F466222

General Info

Members Datasets Scaffolds Average Seq Length
582 288 580 239

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0075367|Ga0495612_0075367_13_777
Length 254
Sequence MRRKIMTRNPVTGEDGRSIGTAVDAVVFDVFGTVVDWRSGVIRDGEALAAAKGLTVDWLAFADAWRAGYQPAMQRVRSGEIAWTRIDGLHRAILDTLLPRFGLESLDEGERAALNRVWHRLDPWPDVVAGLRRLKQRFTISTLSNGNVSLLVDMARHAGLPWDCVLSAELFRRYKPDPEVYLGAARLLDVVPAELLMVAAHPSDLAAAAEAGLRTAYVPRPLEHGPGGFRAAPADQRFDFVAQDFGDLAAQLDA

Samples

Sample ID Description Type Environment
1 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
2 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0
Rhizoplane 6.87
Rhizosphere 81.27
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001378 3300000545 Bacteria 1612
2 rootL2_10255016 3300003322 Bacteria 1252
3 Ga0055540_1002957 3300003792 Bacteria 8533
4 Ga0055540_1004305 3300003792 Bacteria 6489
5 Ga0070658_10250367 3300005327 Bacteria 1503
6 Ga0070676_10012434 3300005328 Bacteria 4646
7 Ga0070676_10040160 3300005328 Bacteria 2709
8 Ga0070676_10096333 3300005328 Bacteria 1821
9 Ga0070676_10400447 3300005328 Bacteria 955
10 Ga0070683_100141715 3300005329 Bacteria 2277
11 Ga0070683_100213280 3300005329 Bacteria 1834
12 Ga0070683_100433739 3300005329 Bacteria 1254
13 Ga0070690_100014288 3300005330 Bacteria 4709
14 Ga0070670_100003234 3300005331 Bacteria 13455
15 Ga0070670_100192388 3300005331 Bacteria 1772
16 Ga0070670_100373356 3300005331 Bacteria 1256
17 Ga0070670_100470730 3300005331 Bacteria 1115
18 Ga0070677_10061087 3300005333 Bacteria 1555
19 Ga0070677_10086747 3300005333 Bacteria 1352
20 Ga0070677_10110053 3300005333 Bacteria 1228
21 Ga0068869_100046767 3300005334 Bacteria 3121
22 Ga0068869_100049508 3300005334 Bacteria 3042
23 Ga0068869_100092576 3300005334 Bacteria 2276
24 Ga0070666_10119007 3300005335 Bacteria 1830
25 Ga0070680_100148058 3300005336 Bacteria 1970
26 Ga0070682_100194963 3300005337 Bacteria 1425
27 Ga0070682_100230557 3300005337 Bacteria 1323
28 Ga0068868_100043976 3300005338 Bacteria 3490
29 Ga0068868_100053541 3300005338 Bacteria 3179
30 Ga0068868_100149592 3300005338 Bacteria 1922
31 Ga0068868_100295500 3300005338 Bacteria 1374
32 Ga0068868_100330539 3300005338 Bacteria 1301
33 Ga0068868_100413825 3300005338 Bacteria 1166
34 Ga0068868_100774319 3300005338 Bacteria 864
35 Ga0070660_100361189 3300005339 Bacteria 1197
36 Ga0070689_100339561 3300005340 Bacteria 1258
37 Ga0070687_100008435 3300005343 Bacteria 4366
38 Ga0070661_100032687 3300005344 Bacteria 3766
39 Ga0070661_100075252 3300005344 Bacteria 2487
40 Ga0070661_100246817 3300005344 Bacteria 1376
41 Ga0070661_100277419 3300005344 Bacteria 1299
42 Ga0070661_100358379 3300005344 Bacteria 1146
43 Ga0070661_100491884 3300005344 Bacteria 981
44 Ga0070668_100021760 3300005347 Bacteria 4845
45 Ga0070669_100041375 3300005353 Bacteria 3351
46 Ga0070669_100157601 3300005353 Bacteria 1762
47 Ga0070669_100385520 3300005353 Bacteria 1144
48 Ga0070669_100537148 3300005353 Bacteria 973
49 Ga0070675_100027407 3300005354 Bacteria 4577
50 Ga0070675_100111354 3300005354 Bacteria 2316
51 Ga0070675_100131352 3300005354 Bacteria 2134
52 Ga0070675_100260899 3300005354 Bacteria 1518
53 Ga0070671_100000534 3300005355 Bacteria 26702
54 Ga0070671_100016856 3300005355 Bacteria 5909
55 Ga0070671_100064999 3300005355 Bacteria 3038
56 Ga0070671_100131678 3300005355 Bacteria 2106
57 Ga0070671_100134558 3300005355 Bacteria 2083
58 Ga0070674_100008544 3300005356 Bacteria 6105
59 Ga0070674_100076398 3300005356 Bacteria 2381
60 Ga0070673_100017428 3300005364 Bacteria 5107
61 Ga0070673_100222868 3300005364 Bacteria 1633
62 Ga0070673_100266373 3300005364 Bacteria 1498
63 Ga0070673_100358389 3300005364 Bacteria 1296
64 Ga0070659_100004663 3300005366 Bacteria 9783
65 Ga0070667_100041935 3300005367 Bacteria 3838
66 Ga0070667_100066886 3300005367 Bacteria 3054
67 Ga0070667_100097031 3300005367 Bacteria 2542
68 Ga0070667_100233718 3300005367 Bacteria 1640
69 Ga0070667_100332424 3300005367 Bacteria 1373
70 Ga0070667_100360376 3300005367 Bacteria 1318
71 Ga0070709_10010686 3300005434 Bacteria 5093
72 Ga0070713_100054840 3300005436 Bacteria 3309
73 Ga0070713_100368162 3300005436 Bacteria 1336
74 Ga0070710_10022298 3300005437 Bacteria 3309
75 Ga0070701_10143547 3300005438 Bacteria 1368
76 Ga0070705_100244985 3300005440 Bacteria 1255
77 Ga0070700_100022547 3300005441 Bacteria 3674
78 Ga0070663_100061684 3300005455 Bacteria 2700
79 Ga0070663_100088922 3300005455 Bacteria 2285
80 Ga0070678_100077289 3300005456 Bacteria 2510
81 Ga0070678_100077608 3300005456 Bacteria 2506
82 Ga0070678_100086348 3300005456 Bacteria 2393
83 Ga0070678_100145965 3300005456 Bacteria 1899
84 Ga0070678_100325411 3300005456 Bacteria 1314
85 Ga0070662_100003483 3300005457 Bacteria 9812
86 Ga0070662_100190825 3300005457 Bacteria 1620
87 Ga0070681_10042378 3300005458 Bacteria 4561
88 Ga0068867_100011474 3300005459 Bacteria 6253
89 Ga0068867_100047355 3300005459 Bacteria 3160
90 Ga0068867_100133746 3300005459 Bacteria 1930
91 Ga0068867_100259332 3300005459 Bacteria 1417
92 Ga0070706_100008756 3300005467 Bacteria 9427
93 Ga0070706_100041084 3300005467 Bacteria 4270
94 Ga0070707_100361326 3300005468 Bacteria 1410
95 Ga0070698_100007972 3300005471 Bacteria 11454
96 Ga0070698_100022409 3300005471 Bacteria 6609
97 Ga0070684_100720571 3300005535 Bacteria 930
98 Ga0070697_100019641 3300005536 Bacteria 5338
99 Ga0068853_100053645 3300005539 Bacteria 3471
100 Ga0070672_100008701 3300005543 Bacteria 6963
101 Ga0070672_100014712 3300005543 Bacteria 5551
102 Ga0070672_100031397 3300005543 Bacteria 3997
103 Ga0070672_100071450 3300005543 Bacteria 2761
104 Ga0070672_100088994 3300005543 Bacteria 2487
105 Ga0070672_100120221 3300005543 Bacteria 2149
106 Ga0070672_100265119 3300005543 Bacteria 1449
107 Ga0070686_100324488 3300005544 Bacteria 1149
108 Ga0070665_100612577 3300005548 Bacteria 1102
109 Ga0068855_100306222 3300005563 Bacteria 1759
110 Ga0070664_100194983 3300005564 Bacteria 1805
111 Ga0070664_100468118 3300005564 Bacteria 1158
112 Ga0070664_100780557 3300005564 Bacteria 893
113 Ga0068857_100020115 3300005577 Bacteria 5868
114 Ga0068857_100021744 3300005577 Bacteria 5645
115 Ga0068857_100102781 3300005577 Bacteria 2566
116 Ga0068857_100109216 3300005577 Bacteria 2485
117 Ga0068854_100118709 3300005578 Bacteria 2004
118 Ga0068854_100206891 3300005578 Bacteria 1546
119 Ga0068856_100004930 3300005614 Bacteria 13214
120 Ga0068856_100060697 3300005614 Bacteria 3735
121 Ga0068852_100029432 3300005616 Bacteria 4512
122 Ga0068852_100033531 3300005616 Bacteria 4265
123 Ga0068852_100095681 3300005616 Bacteria 2667
124 Ga0068852_100128925 3300005616 Bacteria 2327
125 Ga0068852_100148014 3300005616 Bacteria 2180
126 Ga0068852_100493193 3300005616 Bacteria 1219
127 Ga0068852_100522214 3300005616 Bacteria 1185
128 Ga0068859_100804906 3300005617 Bacteria 1027
129 Ga0068859_100864943 3300005617 Bacteria 990
130 Ga0068864_100063190 3300005618 Bacteria 3208
131 Ga0068864_100128335 3300005618 Bacteria 2275
132 Ga0068864_100244678 3300005618 Bacteria 1663
133 Ga0068864_100324052 3300005618 Bacteria 1448
134 Ga0068864_100375893 3300005618 Bacteria 1345
135 Ga0068866_10124415 3300005718 Bacteria 1458
136 Ga0068861_100022892 3300005719 Bacteria 4504
137 Ga0068861_100103441 3300005719 Bacteria 2270
138 Ga0068851_10013041 3300005834 Bacteria 3929
139 Ga0068851_10102310 3300005834 Bacteria 1521
140 Ga0068851_10148281 3300005834 Bacteria 1280
141 Ga0068851_10162752 3300005834 Bacteria 1227
142 Ga0068870_10151148 3300005840 Bacteria 1368
143 Ga0068863_100235834 3300005841 Bacteria 1765
144 Ga0068863_100421627 3300005841 Bacteria 1307
145 Ga0068863_100450291 3300005841 Bacteria 1263
146 Ga0068858_100014061 3300005842 Bacteria 7548
147 Ga0068858_100019774 3300005842 Bacteria 6295
148 Ga0068860_100033557 3300005843 Bacteria 4924
149 Ga0068860_100034758 3300005843 Bacteria 4835
150 Ga0068862_100100406 3300005844 Bacteria 2530
151 Ga0070717_10123719 3300006028 Bacteria 2218
152 Ga0070717_10368781 3300006028 Bacteria 1286
153 Ga0075365_10024694 3300006038 Bacteria 3796
154 Ga0075365_10149458 3300006038 Bacteria 1625
155 Ga0075368_10024335 3300006042 Bacteria 2319
156 Ga0075368_10189906 3300006042 Bacteria 867
157 Ga0075363_100005382 3300006048 Bacteria 5688
158 Ga0075363_100010458 3300006048 Bacteria 4409
159 Ga0075363_100139819 3300006048 Bacteria 1363
160 Ga0075364_10032078 3300006051 Bacteria 3375
161 Ga0075364_10085608 3300006051 Bacteria 2087
162 Ga0075364_10087607 3300006051 Bacteria 2063
163 Ga0070716_100035964 3300006173 Bacteria 2727
164 Ga0070716_100168011 3300006173 Bacteria 1429
165 Ga0075362_10012616 3300006177 Bacteria 3361
166 Ga0075367_10009541 3300006178 Bacteria 5077
167 Ga0075367_10014095 3300006178 Bacteria 4319
168 Ga0075367_10019789 3300006178 Bacteria 3737
169 Ga0075369_10037718 3300006186 Bacteria 2059
170 Ga0075369_10081221 3300006186 Bacteria 1438
171 Ga0075366_10004224 3300006195 Bacteria 7701
172 Ga0075366_10059704 3300006195 Bacteria 2265
173 Ga0075366_10112370 3300006195 Bacteria 1639
174 Ga0075366_10145989 3300006195 Bacteria 1431
175 Ga0075366_10166304 3300006195 Bacteria 1337
176 Ga0097621_100026616 3300006237 Bacteria 4539
177 Ga0075370_10000316 3300006353 Bacteria 17492
178 Ga0075370_10000379 3300006353 Bacteria 16381
179 Ga0075370_10003355 3300006353 Bacteria 7610
180 Ga0075370_10094823 3300006353 Bacteria 1723
181 Ga0068871_100032976 3300006358 Bacteria 4096
182 Ga0075428_100001546 3300006844 Bacteria 24627
183 Ga0075430_100000248 3300006846 Bacteria 37345
184 Ga0075430_100006144 3300006846 Bacteria 10117
185 Ga0075431_100001170 3300006847 Bacteria 23654
186 Ga0075431_100219224 3300006847 Bacteria 1941
187 Ga0075433_10002300 3300006852 Bacteria 14556
188 Ga0075434_100044336 3300006871 Bacteria 4412
189 Ga0075434_100103406 3300006871 Bacteria 2856
190 Ga0075429_100000001 3300006880 Bacteria 139031
191 Ga0068865_100211823 3300006881 Bacteria 1510
192 Ga0075436_100102653 3300006914 Bacteria 1992
193 Ga0075436_100139808 3300006914 Bacteria 1701
194 Ga0097620_100805005 3300006931 Bacteria 1027
195 Ga0097620_100864956 3300006931 Bacteria 990
196 Ga0075435_100189751 3300007076 Bacteria 1739
197 Ga0075435_100270318 3300007076 Bacteria 1450
198 Ga0105240_10009086 3300009093 Bacteria 14109
199 Ga0111539_10431901 3300009094 Bacteria 1534
200 Ga0111539_10666156 3300009094 Bacteria 1212
201 Ga0105245_10276799 3300009098 Bacteria 1639
202 Ga0105245_10332560 3300009098 Bacteria 1500
203 Ga0114129_10010984 3300009147 Bacteria 12901
204 Ga0114129_10038978 3300009147 Bacteria 6698
205 Ga0114129_10151673 3300009147 Bacteria 3171
206 Ga0114129_10265788 3300009147 Bacteria 2297
207 Ga0105243_10057538 3300009148 Bacteria 3096
208 Ga0105243_10129069 3300009148 Bacteria 2142
209 Ga0105243_10231385 3300009148 Bacteria 1640
210 Ga0105243_10720840 3300009148 Bacteria 974
211 Ga0105242_10114117 3300009176 Bacteria 2308
212 Ga0105242_10286534 3300009176 Bacteria 1498
213 Ga0105248_10040445 3300009177 Bacteria 5226
214 Ga0105248_10111124 3300009177 Bacteria 3091
215 Ga0105248_10219991 3300009177 Bacteria 2138
216 Ga0105248_10650989 3300009177 Bacteria 1189
217 Ga0105237_10000958 3300009545 Bacteria 38812
218 Ga0105237_10016409 3300009545 Bacteria 7695
219 Ga0105238_10137813 3300009551 Bacteria 2418
220 Ga0105238_10400253 3300009551 Bacteria 1366
221 Ga0105238_11259713 3300009551 Unclassified 765
222 Ga0105249_10086361 3300009553 Bacteria 2926
223 Ga0105249_10121302 3300009553 Bacteria 2484
224 Ga0105249_10196195 3300009553 Bacteria 1973
225 Ga0105239_10006535 3300010375 Bacteria 13508
226 Ga0105246_10532784 3300011119 Bacteria 1003
227 Ga0157373_10060659 3300013100 Bacteria 2679
228 Ga0157370_10181792 3300013104 Bacteria 1954
229 Ga0157374_10111272 3300013296 Bacteria 2634
230 Ga0157374_10308977 3300013296 Bacteria 1565
231 Ga0157378_10130216 3300013297 Bacteria 2328
232 Ga0163162_10037061 3300013306 Bacteria 4864
233 Ga0163162_10957503 3300013306 Bacteria 967
234 Ga0157372_10007234 3300013307 Bacteria 11820
235 Ga0157372_10826900 3300013307 Bacteria 1075
236 Ga0157375_10029461 3300013308 Bacteria 5162
237 Ga0157375_10051348 3300013308 Bacteria 4049
238 Ga0157375_10060766 3300013308 Bacteria 3749
239 Ga0157375_10081183 3300013308 Bacteria 3282
240 Ga0157375_10508793 3300013308 Bacteria 1368
241 Ga0163163_10191236 3300014325 Bacteria 2095
242 Ga0163163_10447942 3300014325 Bacteria 1351
243 Ga0163163_10490049 3300014325 Bacteria 1291
244 Ga0163163_10893621 3300014325 Bacteria 952
245 Ga0157380_10010673 3300014326 Bacteria 6616
246 Ga0157380_10161708 3300014326 Bacteria 1947
247 Ga0157377_10069435 3300014745 Bacteria 2033
248 Ga0157377_10101465 3300014745 Bacteria 1715
249 Ga0157379_10007204 3300014968 Bacteria 9619
250 Ga0157379_10034450 3300014968 Bacteria 4515
251 Ga0157379_10063043 3300014968 Bacteria 3315
252 Ga0157379_10114488 3300014968 Bacteria 2424
253 Ga0157376_10052467 3300014969 Bacteria 3391
254 Ga0157376_10105671 3300014969 Bacteria 2469
255 Ga0163161_10039177 3300017792 Bacteria 3401
256 Ga0163161_10058711 3300017792 Bacteria 2796
257 Ga0163161_10101436 3300017792 Bacteria 2143
258 Ga0209051_1001007 3300025303 Bacteria 27069
259 Ga0209051_1003186 3300025303 Bacteria 10956
260 Ga0209051_1053200 3300025303 Bacteria 1332
261 Ga0207697_10022863 3300025315 Bacteria 2560
262 Ga0207656_10051035 3300025321 Bacteria 1788
263 Ga0207656_10115647 3300025321 Bacteria 1244
264 Ga0207682_10020370 3300025893 Bacteria 2604
265 Ga0207682_10032555 3300025893 Bacteria 2096
266 Ga0207682_10089295 3300025893 Bacteria 1334
267 Ga0207682_10108555 3300025893 Bacteria 1220
268 Ga0207682_10152967 3300025893 Bacteria 1041
269 Ga0207692_10245464 3300025898 Bacteria 1071
270 Ga0207642_10120686 3300025899 Bacteria 1351
271 Ga0207710_10000056 3300025900 Bacteria 178147
272 Ga0207688_10101630 3300025901 Bacteria 1661
273 Ga0207680_10019990 3300025903 Bacteria 3593
274 Ga0207680_10216027 3300025903 Bacteria 1313
275 Ga0207645_10008823 3300025907 Bacteria 7006
276 Ga0207645_10012245 3300025907 Bacteria 5825
277 Ga0207645_10029751 3300025907 Bacteria 3520
278 Ga0207645_10166775 3300025907 Bacteria 1442
279 Ga0207643_10035563 3300025908 Bacteria 2793
280 Ga0207705_10060137 3300025909 Bacteria 2743
281 Ga0207684_10006858 3300025910 Bacteria 10311
282 Ga0207684_10047347 3300025910 Bacteria 3646
283 Ga0207684_10314099 3300025910 Bacteria 1351
284 Ga0207695_10147889 3300025913 Bacteria 2291
285 Ga0207671_10004831 3300025914 Bacteria 12687
286 Ga0207671_10241871 3300025914 Bacteria 1418
287 Ga0207693_10003237 3300025915 Bacteria 13977
288 Ga0207663_10020065 3300025916 Bacteria 3780
289 Ga0207660_10107561 3300025917 Bacteria 2093
290 Ga0207662_10005876 3300025918 Bacteria 6581
291 Ga0207657_10051810 3300025919 Bacteria 3566
292 Ga0207657_10158794 3300025919 Bacteria 1837
293 Ga0207657_10158964 3300025919 Bacteria 1836
294 Ga0207649_10170212 3300025920 Bacteria 1517
295 Ga0207652_10041922 3300025921 Bacteria 3893
296 Ga0207646_10003828 3300025922 Bacteria 16717
297 Ga0207681_10025799 3300025923 Bacteria 3784
298 Ga0207681_10187604 3300025923 Bacteria 1579
299 Ga0207681_10213368 3300025923 Bacteria 1489
300 Ga0207650_10003667 3300025925 Bacteria 10504
301 Ga0207650_10062595 3300025925 Bacteria 2780
302 Ga0207650_10258297 3300025925 Bacteria 1412
303 Ga0207650_10380458 3300025925 Bacteria 1165
304 Ga0207659_10013906 3300025926 Bacteria 5175
305 Ga0207659_10024080 3300025926 Bacteria 4074
306 Ga0207659_10100152 3300025926 Bacteria 2183
307 Ga0207659_10111283 3300025926 Bacteria 2082
308 Ga0207664_10328534 3300025929 Bacteria 1350
309 Ga0207644_10000360 3300025931 Bacteria 29659
310 Ga0207644_10005934 3300025931 Bacteria 7961
311 Ga0207644_10024980 3300025931 Bacteria 4105
312 Ga0207644_10140330 3300025931 Bacteria 1860
313 Ga0207644_10286181 3300025931 Bacteria 1324
314 Ga0207690_10075785 3300025932 Bacteria 2334
315 Ga0207706_10007080 3300025933 Bacteria 10371
316 Ga0207706_10029157 3300025933 Bacteria 4928
317 Ga0207706_10078331 3300025933 Bacteria 2907
318 Ga0207686_10058342 3300025934 Bacteria 2433
319 Ga0207686_10120280 3300025934 Bacteria 1786
320 Ga0207709_10028538 3300025935 Bacteria 3227
321 Ga0207709_10262823 3300025935 Bacteria 1266
322 Ga0207670_10258672 3300025936 Bacteria 1348
323 Ga0207669_10029992 3300025937 Bacteria 3016
324 Ga0207669_10153627 3300025937 Bacteria 1616
325 Ga0207665_10135222 3300025939 Bacteria 1754
326 Ga0207665_10157952 3300025939 Bacteria 1629
327 Ga0207691_10002225 3300025940 Bacteria 18972
328 Ga0207691_10007668 3300025940 Bacteria 10387
329 Ga0207691_10026718 3300025940 Bacteria 5416
330 Ga0207691_10075841 3300025940 Bacteria 3031
331 Ga0207691_10179193 3300025940 Bacteria 1852
332 Ga0207691_10194949 3300025940 Bacteria 1765
333 Ga0207711_10012084 3300025941 Bacteria 7176
334 Ga0207711_10068738 3300025941 Bacteria 3069
335 Ga0207689_10002313 3300025942 Bacteria 17849
336 Ga0207689_10008764 3300025942 Bacteria 8795
337 Ga0207689_10040238 3300025942 Bacteria 3869
338 Ga0207689_10095638 3300025942 Bacteria 2440
339 Ga0207661_10337522 3300025944 Bacteria 1357
340 Ga0207679_10191127 3300025945 Bacteria 1702
341 Ga0207679_10331541 3300025945 Bacteria 1321
342 Ga0207679_10462990 3300025945 Bacteria 1126
343 Ga0207651_10068520 3300025960 Bacteria 2502
344 Ga0207651_10182923 3300025960 Bacteria 1664
345 Ga0207651_10198630 3300025960 Bacteria 1605
346 Ga0207712_10041716 3300025961 Bacteria 3155
347 Ga0207712_10042191 3300025961 Bacteria 3140
348 Ga0207712_10344183 3300025961 Bacteria 1237
349 Ga0207668_10014922 3300025972 Bacteria 4818
350 Ga0207668_10063888 3300025972 Bacteria 2599
351 Ga0207640_10055476 3300025981 Bacteria 2596
352 Ga0207640_10109695 3300025981 Bacteria 1953
353 Ga0207640_10348441 3300025981 Bacteria 1189
354 Ga0207658_10015968 3300025986 Bacteria 5157
355 Ga0207658_10204100 3300025986 Bacteria 1652
356 Ga0207677_10075883 3300026023 Bacteria 2391
357 Ga0207677_10103839 3300026023 Bacteria 2099
358 Ga0207703_10016405 3300026035 Bacteria 5775
359 Ga0207703_10041922 3300026035 Bacteria 3669
360 Ga0207703_10065929 3300026035 Bacteria 2977
361 Ga0207703_10200556 3300026035 Bacteria 1773
362 Ga0207639_10060734 3300026041 Bacteria 2917
363 Ga0207639_10089738 3300026041 Bacteria 2457
364 Ga0207639_10221187 3300026041 Bacteria 1635
365 Ga0207678_10045486 3300026067 Bacteria 3796
366 Ga0207678_10067290 3300026067 Bacteria 3075
367 Ga0207678_10180056 3300026067 Bacteria 1805
368 Ga0207678_10589009 3300026067 Bacteria 974
369 Ga0207708_10019575 3300026075 Bacteria 5103
370 Ga0207702_10776027 3300026078 Unclassified 947
371 Ga0207702_10969910 3300026078 Bacteria 843
372 Ga0207641_10024652 3300026088 Bacteria 4957
373 Ga0207641_10157530 3300026088 Bacteria 2061
374 Ga0207641_10244169 3300026088 Bacteria 1674
375 Ga0207648_10006265 3300026089 Bacteria 11842
376 Ga0207648_10017650 3300026089 Bacteria 6482
377 Ga0207648_10035407 3300026089 Bacteria 4397
378 Ga0207648_10086539 3300026089 Bacteria 2734
379 Ga0207648_10665670 3300026089 Bacteria 963
380 Ga0207676_10053196 3300026095 Bacteria 3168
381 Ga0207676_10153757 3300026095 Bacteria 1984
382 Ga0207676_10184776 3300026095 Bacteria 1828
383 Ga0207676_10303559 3300026095 Bacteria 1458
384 Ga0207676_10328670 3300026095 Bacteria 1406
385 Ga0207676_10828196 3300026095 Bacteria 904
386 Ga0207674_10004884 3300026116 Bacteria 16046
387 Ga0207674_10022988 3300026116 Bacteria 6686
388 Ga0207674_10033847 3300026116 Bacteria 5346
389 Ga0207674_10101455 3300026116 Bacteria 2858
390 Ga0207675_100003645 3300026118 Bacteria 15012
391 Ga0207675_100005117 3300026118 Bacteria 12625
392 Ga0207683_10110011 3300026121 Bacteria 2467
393 Ga0207683_10134907 3300026121 Bacteria 2222
394 Ga0207683_10156058 3300026121 Bacteria 2061
395 Ga0207683_10180626 3300026121 Bacteria 1913
396 Ga0207683_10332643 3300026121 Bacteria 1392
397 Ga0207683_10518567 3300026121 Bacteria 1101
398 Ga0207698_10059527 3300026142 Bacteria 2966
399 Ga0207698_10102215 3300026142 Bacteria 2379
400 Ga0207698_10150004 3300026142 Bacteria 2022
401 Ga0207698_10335401 3300026142 Bacteria 1422
402 Ga0207698_10352329 3300026142 Bacteria 1391
403 Ga0207698_10528706 3300026142 Bacteria 1152
404 Ga0207698_10678750 3300026142 Bacteria 1023
405 Ga0209974_10017294 3300027876 Bacteria 2392
406 Ga0268266_10523804 3300028379 Bacteria 1134
407 Ga0268266_10531913 3300028379 Bacteria 1125
408 Ga0268265_10028550 3300028380 Bacteria 3995
409 Ga0268264_10033475 3300028381 Bacteria 4222
410 Ga0307408_100240680 3300031548 Bacteria 1487
411 Ga0307508_10284445 3300031616 Bacteria 1247
412 Ga0307516_10017915 3300031730 Bacteria 7375
413 Ga0307410_10157981 3300031852 Bacteria 1696
414 Ga0307407_10092469 3300031903 Bacteria 1858
415 Ga0307412_10026475 3300031911 Bacteria 3605
416 Ga0307409_100105829 3300031995 Bacteria 2346
417 Ga0307416_100003176 3300032002 Bacteria 9632
418 Ga0307411_10173873 3300032005 Bacteria 1627
419 Ga0307415_100137194 3300032126 Bacteria 1862
420 Ga0373928_0055213 3300035084 Bacteria 948
421 Ga0373934_0037371 3300035086 Bacteria 1912
422 Ga0373945_0042063 3300035116 Bacteria 1655
423 Ga0373954_0000008 3300035118 Bacteria 79963
424 Ga0373954_0102464 3300035118 Bacteria 1382
425 Ga0373956_0112478 3300035119 Bacteria 1268
426 Ga0373943_0042851 3300035170 Bacteria 2195
427 Ga0373943_0109302 3300035170 Bacteria 1456
428 Ga0373946_0103217 3300035171 Bacteria 1281
429 Ga0373955_0085465 3300035172 Bacteria 1791
430 Ga0373924_0225101 3300035410 Unclassified 829
431 Ga0373935_0102430 3300035692 Bacteria 1889
432 Ga0373927_0255811 3300035695 Bacteria 1151
433 Ga0373927_0260354 3300035695 Bacteria 1141
434 Ga0373933_0001883 3300035724 Bacteria 12112
435 Ga0373933_0221824 3300035724 Bacteria 1213
436 Ga0373933_0447879 3300035724 Bacteria 844
437 Ga0373947_0522577 3300035725 Bacteria 807
438 Ga0373937_0000551 3300036401 Bacteria 33238
439 Ga0373937_0176412 3300036401 Bacteria 2006
440 Ga0373937_0417423 3300036401 Bacteria 1273
441 Ga0395899_0132320 3300037312 Bacteria 1780
442 Ga0395900_0024502 3300037418 Bacteria 6179
443 Ga0395898_0009183 3300037466 Bacteria 10408
444 Ga0395901_0035138 3300038443 Bacteria 5179
445 Ga0436363_0460634 3300039450 Bacteria 1801
446 Ga0466972_0002980 3300044658 Bacteria 8379
447 Ga0466965_0002399 3300044683 Bacteria 7948
448 Ga0466960_0000211 3300044901 Bacteria 20062
449 Ga0451576_0553619 3300045051 Bacteria 1208
450 Ga0466967_0269183 3300045976 Bacteria 1632
451 Ga0495592_0001414 3300046454 Bacteria 16651
452 Ga0495603_0118207 3300046455 Bacteria 1545
453 Ga0495603_0152287 3300046455 Bacteria 1343
454 Ga0495629_0242866 3300046459 Bacteria 1240
455 Ga0495638_0266130 3300046460 Bacteria 938
456 Ga0495582_0040706 3300046473 Bacteria 2560
457 Ga0495584_0139059 3300046491 Unclassified 1233
458 Ga0495606_0028883 3300046507 Bacteria 3904
459 Ga0495608_0234906 3300046511 Unclassified 1147
460 Ga0495610_0114836 3300046512 Bacteria 1188
461 Ga0495616_0061881 3300046513 Bacteria 1835
462 Ga0495628_0134425 3300046516 Bacteria 1891
463 Ga0495637_0210051 3300046520 Bacteria 712
464 Ga0495644_0138593 3300046523 Bacteria 929
465 Ga0495648_0000833 3300046524 Bacteria 32602
466 Ga0495642_0021404 3300046528 Bacteria 2543
467 Ga0495640_0306759 3300046533 Bacteria 985
468 Ga0495586_0190872 3300046535 Bacteria 1160
469 Ga0495597_0074256 3300046542 Bacteria 1460
470 Ga0495645_0018188 3300046543 Bacteria 5046
471 Ga0495667_0302690 3300046559 Bacteria 1013
472 Ga0495668_0018534 3300046616 Bacteria 4023
473 Ga0495623_0273696 3300046679 Bacteria 942
474 Ga0495647_0089514 3300046681 Bacteria 1260
475 Ga0495658_0021873 3300046683 Bacteria 3376
476 Ga0495658_0037987 3300046683 Bacteria 2664
477 Ga0495613_0129227 3300046689 Bacteria 1810
478 Ga0495670_0228320 3300046691 Bacteria 990
479 Ga0495649_0023324 3300046694 Bacteria 3458
480 Ga0495604_0001385 3300047317 Bacteria 19854
481 Ga0495674_0140689 3300047319 Bacteria 2029
482 Ga0495672_0001133 3300047320 Bacteria 27015
483 Ga0495680_0010119 3300047322 Bacteria 8431
484 Ga0495687_000359 3300047443 Bacteria 57119
485 Ga0495687_006702 3300047443 Bacteria 6983
486 Ga0495673_0000856 3300047469 Bacteria 28247
487 Ga0495602_0590210 3300048088 Bacteria 765
488 Ga0496100_0006224 3300048903 Bacteria 6493
489 Ga0496100_0203877 3300048903 Bacteria 1443
490 Ga0496101_0000026 3300048904 Bacteria 199963
491 Ga0496101_0066482 3300048904 Bacteria 2630
492 Ga0496101_0239538 3300048904 Bacteria 1412
493 Ga0496102_0000031 3300048905 Bacteria 217389
494 Ga0496102_0262822 3300048905 Bacteria 1627
495 Ga0496103_0000025 3300048906 Bacteria 221144
496 Ga0496104_0004547 3300048907 Bacteria 12085
497 Ga0496104_0109243 3300048907 Bacteria 2651
498 Ga0496105_0078955 3300048908 Bacteria 2718
499 Ga0496105_0120845 3300048908 Bacteria 2160
500 Ga0496105_0215579 3300048908 Bacteria 1564
501 Ga0496106_0016267 3300048909 Bacteria 5504
502 Ga0496106_0155013 3300048909 Bacteria 1808
503 Ga0496106_0421502 3300048909 Bacteria 1073
504 Ga0496107_0016047 3300048910 Bacteria 5256
505 Ga0496107_0110352 3300048910 Bacteria 2021
506 Ga0496108_0002743 3300048911 Bacteria 14087
507 Ga0496108_0029782 3300048911 Bacteria 4523
508 Ga0496108_0137690 3300048911 Bacteria 2102
509 Ga0496108_0141037 3300048911 Bacteria 2076
510 Ga0496109_0035154 3300048912 Bacteria 4518
511 Ga0496109_0098714 3300048912 Bacteria 2708
512 Ga0496110_0009808 3300048913 Bacteria 7757
513 Ga0496111_0005697 3300048914 Bacteria 8026
514 Ga0496111_0092615 3300048914 Bacteria 2215
515 Ga0496111_0160002 3300048914 Bacteria 1672
516 Ga0496112_0008259 3300048915 Bacteria 9315
517 Ga0496112_0021084 3300048915 Bacteria 6190
518 Ga0496112_0038071 3300048915 Bacteria 4696
519 Ga0496112_0075635 3300048915 Bacteria 3330
520 Ga0496112_0107705 3300048915 Bacteria 2757
521 Ga0496112_0237020 3300048915 Bacteria 1778
522 Ga0496113_0058385 3300048916 Bacteria 2903
523 Ga0496113_0101427 3300048916 Bacteria 2231
524 Ga0496114_0035499 3300048917 Bacteria 4117
525 Ga0496114_0038925 3300048917 Bacteria 3935
526 Ga0496115_0227552 3300048918 Bacteria 1538
527 Ga0496115_0229450 3300048918 Bacteria 1531
528 Ga0496116_0000084 3300048919 Bacteria 219579
529 Ga0496117_0000018 3300048920 Bacteria 479613
530 Ga0496118_0000013 3300048921 Bacteria 574008
531 Ga0496119_0020835 3300048922 Bacteria 4761
532 Ga0496119_0032380 3300048922 Bacteria 3485
533 Ga0496120_0012709 3300048923 Bacteria 5710
534 Ga0496121_0000056 3300048924 Bacteria 296250
535 Ga0496126_0000089 3300048929 Bacteria 211348
536 Ga0501075_0167270 3300049591 Bacteria 1678
537 nmdc:mga03683_109201_c1 3300050489 Bacteria 1222
538 nmdc:mga03683_6219_c1 3300050489 Bacteria 4075
539 nmdc:mga00v17_320381_c1 3300050491 Bacteria 1007
540 nmdc:mga00v17_379019_c1 3300050491 Bacteria 919
541 nmdc:mga00v17_46657_c1 3300050491 Bacteria 2622
542 nmdc:mga0k408_104669_c1 3300050493 Bacteria 1670
543 nmdc:mga0k408_25900_c1 3300050493 Bacteria 3324
544 nmdc:mga0k408_26927_c1 3300050493 Bacteria 3262
545 nmdc:mga0k408_3366_c1 3300050493 Bacteria 8468
546 nmdc:mga06z11_128152_c1 3300050494 Bacteria 1422
547 nmdc:mga06z11_68378_c1 3300050494 Bacteria 1872
548 nmdc:mga07m45_105892_c1 3300050496 Bacteria 1618
549 nmdc:mga07m45_1246_c1 3300050496 Bacteria 11554
550 nmdc:mga07m45_196303_c1 3300050496 Bacteria 1174
551 nmdc:mga07m45_27321_c1 3300050496 Bacteria 1804
552 nmdc:mga07m45_35155_c1 3300050496 Bacteria 2787
553 nmdc:mga07m45_4005_c1 3300050496 Bacteria 7168
554 nmdc:mga07m45_63808_c1 3300050496 Bacteria 2089
555 nmdc:mga07m45_9134_c1 3300050496 Bacteria 5122
556 nmdc:mga05p37_13321_c1 3300050507 Bacteria 9849
557 nmdc:mga05p37_319019_c1 3300050507 Bacteria 1840
558 nmdc:mga05p37_76654_c1 3300050507 Bacteria 4116
559 nmdc:mga05p37_94154_c1 3300050507 Bacteria 3691
560 nmdc:mga09592_21395_c1 3300050508 Bacteria 5330
561 nmdc:mga0qj67_1083_c1 3300050509 Bacteria 18865
562 nmdc:mga0qj67_2840_c1 3300050509 Bacteria 12419
563 nmdc:mga06r32_149545_c1 3300050510 Bacteria 1961
564 nmdc:mga06r32_1957_c1 3300050510 Bacteria 18373
565 nmdc:mga0n895_11206_c1 3300050512 Bacteria 7985
566 nmdc:mga0rr50_177709_c1 3300050513 Bacteria 1739
567 nmdc:mga0rr50_229073_c1 3300050513 Bacteria 1537
568 nmdc:mga08x19_35324_c1 3300050514 Bacteria 3162
569 nmdc:mga0a205_149149_c1 3300050515 Bacteria 2239
570 nmdc:mga0a205_185_c2 3300050515 Bacteria 42551
571 nmdc:mga0sz30_76537_c1 3300050516 Bacteria 1445
572 Ga0495601_0025287 3300053077 Bacteria 3661
573 Ga0495601_0256133 3300053077 Bacteria 1143
574 Ga0495612_0075367 3300053078 Bacteria 1412
575 Ga0495595_0067278 3300053084 Bacteria 1688
576 Ga0500644_0048224 3300053088 Bacteria 1448
577 Ga0500651_0023491 3300053093 Bacteria 3862
578 Ga0500594_0002652 3300053118 Bacteria 3887
579 Ga0500658_0001540 3300053134 Bacteria 9213
580 Ga0500622_0008232 3300053156 Bacteria 5852

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0042063 Ga0373945_0042063_1004_1639 206
2 3300046533 Ga0495640_0306759 Ga0495640_0306759_325_969 213
3 3300048911 Ga0496108_0137690 Ga0496108_0137690_1132_1797 221
4 3300048915 Ga0496112_0008259 Ga0496112_0008259_8107_8772 221
5 3300005334 Ga0068869_100092576 Ga0068869_1000925762 223
6 3300005364 Ga0070673_100358389 Ga0070673_1003583892 223
7 3300005577 Ga0068857_100102781 Ga0068857_1001027812 223
8 3300005578 Ga0068854_100118709 Ga0068854_1001187092 223
9 3300005616 Ga0068852_100128925 Ga0068852_1001289252 223
10 3300006051 Ga0075364_10087607 Ga0075364_100876072 223
11 3300006177 Ga0075362_10012616 Ga0075362_100126163 223
12 3300006178 Ga0075367_10019789 Ga0075367_100197895 223
13 3300006186 Ga0075369_10081221 Ga0075369_100812212 223
14 3300006195 Ga0075366_10145989 Ga0075366_101459892 223
15 3300009093 Ga0105240_10009086 Ga0105240_1000908615 223
16 3300009545 Ga0105237_10016409 Ga0105237_100164099 223
17 3300025913 Ga0207695_10147889 Ga0207695_101478891 223
18 3300025914 Ga0207671_10241871 Ga0207671_102418712 223
19 3300025919 Ga0207657_10158964 Ga0207657_101589641 223
20 3300025933 Ga0207706_10007080 Ga0207706_100070809 223
21 3300025942 Ga0207689_10095638 Ga0207689_100956383 223
22 3300025960 Ga0207651_10068520 Ga0207651_100685202 223
23 3300025981 Ga0207640_10348441 Ga0207640_103484412 223
24 3300026116 Ga0207674_10033847 Ga0207674_100338475 223
25 3300026142 Ga0207698_10678750 Ga0207698_106787502 223
26 3300050489 nmdc:mga03683_6219_c1 nmdc:mga03683_6219_c1_2615_3331 223
27 3300050494 nmdc:mga06z11_68378_c1 nmdc:mga06z11_68378_c1_12_728 223
28 3300050496 nmdc:mga07m45_105892_c1 nmdc:mga07m45_105892_c1_716_1432 223
29 3300050516 nmdc:mga0sz30_76537_c1 nmdc:mga0sz30_76537_c1_242_958 223
30 3300009551 Ga0105238_11259713 Ga0105238_112597131 224
31 3300005328 Ga0070676_10096333 Ga0070676_100963332 225
32 3300006195 Ga0075366_10059704 Ga0075366_100597042 225
33 3300006914 Ga0075436_100102653 Ga0075436_1001026531 225
34 3300007076 Ga0075435_100270318 Ga0075435_1002703182 225
35 3300009147 Ga0114129_10038978 Ga0114129_100389786 225
36 3300025907 Ga0207645_10166775 Ga0207645_101667752 225
37 3300025937 Ga0207669_10153627 Ga0207669_101536272 225
38 3300026089 Ga0207648_10035407 Ga0207648_100354072 225
39 3300031730 Ga0307516_10017915 Ga0307516_100179155 225
40 3300046542 Ga0495597_0074256 Ga0495597_0074256_703_1419 225
41 3300047443 Ga0495687_000359 Ga0495687_000359_50120_50836 225
42 3300050491 nmdc:mga00v17_320381_c1 nmdc:mga00v17_320381_c1_24_701 225
43 3300050493 nmdc:mga0k408_25900_c1 nmdc:mga0k408_25900_c1_2244_2999 225
44 3300050496 nmdc:mga07m45_196303_c1 nmdc:mga07m45_196303_c1_326_1081 225
45 3300050507 nmdc:mga05p37_94154_c1 nmdc:mga05p37_94154_c1_1368_2048 225
46 3300050513 nmdc:mga0rr50_229073_c1 nmdc:mga0rr50_229073_c1_418_1098 225
47 3300050515 nmdc:mga0a205_149149_c1 nmdc:mga0a205_149149_c1_16_696 225
48 3300005434 Ga0070709_10010686 Ga0070709_100106866 226
49 3300005436 Ga0070713_100054840 Ga0070713_1000548402 226
50 3300005436 Ga0070713_100368162 Ga0070713_1003681622 226
51 3300005437 Ga0070710_10022298 Ga0070710_100222982 226
52 3300005614 Ga0068856_100060697 Ga0068856_1000606974 226
53 3300006028 Ga0070717_10123719 Ga0070717_101237192 226
54 3300009177 Ga0105248_10650989 Ga0105248_106509892 226
55 3300009553 Ga0105249_10121302 Ga0105249_101213024 226
56 3300025321 Ga0207656_10115647 Ga0207656_101156473 226
57 3300025898 Ga0207692_10245464 Ga0207692_102454642 226
58 3300025915 Ga0207693_10003237 Ga0207693_100032377 226
59 3300025916 Ga0207663_10020065 Ga0207663_100200654 226
60 3300025929 Ga0207664_10328534 Ga0207664_103285342 226
61 3300025972 Ga0207668_10063888 Ga0207668_100638885 226
62 3300025981 Ga0207640_10109695 Ga0207640_101096953 226
63 3300026078 Ga0207702_10776027 Ga0207702_107760271 226
64 3300026078 Ga0207702_10969910 Ga0207702_109699102 226
65 3300035170 Ga0373943_0042851 Ga0373943_0042851_479_1162 226
66 3300035172 Ga0373955_0085465 Ga0373955_0085465_128_811 226
67 3300035410 Ga0373924_0225101 Ga0373924_0225101_43_726 226
68 3300035725 Ga0373947_0522577 Ga0373947_0522577_95_778 226
69 3300036401 Ga0373937_0176412 Ga0373937_0176412_968_1651 226
70 3300044658 Ga0466972_0002980 Ga0466972_0002980_6425_7126 226
71 3300044683 Ga0466965_0002399 Ga0466965_0002399_6150_6851 226
72 3300044901 Ga0466960_0000211 Ga0466960_0000211_2082_2783 226
73 3300046455 Ga0495603_0118207 Ga0495603_0118207_556_1239 226
74 3300046491 Ga0495584_0139059 Ga0495584_0139059_17_700 226
75 3300046516 Ga0495628_0134425 Ga0495628_0134425_591_1274 226
76 3300046520 Ga0495637_0210051 Ga0495637_0210051_17_700 226
77 3300046523 Ga0495644_0138593 Ga0495644_0138593_62_745 226
78 3300047317 Ga0495604_0001385 Ga0495604_0001385_18326_19009 226
79 3300047319 Ga0495674_0140689 Ga0495674_0140689_50_739 226
80 3300047322 Ga0495680_0010119 Ga0495680_0010119_26_709 226
81 3300048903 Ga0496100_0203877 Ga0496100_0203877_369_1055 226
82 3300048904 Ga0496101_0239538 Ga0496101_0239538_616_1302 226
83 3300048907 Ga0496104_0004547 Ga0496104_0004547_5389_6075 226
84 3300048907 Ga0496104_0109243 Ga0496104_0109243_1530_2219 226
85 3300048908 Ga0496105_0078955 Ga0496105_0078955_56_739 226
86 3300048908 Ga0496105_0120845 Ga0496105_0120845_59_745 226
87 3300048911 Ga0496108_0002743 Ga0496108_0002743_8456_9142 226
88 3300048911 Ga0496108_0029782 Ga0496108_0029782_3302_3991 226
89 3300048912 Ga0496109_0035154 Ga0496109_0035154_2545_3231 226
90 3300048913 Ga0496110_0009808 Ga0496110_0009808_1697_2383 226
91 3300048914 Ga0496111_0005697 Ga0496111_0005697_1928_2614 226
92 3300048914 Ga0496111_0092615 Ga0496111_0092615_1334_2023 226
93 3300048915 Ga0496112_0038071 Ga0496112_0038071_2528_3214 226
94 3300048915 Ga0496112_0107705 Ga0496112_0107705_1393_2082 226
95 3300048915 Ga0496112_0237020 Ga0496112_0237020_452_1141 226
96 3300048916 Ga0496113_0058385 Ga0496113_0058385_622_1311 226
97 3300048916 Ga0496113_0101427 Ga0496113_0101427_1148_1834 226
98 3300048918 Ga0496115_0227552 Ga0496115_0227552_737_1426 226
99 3300050491 nmdc:mga00v17_379019_c1 nmdc:mga00v17_379019_c1_110_802 226
100 3300053084 Ga0495595_0067278 Ga0495595_0067278_11_694 226
101 iso_pu_bacteria 2671180139 2671695425 226
102 3300005333 Ga0070677_10061087 Ga0070677_100610872 227
103 3300005334 Ga0068869_100049508 Ga0068869_1000495082 227
104 3300005338 Ga0068868_100043976 Ga0068868_1000439762 227
105 3300005355 Ga0070671_100064999 Ga0070671_1000649993 227
106 3300005364 Ga0070673_100017428 Ga0070673_1000174282 227
107 3300005367 Ga0070667_100233718 Ga0070667_1002337182 227
108 3300005456 Ga0070678_100325411 Ga0070678_1003254112 227
109 3300005459 Ga0068867_100011474 Ga0068867_1000114745 227
110 3300005543 Ga0070672_100008701 Ga0070672_1000087012 227
111 3300005577 Ga0068857_100021744 Ga0068857_1000217442 227
112 3300005840 Ga0068870_10151148 Ga0068870_101511482 227
113 3300006195 Ga0075366_10112370 Ga0075366_101123702 227
114 3300009098 Ga0105245_10332560 Ga0105245_103325602 227
115 3300009148 Ga0105243_10129069 Ga0105243_101290692 227
116 3300011119 Ga0105246_10532784 Ga0105246_105327842 227
117 3300013308 Ga0157375_10081183 Ga0157375_100811833 227
118 3300014745 Ga0157377_10101465 Ga0157377_101014652 227
119 3300025893 Ga0207682_10152967 Ga0207682_101529671 227
120 3300025907 Ga0207645_10012245 Ga0207645_100122452 227
121 3300025925 Ga0207650_10380458 Ga0207650_103804582 227
122 3300025931 Ga0207644_10140330 Ga0207644_101403302 227
123 3300025942 Ga0207689_10040238 Ga0207689_100402382 227
124 3300025960 Ga0207651_10198630 Ga0207651_101986301 227
125 3300026089 Ga0207648_10006265 Ga0207648_100062656 227
126 3300026116 Ga0207674_10004884 Ga0207674_100048849 227
127 3300026121 Ga0207683_10180626 Ga0207683_101806262 227
128 3300031616 Ga0307508_10284445 Ga0307508_102844452 227
129 3300046454 Ga0495592_0001414 Ga0495592_0001414_125_820 227
130 3300046460 Ga0495638_0266130 Ga0495638_0266130_48_770 227
131 3300046512 Ga0495610_0114836 Ga0495610_0114836_126_821 227
132 3300046513 Ga0495616_0061881 Ga0495616_0061881_467_1189 227
133 3300046528 Ga0495642_0021404 Ga0495642_0021404_743_1465 227
134 3300046691 Ga0495670_0228320 Ga0495670_0228320_255_953 227
135 3300046694 Ga0495649_0023324 Ga0495649_0023324_1911_2633 227
136 3300047443 Ga0495687_006702 Ga0495687_006702_3986_4708 227
137 3300050493 nmdc:mga0k408_26927_c1 nmdc:mga0k408_26927_c1_343_1065 227
138 3300053088 Ga0500644_0048224 Ga0500644_0048224_145_840 227
139 3300053093 Ga0500651_0023491 Ga0500651_0023491_203_898 227
140 3300053118 Ga0500594_0002652 Ga0500594_0002652_1287_1982 227
141 3300053134 Ga0500658_0001540 Ga0500658_0001540_5754_6476 227
142 3300053156 Ga0500622_0008232 Ga0500622_0008232_2443_3138 227
143 3300005440 Ga0070705_100244985 Ga0070705_1002449851 228
144 3300013306 Ga0163162_10957503 Ga0163162_109575031 228
145 3300014325 Ga0163163_10490049 Ga0163163_104900492 228
146 3300026067 Ga0207678_10589009 Ga0207678_105890092 228
147 3300050496 nmdc:mga07m45_63808_c1 nmdc:mga07m45_63808_c1_810_1532 228
148 3300005367 Ga0070667_100041935 Ga0070667_1000419352 229
149 3300006051 Ga0075364_10032078 Ga0075364_100320782 229
150 3300006871 Ga0075434_100103406 Ga0075434_1001034062 229
151 3300035086 Ga0373934_0037371 Ga0373934_0037371_736_1431 229
152 3300035118 Ga0373954_0000008 Ga0373954_0000008_38506_39201 229
153 3300035724 Ga0373933_0001883 Ga0373933_0001883_1081_1776 229
154 3300036401 Ga0373937_0000551 Ga0373937_0000551_31737_32432 229
155 3300045976 Ga0466967_0269183 Ga0466967_0269183_173_877 229
156 3300046559 Ga0495667_0302690 Ga0495667_0302690_83_778 229
157 3300048088 Ga0495602_0590210 Ga0495602_0590210_42_737 229
158 3300050507 nmdc:mga05p37_13321_c1 nmdc:mga05p37_13321_c1_5974_6663 229
159 3300050509 nmdc:mga0qj67_1083_c1 nmdc:mga0qj67_1083_c1_10801_11490 229
160 3300050510 nmdc:mga06r32_149545_c1 nmdc:mga06r32_149545_c1_247_936 229
161 3300005458 Ga0070681_10042378 Ga0070681_100423785 230
162 3300006038 Ga0075365_10149458 Ga0075365_101494582 230
163 3300006042 Ga0075368_10024335 Ga0075368_100243352 230
164 3300006048 Ga0075363_100010458 Ga0075363_1000104583 230
165 3300006051 Ga0075364_10085608 Ga0075364_100856083 230
166 3300006178 Ga0075367_10014095 Ga0075367_100140955 230
167 3300006195 Ga0075366_10166304 Ga0075366_101663042 230
168 3300006353 Ga0075370_10000316 Ga0075370_100003166 230
169 3300006353 Ga0075370_10094823 Ga0075370_100948232 230
170 3300050489 nmdc:mga03683_109201_c1 nmdc:mga03683_109201_c1_28_744 230
171 3300050493 nmdc:mga0k408_3366_c1 nmdc:mga0k408_3366_c1_673_1389 230
172 3300050496 nmdc:mga07m45_1246_c1 nmdc:mga07m45_1246_c1_7287_8003 230
173 3300050496 nmdc:mga07m45_9134_c1 nmdc:mga07m45_9134_c1_3452_4168 230
174 3300013308 Ga0157375_10508793 Ga0157375_105087931 231
175 3300050496 nmdc:mga07m45_27321_c1 nmdc:mga07m45_27321_c1_830_1525 231
176 3300003322 rootL2_10255016 rootL2_102550162 232
177 3300005327 Ga0070658_10250367 Ga0070658_102503672 232
178 3300005328 Ga0070676_10012434 Ga0070676_100124343 232
179 3300005328 Ga0070676_10400447 Ga0070676_104004471 232
180 3300005329 Ga0070683_100433739 Ga0070683_1004337392 232
181 3300005330 Ga0070690_100014288 Ga0070690_1000142882 232
182 3300005331 Ga0070670_100003234 Ga0070670_1000032342 232
183 3300005331 Ga0070670_100192388 Ga0070670_1001923883 232
184 3300005331 Ga0070670_100373356 Ga0070670_1003733562 232
185 3300005331 Ga0070670_100470730 Ga0070670_1004707302 232
186 3300005333 Ga0070677_10086747 Ga0070677_100867471 232
187 3300005333 Ga0070677_10110053 Ga0070677_101100532 232
188 3300005334 Ga0068869_100046767 Ga0068869_1000467673 232
189 3300005335 Ga0070666_10119007 Ga0070666_101190073 232
190 3300005338 Ga0068868_100053541 Ga0068868_1000535412 232
191 3300005338 Ga0068868_100295500 Ga0068868_1002955002 232
192 3300005338 Ga0068868_100330539 Ga0068868_1003305392 232
193 3300005338 Ga0068868_100413825 Ga0068868_1004138252 232
194 3300005338 Ga0068868_100774319 Ga0068868_1007743191 232
195 3300005340 Ga0070689_100339561 Ga0070689_1003395612 232
196 3300005343 Ga0070687_100008435 Ga0070687_1000084353 232
197 3300005344 Ga0070661_100246817 Ga0070661_1002468171 232
198 3300005344 Ga0070661_100277419 Ga0070661_1002774191 232
199 3300005344 Ga0070661_100358379 Ga0070661_1003583791 232
200 3300005344 Ga0070661_100491884 Ga0070661_1004918841 232
201 3300005347 Ga0070668_100021760 Ga0070668_1000217604 232
202 3300005353 Ga0070669_100041375 Ga0070669_1000413753 232
203 3300005353 Ga0070669_100385520 Ga0070669_1003855202 232
204 3300005353 Ga0070669_100537148 Ga0070669_1005371482 232
205 3300005354 Ga0070675_100027407 Ga0070675_1000274076 232
206 3300005354 Ga0070675_100111354 Ga0070675_1001113542 232
207 3300005354 Ga0070675_100260899 Ga0070675_1002608992 232
208 3300005355 Ga0070671_100000534 Ga0070671_1000005349 232
209 3300005355 Ga0070671_100131678 Ga0070671_1001316783 232
210 3300005355 Ga0070671_100134558 Ga0070671_1001345582 232
211 3300005356 Ga0070674_100008544 Ga0070674_1000085444 232
212 3300005356 Ga0070674_100076398 Ga0070674_1000763982 232
213 3300005364 Ga0070673_100222868 Ga0070673_1002228682 232
214 3300005364 Ga0070673_100266373 Ga0070673_1002663732 232
215 3300005367 Ga0070667_100066886 Ga0070667_1000668863 232
216 3300005367 Ga0070667_100360376 Ga0070667_1003603762 232
217 3300005441 Ga0070700_100022547 Ga0070700_1000225472 232
218 3300005456 Ga0070678_100077289 Ga0070678_1000772892 232
219 3300005456 Ga0070678_100077608 Ga0070678_1000776082 232
220 3300005456 Ga0070678_100086348 Ga0070678_1000863482 232
221 3300005456 Ga0070678_100145965 Ga0070678_1001459652 232
222 3300005457 Ga0070662_100190825 Ga0070662_1001908252 232
223 3300005459 Ga0068867_100047355 Ga0068867_1000473552 232
224 3300005459 Ga0068867_100133746 Ga0068867_1001337462 232
225 3300005459 Ga0068867_100259332 Ga0068867_1002593322 232
226 3300005467 Ga0070706_100041084 Ga0070706_1000410846 232
227 3300005543 Ga0070672_100014712 Ga0070672_1000147124 232
228 3300005543 Ga0070672_100031397 Ga0070672_1000313973 232
229 3300005543 Ga0070672_100071450 Ga0070672_1000714503 232
230 3300005543 Ga0070672_100088994 Ga0070672_1000889943 232
231 3300005543 Ga0070672_100120221 Ga0070672_1001202213 232
232 3300005543 Ga0070672_100265119 Ga0070672_1002651192 232
233 3300005544 Ga0070686_100324488 Ga0070686_1003244882 232
234 3300005564 Ga0070664_100194983 Ga0070664_1001949832 232
235 3300005564 Ga0070664_100468118 Ga0070664_1004681182 232
236 3300005564 Ga0070664_100780557 Ga0070664_1007805571 232
237 3300005616 Ga0068852_100029432 Ga0068852_1000294322 232
238 3300005616 Ga0068852_100033531 Ga0068852_1000335314 232
239 3300005616 Ga0068852_100148014 Ga0068852_1001480142 232
240 3300005616 Ga0068852_100493193 Ga0068852_1004931932 232
241 3300005616 Ga0068852_100522214 Ga0068852_1005222142 232
242 3300005618 Ga0068864_100063190 Ga0068864_1000631903 232
243 3300005618 Ga0068864_100128335 Ga0068864_1001283352 232
244 3300005618 Ga0068864_100324052 Ga0068864_1003240522 232
245 3300005618 Ga0068864_100375893 Ga0068864_1003758931 232
246 3300005718 Ga0068866_10124415 Ga0068866_101244152 232
247 3300005719 Ga0068861_100022892 Ga0068861_1000228924 232
248 3300005834 Ga0068851_10148281 Ga0068851_101482812 232
249 3300005834 Ga0068851_10162752 Ga0068851_101627522 232
250 3300005841 Ga0068863_100235834 Ga0068863_1002358342 232
251 3300005842 Ga0068858_100014061 Ga0068858_1000140617 232
252 3300005843 Ga0068860_100034758 Ga0068860_1000347583 232
253 3300005844 Ga0068862_100100406 Ga0068862_1001004062 232
254 3300006038 Ga0075365_10024694 Ga0075365_100246942 232
255 3300006042 Ga0075368_10189906 Ga0075368_101899061 232
256 3300006048 Ga0075363_100005382 Ga0075363_1000053825 232
257 3300006173 Ga0070716_100168011 Ga0070716_1001680112 232
258 3300006178 Ga0075367_10009541 Ga0075367_100095414 232
259 3300006195 Ga0075366_10004224 Ga0075366_100042244 232
260 3300006237 Ga0097621_100026616 Ga0097621_1000266164 232
261 3300006353 Ga0075370_10000379 Ga0075370_100003796 232
262 3300006353 Ga0075370_10003355 Ga0075370_100033555 232
263 3300006358 Ga0068871_100032976 Ga0068871_1000329764 232
264 3300006881 Ga0068865_100211823 Ga0068865_1002118232 232
265 3300009094 Ga0111539_10431901 Ga0111539_104319012 232
266 3300009148 Ga0105243_10057538 Ga0105243_100575382 232
267 3300009148 Ga0105243_10231385 Ga0105243_102313852 232
268 3300009148 Ga0105243_10720840 Ga0105243_107208402 232
269 3300009176 Ga0105242_10114117 Ga0105242_101141172 232
270 3300009176 Ga0105242_10286534 Ga0105242_102865342 232
271 3300009177 Ga0105248_10040445 Ga0105248_100404453 232
272 3300009177 Ga0105248_10111124 Ga0105248_101111243 232
273 3300009177 Ga0105248_10219991 Ga0105248_102199911 232
274 3300009545 Ga0105237_10000958 Ga0105237_100009589 232
275 3300009551 Ga0105238_10400253 Ga0105238_104002532 232
276 3300009553 Ga0105249_10086361 Ga0105249_100863613 232
277 3300009553 Ga0105249_10196195 Ga0105249_101961952 232
278 3300010375 Ga0105239_10006535 Ga0105239_1000653511 232
279 3300013296 Ga0157374_10111272 Ga0157374_101112722 232
280 3300013297 Ga0157378_10130216 Ga0157378_101302162 232
281 3300013306 Ga0163162_10037061 Ga0163162_100370613 232
282 3300013308 Ga0157375_10029461 Ga0157375_100294614 232
283 3300013308 Ga0157375_10060766 Ga0157375_100607663 232
284 3300014325 Ga0163163_10191236 Ga0163163_101912363 232
285 3300014325 Ga0163163_10447942 Ga0163163_104479422 232
286 3300014325 Ga0163163_10893621 Ga0163163_108936212 232
287 3300014326 Ga0157380_10010673 Ga0157380_100106734 232
288 3300014968 Ga0157379_10034450 Ga0157379_100344503 232
289 3300014968 Ga0157379_10063043 Ga0157379_100630433 232
290 3300014969 Ga0157376_10052467 Ga0157376_100524673 232
291 3300017792 Ga0163161_10039177 Ga0163161_100391773 232
292 3300017792 Ga0163161_10101436 Ga0163161_101014363 232
293 3300025315 Ga0207697_10022863 Ga0207697_100228631 232
294 3300025321 Ga0207656_10051035 Ga0207656_100510352 232
295 3300025893 Ga0207682_10020370 Ga0207682_100203702 232
296 3300025893 Ga0207682_10032555 Ga0207682_100325552 232
297 3300025893 Ga0207682_10108555 Ga0207682_101085552 232
298 3300025899 Ga0207642_10120686 Ga0207642_101206862 232
299 3300025903 Ga0207680_10019990 Ga0207680_100199904 232
300 3300025903 Ga0207680_10216027 Ga0207680_102160272 232
301 3300025907 Ga0207645_10008823 Ga0207645_100088237 232
302 3300025908 Ga0207643_10035563 Ga0207643_100355632 232
303 3300025909 Ga0207705_10060137 Ga0207705_100601372 232
304 3300025910 Ga0207684_10006858 Ga0207684_100068581 232
305 3300025914 Ga0207671_10004831 Ga0207671_1000483113 232
306 3300025918 Ga0207662_10005876 Ga0207662_100058764 232
307 3300025919 Ga0207657_10158794 Ga0207657_101587942 232
308 3300025920 Ga0207649_10170212 Ga0207649_101702122 232
309 3300025923 Ga0207681_10187604 Ga0207681_101876042 232
310 3300025923 Ga0207681_10213368 Ga0207681_102133682 232
311 3300025925 Ga0207650_10003667 Ga0207650_1000366710 232
312 3300025925 Ga0207650_10062595 Ga0207650_100625953 232
313 3300025925 Ga0207650_10258297 Ga0207650_102582972 232
314 3300025926 Ga0207659_10013906 Ga0207659_100139067 232
315 3300025926 Ga0207659_10024080 Ga0207659_100240803 232
316 3300025926 Ga0207659_10111283 Ga0207659_101112832 232
317 3300025931 Ga0207644_10000360 Ga0207644_1000036020 232
318 3300025931 Ga0207644_10024980 Ga0207644_100249802 232
319 3300025931 Ga0207644_10286181 Ga0207644_102861812 232
320 3300025933 Ga0207706_10078331 Ga0207706_100783313 232
321 3300025934 Ga0207686_10058342 Ga0207686_100583422 232
322 3300025934 Ga0207686_10120280 Ga0207686_101202802 232
323 3300025935 Ga0207709_10028538 Ga0207709_100285383 232
324 3300025935 Ga0207709_10262823 Ga0207709_102628231 232
325 3300025936 Ga0207670_10258672 Ga0207670_102586722 232
326 3300025937 Ga0207669_10029992 Ga0207669_100299922 232
327 3300025939 Ga0207665_10157952 Ga0207665_101579522 232
328 3300025940 Ga0207691_10002225 Ga0207691_1000222517 232
329 3300025940 Ga0207691_10026718 Ga0207691_100267184 232
330 3300025940 Ga0207691_10075841 Ga0207691_100758414 232
331 3300025940 Ga0207691_10179193 Ga0207691_101791932 232
332 3300025940 Ga0207691_10194949 Ga0207691_101949492 232
333 3300025941 Ga0207711_10012084 Ga0207711_100120847 232
334 3300025941 Ga0207711_10068738 Ga0207711_100687383 232
335 3300025942 Ga0207689_10008764 Ga0207689_100087648 232
336 3300025945 Ga0207679_10331541 Ga0207679_103315412 232
337 3300025945 Ga0207679_10462990 Ga0207679_104629902 232
338 3300025960 Ga0207651_10182923 Ga0207651_101829232 232
339 3300025961 Ga0207712_10041716 Ga0207712_100417163 232
340 3300025961 Ga0207712_10042191 Ga0207712_100421912 232
341 3300025961 Ga0207712_10344183 Ga0207712_103441832 232
342 3300025972 Ga0207668_10014922 Ga0207668_100149222 232
343 3300025986 Ga0207658_10015968 Ga0207658_100159684 232
344 3300026023 Ga0207677_10075883 Ga0207677_100758832 232
345 3300026023 Ga0207677_10103839 Ga0207677_101038392 232
346 3300026035 Ga0207703_10016405 Ga0207703_100164054 232
347 3300026041 Ga0207639_10221187 Ga0207639_102211872 232
348 3300026067 Ga0207678_10067290 Ga0207678_100672903 232
349 3300026075 Ga0207708_10019575 Ga0207708_100195754 232
350 3300026088 Ga0207641_10024652 Ga0207641_100246524 232
351 3300026088 Ga0207641_10244169 Ga0207641_102441692 232
352 3300026089 Ga0207648_10017650 Ga0207648_100176502 232
353 3300026089 Ga0207648_10086539 Ga0207648_100865394 232
354 3300026095 Ga0207676_10053196 Ga0207676_100531963 232
355 3300026095 Ga0207676_10153757 Ga0207676_101537572 232
356 3300026095 Ga0207676_10184776 Ga0207676_101847762 232
357 3300026095 Ga0207676_10303559 Ga0207676_103035592 232
358 3300026118 Ga0207675_100005117 Ga0207675_10000511712 232
359 3300026121 Ga0207683_10110011 Ga0207683_101100112 232
360 3300026121 Ga0207683_10134907 Ga0207683_101349072 232
361 3300026121 Ga0207683_10156058 Ga0207683_101560583 232
362 3300026121 Ga0207683_10332643 Ga0207683_103326432 232
363 3300026121 Ga0207683_10518567 Ga0207683_105185671 232
364 3300026142 Ga0207698_10059527 Ga0207698_100595272 232
365 3300026142 Ga0207698_10102215 Ga0207698_101022152 232
366 3300026142 Ga0207698_10335401 Ga0207698_103354012 232
367 3300026142 Ga0207698_10352329 Ga0207698_103523292 232
368 3300026142 Ga0207698_10528706 Ga0207698_105287061 232
369 3300027876 Ga0209974_10017294 Ga0209974_100172942 232
370 3300028380 Ga0268265_10028550 Ga0268265_100285502 232
371 3300028381 Ga0268264_10033475 Ga0268264_100334753 232
372 3300035118 Ga0373954_0102464 Ga0373954_0102464_141_881 232
373 3300035119 Ga0373956_0112478 Ga0373956_0112478_184_924 232
374 3300035170 Ga0373943_0109302 Ga0373943_0109302_502_1242 232
375 3300035171 Ga0373946_0103217 Ga0373946_0103217_174_914 232
376 3300035692 Ga0373935_0102430 Ga0373935_0102430_560_1300 232
377 3300035695 Ga0373927_0255811 Ga0373927_0255811_297_1037 232
378 3300035695 Ga0373927_0260354 Ga0373927_0260354_54_767 232
379 3300035724 Ga0373933_0221824 Ga0373933_0221824_408_1148 232
380 3300035724 Ga0373933_0447879 Ga0373933_0447879_97_819 232
381 3300036401 Ga0373937_0417423 Ga0373937_0417423_105_845 232
382 3300046455 Ga0495603_0152287 Ga0495603_0152287_560_1300 232
383 3300046459 Ga0495629_0242866 Ga0495629_0242866_83_823 232
384 3300046473 Ga0495582_0040706 Ga0495582_0040706_969_1709 232
385 3300046507 Ga0495606_0028883 Ga0495606_0028883_2246_2962 232
386 3300046511 Ga0495608_0234906 Ga0495608_0234906_143_871 232
387 3300046524 Ga0495648_0000833 Ga0495648_0000833_26908_27624 232
388 3300046535 Ga0495586_0190872 Ga0495586_0190872_296_1036 232
389 3300046543 Ga0495645_0018188 Ga0495645_0018188_901_1641 232
390 3300046616 Ga0495668_0018534 Ga0495668_0018534_2447_3163 232
391 3300046679 Ga0495623_0273696 Ga0495623_0273696_12_752 232
392 3300046681 Ga0495647_0089514 Ga0495647_0089514_474_1214 232
393 3300046683 Ga0495658_0021873 Ga0495658_0021873_2031_2753 232
394 3300046683 Ga0495658_0037987 Ga0495658_0037987_320_1060 232
395 3300046689 Ga0495613_0129227 Ga0495613_0129227_143_883 232
396 3300047320 Ga0495672_0001133 Ga0495672_0001133_22426_23142 232
397 3300047469 Ga0495673_0000856 Ga0495673_0000856_17818_18534 232
398 3300048903 Ga0496100_0006224 Ga0496100_0006224_1312_2028 232
399 3300048904 Ga0496101_0000026 Ga0496101_0000026_50235_50951 232
400 3300048905 Ga0496102_0000031 Ga0496102_0000031_51403_52119 232
401 3300048906 Ga0496103_0000025 Ga0496103_0000025_50211_50927 232
402 3300048909 Ga0496106_0016267 Ga0496106_0016267_1344_2060 232
403 3300048910 Ga0496107_0016047 Ga0496107_0016047_875_1591 232
404 3300048911 Ga0496108_0141037 Ga0496108_0141037_429_1157 232
405 3300048912 Ga0496109_0098714 Ga0496109_0098714_575_1297 232
406 3300048917 Ga0496114_0035499 Ga0496114_0035499_1636_2376 232
407 3300048919 Ga0496116_0000084 Ga0496116_0000084_167484_168200 232
408 3300048920 Ga0496117_0000018 Ga0496117_0000018_169480_170196 232
409 3300048921 Ga0496118_0000013 Ga0496118_0000013_309418_310134 232
410 3300048922 Ga0496119_0020835 Ga0496119_0020835_2777_3493 232
411 3300048922 Ga0496119_0032380 Ga0496119_0032380_1657_2373 232
412 3300048923 Ga0496120_0012709 Ga0496120_0012709_664_1380 232
413 3300048924 Ga0496121_0000056 Ga0496121_0000056_50276_50992 232
414 3300048929 Ga0496126_0000089 Ga0496126_0000089_125252_125968 232
415 3300049591 Ga0501075_0167270 Ga0501075_0167270_374_1093 232
416 3300050493 nmdc:mga0k408_104669_c1 nmdc:mga0k408_104669_c1_664_1386 232
417 3300050494 nmdc:mga06z11_128152_c1 nmdc:mga06z11_128152_c1_386_1114 232
418 3300050496 nmdc:mga07m45_35155_c1 nmdc:mga07m45_35155_c1_817_1539 232
419 3300050496 nmdc:mga07m45_4005_c1 nmdc:mga07m45_4005_c1_2833_3555 232
420 3300053077 Ga0495601_0025287 Ga0495601_0025287_2192_2914 232
421 3300053077 Ga0495601_0256133 Ga0495601_0256133_384_1124 232
422 iso_pu_bacteria 2902837492 2902841208 232
423 3300005328 Ga0070676_10040160 Ga0070676_100401603 233
424 3300005329 Ga0070683_100141715 Ga0070683_1001417152 233
425 3300005329 Ga0070683_100213280 Ga0070683_1002132802 233
426 3300005336 Ga0070680_100148058 Ga0070680_1001480583 233
427 3300005337 Ga0070682_100194963 Ga0070682_1001949632 233
428 3300005344 Ga0070661_100032687 Ga0070661_1000326873 233
429 3300005344 Ga0070661_100075252 Ga0070661_1000752522 233
430 3300005353 Ga0070669_100157601 Ga0070669_1001576012 233
431 3300005354 Ga0070675_100131352 Ga0070675_1001313523 233
432 3300005355 Ga0070671_100016856 Ga0070671_1000168564 233
433 3300005366 Ga0070659_100004663 Ga0070659_10000466311 233
434 3300005367 Ga0070667_100097031 Ga0070667_1000970312 233
435 3300005438 Ga0070701_10143547 Ga0070701_101435471 233
436 3300005455 Ga0070663_100061684 Ga0070663_1000616842 233
437 3300005457 Ga0070662_100003483 Ga0070662_1000034832 233
438 3300005467 Ga0070706_100008756 Ga0070706_1000087565 233
439 3300005468 Ga0070707_100361326 Ga0070707_1003613262 233
440 3300005471 Ga0070698_100007972 Ga0070698_1000079725 233
441 3300005471 Ga0070698_100022409 Ga0070698_1000224092 233
442 3300005535 Ga0070684_100720571 Ga0070684_1007205711 233
443 3300005536 Ga0070697_100019641 Ga0070697_1000196414 233
444 3300005539 Ga0068853_100053645 Ga0068853_1000536453 233
445 3300005548 Ga0070665_100612577 Ga0070665_1006125772 233
446 3300005563 Ga0068855_100306222 Ga0068855_1003062222 233
447 3300005577 Ga0068857_100020115 Ga0068857_1000201153 233
448 3300005577 Ga0068857_100109216 Ga0068857_1001092162 233
449 3300005578 Ga0068854_100206891 Ga0068854_1002068912 233
450 3300005614 Ga0068856_100004930 Ga0068856_1000049308 233
451 3300005616 Ga0068852_100095681 Ga0068852_1000956813 233
452 3300005617 Ga0068859_100864943 Ga0068859_1008649432 233
453 3300005719 Ga0068861_100103441 Ga0068861_1001034412 233
454 3300005834 Ga0068851_10013041 Ga0068851_100130413 233
455 3300005834 Ga0068851_10102310 Ga0068851_101023102 233
456 3300005841 Ga0068863_100421627 Ga0068863_1004216272 233
457 3300005841 Ga0068863_100450291 Ga0068863_1004502912 233
458 3300005843 Ga0068860_100033557 Ga0068860_1000335573 233
459 3300006846 Ga0075430_100000248 Ga0075430_10000024826 233
460 3300006847 Ga0075431_100001170 Ga0075431_1000011702 233
461 3300006852 Ga0075433_10002300 Ga0075433_100023005 233
462 3300006871 Ga0075434_100044336 Ga0075434_1000443363 233
463 3300006880 Ga0075429_100000001 Ga0075429_10000000128 233
464 3300006914 Ga0075436_100139808 Ga0075436_1001398082 233
465 3300006931 Ga0097620_100864956 Ga0097620_1008649562 233
466 3300007076 Ga0075435_100189751 Ga0075435_1001897512 233
467 3300009098 Ga0105245_10276799 Ga0105245_102767992 233
468 3300009147 Ga0114129_10151673 Ga0114129_101516733 233
469 3300009147 Ga0114129_10265788 Ga0114129_102657883 233
470 3300009551 Ga0105238_10137813 Ga0105238_101378133 233
471 3300013100 Ga0157373_10060659 Ga0157373_100606592 233
472 3300013104 Ga0157370_10181792 Ga0157370_101817922 233
473 3300013296 Ga0157374_10308977 Ga0157374_103089772 233
474 3300013307 Ga0157372_10007234 Ga0157372_100072349 233
475 3300013308 Ga0157375_10051348 Ga0157375_100513483 233
476 3300014326 Ga0157380_10161708 Ga0157380_101617082 233
477 3300014745 Ga0157377_10069435 Ga0157377_100694352 233
478 3300014968 Ga0157379_10007204 Ga0157379_100072042 233
479 3300014968 Ga0157379_10114488 Ga0157379_101144883 233
480 3300014969 Ga0157376_10105671 Ga0157376_101056713 233
481 3300017792 Ga0163161_10058711 Ga0163161_100587113 233
482 3300025893 Ga0207682_10089295 Ga0207682_100892952 233
483 3300025901 Ga0207688_10101630 Ga0207688_101016303 233
484 3300025907 Ga0207645_10029751 Ga0207645_100297513 233
485 3300025910 Ga0207684_10047347 Ga0207684_100473472 233
486 3300025910 Ga0207684_10314099 Ga0207684_103140991 233
487 3300025917 Ga0207660_10107561 Ga0207660_101075612 233
488 3300025919 Ga0207657_10051810 Ga0207657_100518103 233
489 3300025921 Ga0207652_10041922 Ga0207652_100419222 233
490 3300025922 Ga0207646_10003828 Ga0207646_100038286 233
491 3300025926 Ga0207659_10100152 Ga0207659_101001522 233
492 3300025931 Ga0207644_10005934 Ga0207644_100059347 233
493 3300025932 Ga0207690_10075785 Ga0207690_100757852 233
494 3300025933 Ga0207706_10029157 Ga0207706_100291573 233
495 3300025940 Ga0207691_10007668 Ga0207691_100076689 233
496 3300025942 Ga0207689_10002313 Ga0207689_1000231317 233
497 3300025944 Ga0207661_10337522 Ga0207661_103375222 233
498 3300025945 Ga0207679_10191127 Ga0207679_101911272 233
499 3300026035 Ga0207703_10065929 Ga0207703_100659292 233
500 3300026035 Ga0207703_10200556 Ga0207703_102005562 233
501 3300026041 Ga0207639_10060734 Ga0207639_100607343 233
502 3300026067 Ga0207678_10045486 Ga0207678_100454863 233
503 3300026088 Ga0207641_10157530 Ga0207641_101575302 233
504 3300026089 Ga0207648_10665670 Ga0207648_106656702 233
505 3300026095 Ga0207676_10328670 Ga0207676_103286702 233
506 3300026116 Ga0207674_10022988 Ga0207674_100229884 233
507 3300026116 Ga0207674_10101455 Ga0207674_101014552 233
508 3300026118 Ga0207675_100003645 Ga0207675_10000364512 233
509 3300026142 Ga0207698_10150004 Ga0207698_101500042 233
510 3300028379 Ga0268266_10531913 Ga0268266_105319132 233
511 3300031548 Ga0307408_100240680 Ga0307408_1002406802 233
512 3300031852 Ga0307410_10157981 Ga0307410_101579812 233
513 3300031903 Ga0307407_10092469 Ga0307407_100924692 233
514 3300031911 Ga0307412_10026475 Ga0307412_100264753 233
515 3300031995 Ga0307409_100105829 Ga0307409_1001058292 233
516 3300032002 Ga0307416_100003176 Ga0307416_1000031767 233
517 3300032005 Ga0307411_10173873 Ga0307411_101738732 233
518 3300032126 Ga0307415_100137194 Ga0307415_1001371943 233
519 3300035084 Ga0373928_0055213 Ga0373928_0055213_129_854 233
520 3300037312 Ga0395899_0132320 Ga0395899_0132320_664_1383 233
521 3300037418 Ga0395900_0024502 Ga0395900_0024502_678_1397 233
522 3300037466 Ga0395898_0009183 Ga0395898_0009183_2862_3581 233
523 3300038443 Ga0395901_0035138 Ga0395901_0035138_420_1139 233
524 3300039450 Ga0436363_0460634 Ga0436363_0460634_443_1144 233
525 3300045051 Ga0451576_0553619 Ga0451576_0553619_280_1002 233
526 3300048904 Ga0496101_0066482 Ga0496101_0066482_892_1617 233
527 3300048905 Ga0496102_0262822 Ga0496102_0262822_557_1282 233
528 3300048908 Ga0496105_0215579 Ga0496105_0215579_133_858 233
529 3300048909 Ga0496106_0155013 Ga0496106_0155013_147_872 233
530 3300048910 Ga0496107_0110352 Ga0496107_0110352_237_962 233
531 3300048915 Ga0496112_0075635 Ga0496112_0075635_513_1238 233
532 3300048917 Ga0496114_0038925 Ga0496114_0038925_217_942 233
533 3300048918 Ga0496115_0229450 Ga0496115_0229450_791_1516 233
534 3300050507 nmdc:mga05p37_319019_c1 nmdc:mga05p37_319019_c1_525_1241 233
535 3300050507 nmdc:mga05p37_76654_c1 nmdc:mga05p37_76654_c1_3196_3915 233
536 3300050508 nmdc:mga09592_21395_c1 nmdc:mga09592_21395_c1_347_1066 233
537 3300050509 nmdc:mga0qj67_2840_c1 nmdc:mga0qj67_2840_c1_8075_8794 233
538 3300050510 nmdc:mga06r32_1957_c1 nmdc:mga06r32_1957_c1_17441_18160 233
539 3300050512 nmdc:mga0n895_11206_c1 nmdc:mga0n895_11206_c1_4159_4875 233
540 3300050513 nmdc:mga0rr50_177709_c1 nmdc:mga0rr50_177709_c1_408_1124 233
541 3300050514 nmdc:mga08x19_35324_c1 nmdc:mga08x19_35324_c1_1864_2580 233
542 3300050515 nmdc:mga0a205_185_c2 nmdc:mga0a205_185_c2_22058_22774 233
543 3300053078 Ga0495612_0075367 Ga0495612_0075367_13_777 233
544 3300000545 CNXas_1001378 CNXas_10013782 234
545 3300003792 Ga0055540_1002957 Ga0055540_10029573 234
546 3300003792 Ga0055540_1004305 Ga0055540_10043056 234
547 3300005337 Ga0070682_100230557 Ga0070682_1002305572 234
548 3300005338 Ga0068868_100149592 Ga0068868_1001495922 234
549 3300005339 Ga0070660_100361189 Ga0070660_1003611892 234
550 3300005367 Ga0070667_100332424 Ga0070667_1003324242 234
551 3300005455 Ga0070663_100088922 Ga0070663_1000889223 234
552 3300005617 Ga0068859_100804906 Ga0068859_1008049061 234
553 3300005618 Ga0068864_100244678 Ga0068864_1002446782 234
554 3300005842 Ga0068858_100019774 Ga0068858_1000197747 234
555 3300006028 Ga0070717_10368781 Ga0070717_103687812 234
556 3300006048 Ga0075363_100139819 Ga0075363_1001398192 234
557 3300006173 Ga0070716_100035964 Ga0070716_1000359642 234
558 3300006186 Ga0075369_10037718 Ga0075369_100377182 234
559 3300006844 Ga0075428_100001546 Ga0075428_1000015468 234
560 3300006846 Ga0075430_100006144 Ga0075430_10000614410 234
561 3300006847 Ga0075431_100219224 Ga0075431_1002192242 234
562 3300006931 Ga0097620_100805005 Ga0097620_1008050051 234
563 3300009094 Ga0111539_10666156 Ga0111539_106661562 234
564 3300009147 Ga0114129_10010984 Ga0114129_1001098410 234
565 3300013307 Ga0157372_10826900 Ga0157372_108269002 234
566 3300025303 Ga0209051_1001007 Ga0209051_100100710 234
567 3300025303 Ga0209051_1003186 Ga0209051_10031867 234
568 3300025303 Ga0209051_1053200 Ga0209051_10532002 234
569 3300025900 Ga0207710_10000056 Ga0207710_1000005665 234
570 3300025923 Ga0207681_10025799 Ga0207681_100257992 234
571 3300025939 Ga0207665_10135222 Ga0207665_101352222 234
572 3300025981 Ga0207640_10055476 Ga0207640_100554762 234
573 3300025986 Ga0207658_10204100 Ga0207658_102041002 234
574 3300026035 Ga0207703_10041922 Ga0207703_100419222 234
575 3300026041 Ga0207639_10089738 Ga0207639_100897384 234
576 3300026067 Ga0207678_10180056 Ga0207678_101800562 234
577 3300026095 Ga0207676_10828196 Ga0207676_108281962 234
578 3300028379 Ga0268266_10523804 Ga0268266_105238042 234
579 3300048909 Ga0496106_0421502 Ga0496106_0421502_288_992 234
580 3300048914 Ga0496111_0160002 Ga0496111_0160002_925_1629 234
581 3300048915 Ga0496112_0021084 Ga0496112_0021084_2527_3231 234
582 3300050491 nmdc:mga00v17_46657_c1 nmdc:mga00v17_46657_c1_774_1481 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

92

218

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

23

212

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3umg-assembly2.cif.gz_C crystal structure of the defluorinating l-2-haloacid dehalogenase rha0230 0.9642 1 234
3umg-assembly2.cif.gz_C crystal structure of the defluorinating l-2-haloacid dehalogenase rha0230 0.9601 1 234
3umc-assembly2.cif.gz_D crystal structure of the l-2-haloacid dehalogenase pa0810 0.9584 3 233
3umc-assembly1.cif.gz_C crystal structure of the l-2-haloacid dehalogenase pa0810 0.9577 3 232
3umc-assembly2.cif.gz_D crystal structure of the l-2-haloacid dehalogenase pa0810 0.9502 3 233
ID Description Score Start End Superfamily
3umgH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9621 2 232 3.40.50.1000
3umcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9491 4 234 3.40.50.1000
3umgH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9448 35 99 1.10.150.240
3umgE02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.943 35 99 1.10.150.240
3umgB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9409 35 99 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A5Q5BDM8-F1-model_v4 Haloacid dehalogenase, type II 0.995 6 207 GO:0019120
AF-A0A7Y4PVT4-F1-model_v4 deleted 0.9926 3 234
AF-X5L739-F1-model_v4 deleted 0.9902 109 234
AF-A0A382TDR6-F1-model_v4 Haloacid dehalogenase, type II 0.9891 3 170
AF-A0A2S8ME79-F1-model_v4 deleted 0.9882 59 234

Feature Viewer

pLDDT pTM Quality
95.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map