 0.9642 | 1 | 234 |
| 3umg-assembly2.cif.gz_C | crystal structure of the defluorinating l-2-haloacid dehalogenase rha0230 | 0.9601 | 1 | 234 |
| 3umc-assembly2.cif.gz_D | crystal structure of the l-2-haloacid dehalogenase pa0810 | 0.9584 | 3 | 233 |
| 3umc-assembly1.cif.gz_C | crystal structure of the l-2-haloacid dehalogenase pa0810 | 0.9577 | 3 | 232 |
| 3umc-assembly2.cif.gz_D | crystal structure of the l-2-haloacid dehalogenase pa0810 | 0.9502 | 3 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3umgH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9621 | 2 | 232 | 3.40.50.1000 |
| 3umcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9491 | 4 | 234 | 3.40.50.1000 |
| 3umgH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9448 | 35 | 99 | 1.10.150.240 |
| 3umgE02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.943 | 35 | 99 | 1.10.150.240 |
| 3umgB02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9409 | 35 | 99 | 1.10.150.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Q5BDM8-F1-model_v4 | Haloacid dehalogenase, type II | 0.995 | 6 | 207 |
GO:0019120
|
| AF-A0A7Y4PVT4-F1-model_v4 | deleted | 0.9926 | 3 | 234 |
|
| AF-X5L739-F1-model_v4 | deleted | 0.9902 | 109 | 234 |
|
| AF-A0A382TDR6-F1-model_v4 | Haloacid dehalogenase, type II | 0.9891 | 3 | 170 |
|
| AF-A0A2S8ME79-F1-model_v4 | deleted | 0.9882 | 59 | 234 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar