F466248

General Info

Members Datasets Scaffolds Average Seq Length
583 319 1166 392

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100052576|Ga0070714_1000525762
Length 413
Sequence MPINLETPKKFNQLISQAHQVAAEILRPNSRKYDTLEHEYPKELDMLAAAIDGLNEGGALGGAGAGAVGTNGSSPATKKKADEGANRNGSNMASLVGLIEMCWGDVGLLLAMPRQGLGQAAIAAVANEEQLQRFGGKWAAMAITEPEAGSDSAAIRTTATLDEATGDYILNGEKIFVTSGDRAELIVVWATLDRSQGRAAIKSFVVERDNPGLKLDRLEHKLGIRASDTANFVLQDCRVPKENLLGSPEIAPKGGFSGVMQTFDNTRPLVAGMAIGVARACLEDTRDHLQSAGIEIDYNLPPHLQSAAAAEFIAMEADWEAARLLTLQAAWMADNKKPNSLQASMAKAKAGRMGTEIALRCVALCGATGFGEGELMEKWARDAKILDLFEGTQQIQLLIIARQLLGKTSAELK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
165 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
166 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
295 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
296 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 2582580736 Prauserella sp. Am3 Isolate Unclassified
304 2643221615 Nocardioides sp. Root224 Isolate Unclassified
305 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
306 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
307 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
308 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
309 2739367898 Nocardioides sp. CF479 Isolate Unclassified
310 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
311 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
312 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
313 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
314 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
315 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
316 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
317 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
318 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
319 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.17
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0
Rhizoplane 7.38
Rhizosphere 79.25
Stem 0
Stem Tuber 0.17
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100052576 3300005435 Bacteria 3474
2 JGI24746J21847_1000677 3300001977 Bacteria 5215
3 JGI24740J21852_10026424 3300001979 Bacteria 1945
4 JGI24739J22299_10022631 3300001989 Bacteria 2228
5 JGI24735J21928_10015421 3300002067 Bacteria 2384
6 JGI24748J21848_1000895 3300002074 Bacteria 3227
7 JGI24034J26672_10000136 3300002239 Bacteria 10868
8 JGI25406J46586_10001784 3300003203 Bacteria 10117
9 Ga0070658_10006849 3300005327 Bacteria 9212
10 Ga0070658_10038129 3300005327 Bacteria 3876
11 Ga0070658_10088812 3300005327 Bacteria 2545
12 Ga0070683_100000641 3300005329 Bacteria 25186
13 Ga0070683_100002592 3300005329 Bacteria 14452
14 Ga0070683_100019348 3300005329 Bacteria 6046
15 Ga0070683_100045129 3300005329 Bacteria 4068
16 Ga0070683_100240051 3300005329 Bacteria 1723
17 Ga0070666_10016832 3300005335 Bacteria 4681
18 Ga0070682_100000117 3300005337 Bacteria 69662
19 Ga0070682_100001006 3300005337 Bacteria 16317
20 Ga0070682_100047031 3300005337 Bacteria 2680
21 Ga0068868_100000878 3300005338 Bacteria 20396
22 Ga0070660_100002223 3300005339 Bacteria 13368
23 Ga0070660_100051008 3300005339 Bacteria 3185
24 Ga0070689_100114918 3300005340 Bacteria 2145
25 Ga0070661_100001375 3300005344 Bacteria 16996
26 Ga0070661_100013239 3300005344 Bacteria 5789
27 Ga0070692_10000576 3300005345 Bacteria 11521
28 Ga0070692_10001979 3300005345 Bacteria 7760
29 Ga0070668_100012580 3300005347 Bacteria 6302
30 Ga0070669_100013344 3300005353 Bacteria 5840
31 Ga0070675_100000111 3300005354 Bacteria 47699
32 Ga0070675_100041648 3300005354 Bacteria 3751
33 Ga0070671_100106756 3300005355 Bacteria 2351
34 Ga0070673_100001567 3300005364 Bacteria 13472
35 Ga0070673_100011909 3300005364 Bacteria 5957
36 Ga0070659_100000002 3300005366 Bacteria 369239
37 Ga0070659_100004130 3300005366 Bacteria 10350
38 Ga0070659_100038648 3300005366 Bacteria 3723
39 Ga0070667_100009407 3300005367 Bacteria 8107
40 Ga0070714_100000019 3300005435 Bacteria 169455
41 Ga0070714_100003420 3300005435 Bacteria 11825
42 Ga0070714_100023646 3300005435 Bacteria 5052
43 Ga0070714_100030746 3300005435 Bacteria 4473
44 Ga0070714_100148679 3300005435 Bacteria 2109
45 Ga0070713_100000390 3300005436 Bacteria 28149
46 Ga0070713_100057834 3300005436 Bacteria 3230
47 Ga0070710_10000006 3300005437 Bacteria 217422
48 Ga0070700_100011326 3300005441 Bacteria 4936
49 Ga0070663_100036165 3300005455 Bacteria 3430
50 Ga0070678_100183974 3300005456 Bacteria 1713
51 Ga0070662_100001863 3300005457 Bacteria 12915
52 Ga0070681_10025949 3300005458 Bacteria 5891
53 Ga0068867_100145468 3300005459 Bacteria 1857
54 Ga0070698_100002059 3300005471 Bacteria 22349
55 Ga0070679_100000068 3300005530 Bacteria 77184
56 Ga0070679_100007291 3300005530 Bacteria 10328
57 Ga0070679_100009133 3300005530 Bacteria 9358
58 Ga0070684_100002845 3300005535 Bacteria 12858
59 Ga0070684_100006126 3300005535 Bacteria 9269
60 Ga0070684_100011369 3300005535 Bacteria 7089
61 Ga0068853_100037768 3300005539 Bacteria 4111
62 Ga0070672_100000015 3300005543 Bacteria 72591
63 Ga0070672_100010387 3300005543 Bacteria 6458
64 Ga0070686_100047303 3300005544 Bacteria 2720
65 Ga0070693_100001745 3300005547 Bacteria 9896
66 Ga0070665_100000106 3300005548 Bacteria 157315
67 Ga0070665_100001502 3300005548 Bacteria 27146
68 Ga0070665_100008940 3300005548 Bacteria 10150
69 Ga0070665_100217255 3300005548 Bacteria 1912
70 Ga0070664_100034103 3300005564 Bacteria 4269
71 Ga0070664_100306580 3300005564 Bacteria 1436
72 Ga0068857_100005857 3300005577 Bacteria 10494
73 Ga0068857_100027364 3300005577 Bacteria 5031
74 Ga0068857_100193749 3300005577 Bacteria 1851
75 Ga0068854_100000183 3300005578 Bacteria 42525
76 Ga0068856_100000757 3300005614 Bacteria 35080
77 Ga0068856_100033907 3300005614 Bacteria 4999
78 Ga0070702_100033692 3300005615 Bacteria 2819
79 Ga0070702_100055460 3300005615 Bacteria 2285
80 Ga0068852_100000093 3300005616 Bacteria 60834
81 Ga0068852_100057097 3300005616 Bacteria 3376
82 Ga0068864_100000053 3300005618 Bacteria 133049
83 Ga0068864_100003161 3300005618 Bacteria 13614
84 Ga0068851_10011784 3300005834 Bacteria 4107
85 Ga0068851_10027612 3300005834 Bacteria 2798
86 Ga0068863_100003824 3300005841 Bacteria 14883
87 Ga0068863_100023158 3300005841 Bacteria 5935
88 Ga0068858_100000009 3300005842 Bacteria 237748
89 Ga0068858_100000091 3300005842 Bacteria 93802
90 Ga0068860_100000400 3300005843 Bacteria 56882
91 Ga0068860_100055881 3300005843 Bacteria 3753
92 Ga0081455_10000112 3300005937 Bacteria 92158
93 Ga0081455_10028530 3300005937 Bacteria 5099
94 Ga0081455_10089101 3300005937 Bacteria 2505
95 Ga0081540_1000049 3300005983 Bacteria 127322
96 Ga0081539_10000086 3300005985 Bacteria 217801
97 Ga0081539_10002609 3300005985 Bacteria 24708
98 Ga0081539_10040313 3300005985 Bacteria 2742
99 Ga0070717_10000005 3300006028 Bacteria 357819
100 Ga0070717_10000352 3300006028 Bacteria 29608
101 Ga0070717_10038928 3300006028 Bacteria 3866
102 Ga0070717_10083720 3300006028 Bacteria 2683
103 Ga0075365_10003743 3300006038 Bacteria 7914
104 Ga0075365_10044988 3300006038 Bacteria 2895
105 Ga0075365_10059039 3300006038 Bacteria 2555
106 Ga0075365_10145185 3300006038 Bacteria 1648
107 Ga0075365_10150161 3300006038 Bacteria 1621
108 Ga0075368_10049932 3300006042 Bacteria 1660
109 Ga0075368_10067331 3300006042 Bacteria 1441
110 Ga0075363_100000378 3300006048 Bacteria 13459
111 Ga0075363_100021867 3300006048 Bacteria 3228
112 Ga0075364_10008289 3300006051 Bacteria 6207
113 Ga0075364_10008329 3300006051 Bacteria 6191
114 Ga0070712_100000007 3300006175 Bacteria 157653
115 Ga0070712_100002695 3300006175 Bacteria 10963
116 Ga0070712_100008485 3300006175 Bacteria 6466
117 Ga0075362_10003323 3300006177 Bacteria 5605
118 Ga0075367_10012558 3300006178 Bacteria 4523
119 Ga0075370_10000475 3300006353 Bacteria 15085
120 Ga0075370_10001223 3300006353 Bacteria 10870
121 Ga0075428_100121351 3300006844 Bacteria 2846
122 Ga0075430_100012368 3300006846 Bacteria 7259
123 Ga0075429_100003759 3300006880 Bacteria 12941
124 Ga0068865_100001277 3300006881 Bacteria 14651
125 Ga0068865_100039288 3300006881 Bacteria 3209
126 Ga0105240_10108860 3300009093 Bacteria 3356
127 Ga0111539_10099425 3300009094 Bacteria 3416
128 Ga0111539_10364164 3300009094 Bacteria 1683
129 Ga0105245_10001831 3300009098 Bacteria 19354
130 Ga0105245_10001895 3300009098 Bacteria 18997
131 Ga0105245_10024675 3300009098 Bacteria 5282
132 Ga0105245_10039587 3300009098 Bacteria 4196
133 Ga0105245_10050223 3300009098 Bacteria 3736
134 Ga0105245_10099935 3300009098 Bacteria 2683
135 Ga0105245_10205720 3300009098 Bacteria 1892
136 Ga0114129_10371161 3300009147 Bacteria 1891
137 Ga0105243_10002147 3300009148 Bacteria 16657
138 Ga0105243_10009602 3300009148 Bacteria 7367
139 Ga0105243_10154308 3300009148 Bacteria 1973
140 Ga0105242_10002368 3300009176 Bacteria 14878
141 Ga0105242_10038851 3300009176 Bacteria 3830
142 Ga0105242_10219474 3300009176 Bacteria 1698
143 Ga0105248_10000008 3300009177 Bacteria 403910
144 Ga0105248_10270004 3300009177 Bacteria 1915
145 Ga0105238_10000011 3300009551 Bacteria 261080
146 Ga0105249_10109885 3300009553 Bacteria 2604
147 Ga0105249_10113743 3300009553 Bacteria 2561
148 Ga0105249_10148463 3300009553 Bacteria 2254
149 Ga0105239_10050812 3300010375 Bacteria 4545
150 Ga0105239_10056910 3300010375 Bacteria 4289
151 Ga0105239_10073144 3300010375 Bacteria 3768
152 Ga0105239_10102334 3300010375 Bacteria 3170
153 Ga0105246_10001248 3300011119 Bacteria 14931
154 Ga0105246_10008649 3300011119 Bacteria 6260
155 Ga0105246_10132755 3300011119 Bacteria 1862
156 Ga0157371_10072030 3300013102 Bacteria 2447
157 Ga0157370_10073477 3300013104 Bacteria 3226
158 Ga0157369_10000110 3300013105 Bacteria 115514
159 Ga0157374_10165305 3300013296 Bacteria 2156
160 Ga0157374_10523449 3300013296 Bacteria 1192
161 Ga0157378_10031281 3300013297 Bacteria 4701
162 Ga0157378_10042428 3300013297 Bacteria 4038
163 Ga0163162_10032523 3300013306 Bacteria 5182
164 Ga0163162_10133134 3300013306 Bacteria 2596
165 Ga0163162_10482755 3300013306 Bacteria 1371
166 Ga0157372_10001384 3300013307 Bacteria 26176
167 Ga0157372_10003488 3300013307 Bacteria 16951
168 Ga0157375_10026372 3300013308 Bacteria 5413
169 Ga0157375_10039653 3300013308 Bacteria 4535
170 Ga0157380_10000843 3300014326 Bacteria 19177
171 Ga0157377_10024159 3300014745 Bacteria 3228
172 Ga0157379_10159632 3300014968 Bacteria 2035
173 Ga0157376_10064613 3300014969 Bacteria 3087
174 Ga0213873_10015371 3300021358 Bacteria 1713
175 Ga0213876_10060287 3300021384 Bacteria 2002
176 Ga0213876_10068727 3300021384 Bacteria 1871
177 Ga0213875_10041266 3300021388 Bacteria 2171
178 Ga0224712_10044474 3300022467 Bacteria 1694
179 Ga0207656_10002156 3300025321 Bacteria 6575
180 Ga0207656_10002232 3300025321 Bacteria 6488
181 Ga0207656_10022538 3300025321 Bacteria 2528
182 Ga0207692_10000001 3300025898 Bacteria 558345
183 Ga0207688_10010454 3300025901 Bacteria 5051
184 Ga0207688_10012057 3300025901 Bacteria 4702
185 Ga0207705_10039266 3300025909 Bacteria 3392
186 Ga0207705_10050406 3300025909 Bacteria 2997
187 Ga0207705_10076394 3300025909 Bacteria 2435
188 Ga0207705_10083163 3300025909 Bacteria 2335
189 Ga0207707_10011031 3300025912 Bacteria 7863
190 Ga0207695_10226847 3300025913 Bacteria 1774
191 Ga0207693_10000001 3300025915 Bacteria 469535
192 Ga0207693_10004920 3300025915 Bacteria 11224
193 Ga0207693_10006065 3300025915 Bacteria 10009
194 Ga0207663_10079161 3300025916 Bacteria 2145
195 Ga0207660_10013455 3300025917 Bacteria 5362
196 Ga0207662_10023772 3300025918 Bacteria 3523
197 Ga0207662_10088563 3300025918 Bacteria 1901
198 Ga0207657_10000475 3300025919 Bacteria 42310
199 Ga0207649_10004012 3300025920 Bacteria 8019
200 Ga0207649_10026695 3300025920 Bacteria 3380
201 Ga0207652_10000044 3300025921 Bacteria 127779
202 Ga0207652_10057318 3300025921 Bacteria 3355
203 Ga0207646_10287884 3300025922 Bacteria 1485
204 Ga0207681_10008037 3300025923 Bacteria 6456
205 Ga0207694_10000004 3300025924 Bacteria 967075
206 Ga0207650_10040316 3300025925 Bacteria 3417
207 Ga0207659_10000010 3300025926 Bacteria 286639
208 Ga0207659_10026112 3300025926 Bacteria 3937
209 Ga0207687_10000007 3300025927 Bacteria 604185
210 Ga0207687_10001023 3300025927 Bacteria 18981
211 Ga0207687_10002454 3300025927 Bacteria 12584
212 Ga0207687_10005746 3300025927 Bacteria 8211
213 Ga0207687_10030821 3300025927 Bacteria 3619
214 Ga0207700_10000027 3300025928 Bacteria 137708
215 Ga0207700_10152818 3300025928 Bacteria 1909
216 Ga0207664_10000008 3300025929 Bacteria 309301
217 Ga0207664_10000529 3300025929 Bacteria 27133
218 Ga0207664_10012473 3300025929 Bacteria 6078
219 Ga0207664_10032387 3300025929 Bacteria 4005
220 Ga0207664_10044110 3300025929 Bacteria 3490
221 Ga0207664_10125303 3300025929 Bacteria 2156
222 Ga0207690_10000088 3300025932 Bacteria 76762
223 Ga0207690_10005795 3300025932 Bacteria 7306
224 Ga0207706_10004835 3300025933 Bacteria 12615
225 Ga0207686_10000048 3300025934 Bacteria 115595
226 Ga0207670_10020188 3300025936 Bacteria 4089
227 Ga0207670_10023297 3300025936 Bacteria 3853
228 Ga0207704_10000093 3300025938 Bacteria 52224
229 Ga0207704_10009888 3300025938 Bacteria 4625
230 Ga0207691_10000044 3300025940 Bacteria 100027
231 Ga0207691_10022858 3300025940 Bacteria 5894
232 Ga0207711_10000006 3300025941 Bacteria 792692
233 Ga0207661_10001262 3300025944 Bacteria 16919
234 Ga0207661_10010771 3300025944 Bacteria 6592
235 Ga0207661_10018784 3300025944 Bacteria 5142
236 Ga0207661_10040792 3300025944 Bacteria 3651
237 Ga0207661_10087624 3300025944 Bacteria 2586
238 Ga0207679_10033917 3300025945 Bacteria 3596
239 Ga0207679_10252051 3300025945 Bacteria 1501
240 Ga0207651_10021082 3300025960 Bacteria 3950
241 Ga0207712_10016409 3300025961 Bacteria 4795
242 Ga0207668_10221809 3300025972 Bacteria 1519
243 Ga0207640_10000200 3300025981 Bacteria 42738
244 Ga0207658_10003525 3300025986 Bacteria 11041
245 Ga0207658_10052319 3300025986 Bacteria 3013
246 Ga0207677_10003263 3300026023 Bacteria 8568
247 Ga0207703_10000023 3300026035 Bacteria 222018
248 Ga0207703_10000152 3300026035 Bacteria 79658
249 Ga0207639_10027752 3300026041 Bacteria 4127
250 Ga0207639_10040770 3300026041 Bacteria 3468
251 Ga0207678_10014283 3300026067 Bacteria 6982
252 Ga0207678_10065920 3300026067 Bacteria 3109
253 Ga0207708_10000842 3300026075 Bacteria 23094
254 Ga0207702_10000060 3300026078 Bacteria 125473
255 Ga0207702_10003333 3300026078 Bacteria 14742
256 Ga0207702_10027029 3300026078 Bacteria 4765
257 Ga0207702_10061229 3300026078 Bacteria 3210
258 Ga0207648_10071310 3300026089 Bacteria 3028
259 Ga0207676_10000094 3300026095 Bacteria 80575
260 Ga0207674_10001502 3300026116 Bacteria 30105
261 Ga0207674_10040696 3300026116 Bacteria 4813
262 Ga0207675_100060076 3300026118 Bacteria 3548
263 Ga0207683_10170782 3300026121 Bacteria 1969
264 Ga0207683_10196375 3300026121 Bacteria 1833
265 Ga0207683_10202083 3300026121 Bacteria 1807
266 Ga0207698_10000440 3300026142 Bacteria 23916
267 Ga0207698_10052617 3300026142 Bacteria 3121
268 Ga0209813_10002809 3300027866 Bacteria 4025
269 Ga0209813_10030764 3300027866 Bacteria 1580
270 Ga0268266_10000047 3300028379 Bacteria 310996
271 Ga0268266_10000285 3300028379 Bacteria 83300
272 Ga0268266_10005034 3300028379 Bacteria 12475
273 Ga0268266_10379628 3300028379 Bacteria 1333
274 Ga0268264_10046651 3300028381 Bacteria 3599
275 Ga0265326_10000003 3300028558 Bacteria 479811
276 Ga0265319_1000664 3300028563 Bacteria 22595
277 Ga0265336_10004622 3300028666 Bacteria 5167
278 Ga0307515_10080725 3300028794 Bacteria 4236
279 Ga0307515_10149740 3300028794 Bacteria 2447
280 Ga0265338_10000844 3300028800 Bacteria 51666
281 Ga0265324_10001900 3300029957 Bacteria 11228
282 Ga0307513_10012431 3300031456 Bacteria 10506
283 Ga0307508_10239324 3300031616 Bacteria 1413
284 Ga0307413_10005794 3300031824 Bacteria 5562
285 Ga0307409_100033771 3300031995 Bacteria 3727
286 Ga0307416_100193848 3300032002 Bacteria 1920
287 Ga0307414_10061438 3300032004 Bacteria 2662
288 Ga0307415_100003742 3300032126 Bacteria 7793
289 Ga0307415_100041426 3300032126 Bacteria 3058
290 Ga0307507_10002484 3300033179 Bacteria 38535
291 Ga0373953_0052238 3300035117 Bacteria 1654
292 Ga0373937_0022173 3300036401 Bacteria 5706
293 Ga0373937_0177048 3300036401 Bacteria 2002
294 Ga0395900_0092948 3300037418 Bacteria 3099
295 Ga0395898_0004969 3300037466 Bacteria 14430
296 Ga0436364_0112430 3300037853 Bacteria 46821
297 Ga0400485_08597 3300038735 Bacteria 35424
298 Ga0400488_44500 3300038741 Bacteria 7837
299 Ga0400486_21500 3300038742 Bacteria 94371
300 Ga0436365_0018303 3300039437 Bacteria 2255
301 Ga0436365_0131291 3300039437 Bacteria 43697
302 Ga0436365_0457026 3300039437 Bacteria 17369
303 Ga0436365_1486515 3300039437 Bacteria 5350
304 Ga0436365_1691212 3300039437 Bacteria 5902
305 Ga0436360_0079068 3300039438 Bacteria 1601
306 Ga0436363_0334812 3300039450 Bacteria 1366
307 Ga0436363_0932759 3300039450 Bacteria 40920
308 Ga0436363_0970724 3300039450 Bacteria 6811
309 Ga0436362_0215426 3300039453 Bacteria 3173
310 Ga0439436_0007563 3300041404 Bacteria 3342
311 Ga0439438_028297 3300041405 Bacteria 1508
312 Ga0439447_000769 3300041407 Bacteria 11818
313 Ga0439466_0001145 3300041411 Bacteria 10310
314 Ga0451853_4057189 3300041512 Bacteria 2563
315 Ga0439432_002550 3300042006 Bacteria 6868
316 Ga0439452_001054 3300042010 Bacteria 12161
317 Ga0439446_0000840 3300042156 Bacteria 6571
318 Ga0439434_0000780 3300042435 Bacteria 9163
319 Ga0451577_0001435 3300042876 Bacteria 31732
320 Ga0466969_0001191 3300044656 Bacteria 14062
321 Ga0466969_0040728 3300044656 Bacteria 2327
322 Ga0466966_0016687 3300044684 Bacteria 4851
323 Ga0466966_0089662 3300044684 Bacteria 1910
324 Ga0466961_0002800 3300044693 Bacteria 10849
325 Ga0466961_0015150 3300044693 Bacteria 4950
326 Ga0466961_0016137 3300044693 Bacteria 4796
327 Ga0466963_0000510 3300044694 Bacteria 18138
328 Ga0466963_0005861 3300044694 Bacteria 7240
329 Ga0466963_0020021 3300044694 Bacteria 4205
330 Ga0466963_0084469 3300044694 Bacteria 2154
331 Ga0466963_0088228 3300044694 Bacteria 2110
332 Ga0466963_0112747 3300044694 Bacteria 1867
333 Ga0466964_0019908 3300044706 Bacteria 2582
334 Ga0466968_0041509 3300044735 Bacteria 1942
335 Ga0466970_0021172 3300044765 Bacteria 3386
336 Ga0466970_0071264 3300044765 Bacteria 1869
337 Ga0466970_0153435 3300044765 Bacteria 1272
338 Ga0466957_0019515 3300044842 Bacteria 3987
339 Ga0466957_0021361 3300044842 Bacteria 3813
340 Ga0466957_0050730 3300044842 Bacteria 2525
341 Ga0466957_0054239 3300044842 Bacteria 2446
342 Ga0466960_0000222 3300044901 Bacteria 19771
343 Ga0466960_0002576 3300044901 Bacteria 6814
344 Ga0466960_0015176 3300044901 Bacteria 3316
345 Ga0466960_0043509 3300044901 Bacteria 2136
346 Ga0466959_0002073 3300045049 Bacteria 12682
347 Ga0466959_0009424 3300045049 Bacteria 6946
348 Ga0466959_0016457 3300045049 Bacteria 5404
349 Ga0466959_0028418 3300045049 Bacteria 4147
350 Ga0466959_0050133 3300045049 Bacteria 3066
351 Ga0466959_0057183 3300045049 Bacteria 2844
352 Ga0466958_0005046 3300045836 Bacteria 7050
353 Ga0466958_0013922 3300045836 Bacteria 4587
354 Ga0466958_0050862 3300045836 Bacteria 2508
355 Ga0466967_0000478 3300045976 Bacteria 19384
356 Ga0466967_0028857 3300045976 Bacteria 4638
357 Ga0466967_0043094 3300045976 Bacteria 3906
358 Ga0466967_0050219 3300045976 Bacteria 3651
359 Ga0466967_0055985 3300045976 Bacteria 3475
360 Ga0466967_0082168 3300045976 Bacteria 2911
361 Ga0466967_0127720 3300045976 Bacteria 2357
362 Ga0495592_0101174 3300046454 Bacteria 2054
363 Ga0495592_0132251 3300046454 Bacteria 1744
364 Ga0495629_0005201 3300046459 Bacteria 9743
365 Ga0495638_0037115 3300046460 Bacteria 3101
366 Ga0495641_0000874 3300046461 Bacteria 25824
367 Ga0495641_0088801 3300046461 Bacteria 1382
368 Ga0495651_0119930 3300046462 Bacteria 1934
369 Ga0495653_0035665 3300046463 Bacteria 3923
370 Ga0495580_0016747 3300046472 Bacteria 5500
371 Ga0495639_0084345 3300046475 Bacteria 1484
372 Ga0495606_0000565 3300046507 Bacteria 58752
373 Ga0495608_0000068 3300046511 Bacteria 79694
374 Ga0495608_0020646 3300046511 Bacteria 4525
375 Ga0495628_0121590 3300046516 Bacteria 2002
376 Ga0495628_0123099 3300046516 Bacteria 1988
377 Ga0495630_0000056 3300046517 Bacteria 91477
378 Ga0495630_0034134 3300046517 Bacteria 3797
379 Ga0495630_0064261 3300046517 Bacteria 2757
380 Ga0495652_0004685 3300046529 Bacteria 13047
381 Ga0495652_0083622 3300046529 Bacteria 2627
382 Ga0495640_0106975 3300046533 Bacteria 1831
383 Ga0495645_0002246 3300046543 Bacteria 13145
384 Ga0495645_0018914 3300046543 Bacteria 4954
385 Ga0495645_0162027 3300046543 Bacteria 1546
386 Ga0495667_0189895 3300046559 Bacteria 1317
387 Ga0495634_0007615 3300046642 Bacteria 8114
388 Ga0495625_0000587 3300046660 Bacteria 52838
389 Ga0495635_0071064 3300046663 Bacteria 2386
390 Ga0495588_0000165 3300046674 Bacteria 85841
391 Ga0495657_0000004 3300046675 Bacteria 266465
392 Ga0495657_0047034 3300046675 Bacteria 2919
393 Ga0495599_0013295 3300046678 Bacteria 5087
394 Ga0495647_0000018 3300046681 Bacteria 81701
395 Ga0495613_0000179 3300046689 Bacteria 62109
396 Ga0495624_0000008 3300046690 Bacteria 145035
397 Ga0495624_0000073 3300046690 Bacteria 65582
398 Ga0495649_0000751 3300046694 Bacteria 26125
399 Ga0495600_0016433 3300046809 Bacteria 4696
400 Ga0495604_0000357 3300047317 Bacteria 40931
401 Ga0495604_0078304 3300047317 Bacteria 2481
402 Ga0495604_0167644 3300047317 Bacteria 1547
403 Ga0495674_0035657 3300047319 Bacteria 4486
404 Ga0495674_0152494 3300047319 Bacteria 1937
405 Ga0495672_0030883 3300047320 Bacteria 3352
406 Ga0495676_0004999 3300047321 Bacteria 12164
407 Ga0495676_0027971 3300047321 Bacteria 4826
408 Ga0495676_0038541 3300047321 Bacteria 3968
409 Ga0495680_0000496 3300047322 Bacteria 44440
410 Ga0495687_000406 3300047443 Bacteria 53268
411 Ga0495675_0000175 3300047444 Bacteria 46609
412 Ga0495684_0043493 3300047471 Bacteria 3439
413 Ga0495593_0061865 3300047673 Bacteria 1957
414 Ga0495602_0002588 3300048088 Bacteria 18471
415 Ga0495602_0031032 3300048088 Bacteria 5059
416 Ga0496100_0000018 3300048903 Bacteria 162451
417 Ga0496100_0003651 3300048903 Bacteria 8048
418 Ga0496101_0000062 3300048904 Bacteria 126595
419 Ga0496101_0004877 3300048904 Bacteria 8515
420 Ga0496101_0173669 3300048904 Bacteria 1657
421 Ga0496102_0000039 3300048905 Bacteria 198306
422 Ga0496102_0010620 3300048905 Bacteria 7933
423 Ga0496102_0183577 3300048905 Bacteria 1971
424 Ga0496103_0000008 3300048906 Bacteria 340474
425 Ga0496103_0029605 3300048906 Bacteria 3329
426 Ga0496104_0000650 3300048907 Bacteria 29817
427 Ga0496105_0000347 3300048908 Bacteria 30490
428 Ga0496105_0033730 3300048908 Bacteria 4206
429 Ga0496105_0082806 3300048908 Bacteria 2650
430 Ga0496106_0000122 3300048909 Bacteria 59816
431 Ga0496106_0000312 3300048909 Bacteria 34208
432 Ga0496106_0017353 3300048909 Bacteria 5327
433 Ga0496107_0000006 3300048910 Bacteria 258746
434 Ga0496107_0019934 3300048910 Bacteria 4736
435 Ga0496107_0028789 3300048910 Bacteria 3949
436 Ga0496107_0095337 3300048910 Bacteria 2177
437 Ga0496108_0000062 3300048911 Bacteria 122391
438 Ga0496108_0008150 3300048911 Bacteria 8497
439 Ga0496108_0009387 3300048911 Bacteria 7921
440 Ga0496108_0203029 3300048911 Bacteria 1720
441 Ga0496109_0000121 3300048912 Bacteria 81487
442 Ga0496109_0000129 3300048912 Bacteria 77469
443 Ga0496109_0003623 3300048912 Bacteria 12912
444 Ga0496109_0007583 3300048912 Bacteria 9200
445 Ga0496110_0000089 3300048913 Bacteria 48723
446 Ga0496110_0032801 3300048913 Bacteria 4489
447 Ga0496110_0056938 3300048913 Bacteria 3440
448 Ga0496110_0146152 3300048913 Bacteria 2139
449 Ga0496111_0076543 3300048914 Bacteria 2439
450 Ga0496111_0147610 3300048914 Bacteria 1744
451 Ga0496111_0182051 3300048914 Bacteria 1562
452 Ga0496112_0000223 3300048915 Bacteria 36875
453 Ga0496112_0001770 3300048915 Bacteria 16950
454 Ga0496113_0000628 3300048916 Bacteria 17756
455 Ga0496113_0010757 3300048916 Bacteria 6066
456 Ga0496113_0021542 3300048916 Bacteria 4548
457 Ga0496114_0045004 3300048917 Bacteria 3664
458 Ga0496114_0204212 3300048917 Bacteria 1732
459 Ga0496116_0001565 3300048919 Bacteria 25265
460 Ga0496118_0000818 3300048921 Bacteria 49518
461 Ga0496119_0052566 3300048922 Bacteria 2494
462 Ga0496120_0007169 3300048923 Bacteria 8354
463 Ga0496121_0006714 3300048924 Bacteria 14134
464 Ga0496121_0062775 3300048924 Bacteria 3040
465 Ga0496124_0045298 3300048927 Bacteria 3772
466 Ga0496125_0007232 3300048928 Bacteria 11827
467 Ga0501032_0002454 3300049569 Bacteria 14486
468 Ga0501032_0014608 3300049569 Bacteria 5562
469 Ga0501032_0051764 3300049569 Bacteria 2768
470 Ga0501034_0003032 3300049571 Bacteria 19417
471 Ga0501034_0006537 3300049571 Bacteria 12527
472 Ga0501034_0024940 3300049571 Bacteria 6083
473 Ga0501034_0066247 3300049571 Bacteria 3624
474 Ga0501036_0014209 3300049572 Bacteria 6624
475 Ga0501036_0024665 3300049572 Bacteria 5070
476 Ga0501036_0064936 3300049572 Bacteria 3089
477 Ga0501037_0006562 3300049573 Bacteria 8515
478 Ga0501037_0132425 3300049573 Bacteria 1787
479 Ga0501038_0012061 3300049574 Bacteria 7892
480 Ga0501038_0112865 3300049574 Bacteria 2250
481 Ga0501041_0006202 3300049577 Bacteria 6990
482 Ga0501042_0007948 3300049578 Bacteria 6977
483 Ga0501042_0119524 3300049578 Bacteria 1897
484 Ga0501046_0000799 3300049580 Bacteria 30520
485 Ga0501046_0001349 3300049580 Bacteria 23762
486 Ga0501046_0061264 3300049580 Bacteria 2943
487 Ga0501047_0053133 3300049581 Bacteria 3916
488 Ga0501047_0067942 3300049581 Bacteria 3433
489 Ga0501047_0080816 3300049581 Bacteria 3124
490 Ga0501047_0127282 3300049581 Bacteria 2427
491 Ga0501047_0246814 3300049581 Bacteria 1634
492 Ga0501047_0360799 3300049581 Bacteria 1289
493 Ga0501048_0003341 3300049582 Bacteria 12204
494 Ga0501048_0017290 3300049582 Bacteria 5313
495 Ga0501048_0196308 3300049582 Bacteria 1430
496 Ga0501067_0006652 3300049583 Bacteria 6414
497 Ga0501068_0166982 3300049584 Bacteria 1388
498 Ga0501069_0022967 3300049585 Bacteria 3396
499 Ga0501069_0076805 3300049585 Bacteria 1878
500 Ga0501070_0000651 3300049586 Bacteria 31939
501 Ga0501070_0004254 3300049586 Bacteria 12308
502 Ga0501070_0149318 3300049586 Bacteria 1928
503 Ga0501070_0152198 3300049586 Bacteria 1908
504 Ga0501070_0215519 3300049586 Bacteria 1575
505 Ga0501071_0022117 3300049587 Bacteria 4431
506 Ga0501072_0008263 3300049588 Bacteria 7908
507 Ga0501073_0003023 3300049589 Bacteria 12608
508 Ga0501073_0005104 3300049589 Bacteria 9845
509 Ga0501073_0031643 3300049589 Bacteria 3775
510 Ga0501074_0007354 3300049590 Bacteria 7963
511 Ga0501074_0022863 3300049590 Bacteria 4546
512 Ga0501074_0097880 3300049590 Bacteria 2100
513 Ga0501076_0042557 3300049592 Bacteria 3576
514 Ga0501076_0062993 3300049592 Bacteria 2954
515 Ga0501077_0017179 3300049593 Bacteria 4564
516 Ga0501077_0227206 3300049593 Bacteria 1186
517 Ga0501079_0009411 3300049741 Bacteria 7406
518 Ga0501080_0003998 3300049742 Bacteria 13053
519 Ga0501081_0055694 3300049743 Bacteria 2732
520 Ga0501035_0007867 3300049822 Bacteria 9963
521 Ga0501035_0033927 3300049822 Bacteria 4639
522 Ga0501035_0035100 3300049822 Bacteria 4553
523 Ga0501035_0051830 3300049822 Bacteria 3672
524 Ga0501035_0300316 3300049822 Bacteria 1353
525 Ga0501044_0025719 3300049823 Bacteria 6239
526 Ga0501044_0039969 3300049823 Bacteria 4890
527 Ga0501044_0097462 3300049823 Bacteria 2961
528 Ga0501044_0102835 3300049823 Bacteria 2872
529 Ga0501045_0098538 3300049824 Bacteria 2163
530 nmdc:mga03n38_10033_c1 3300050490 Bacteria 3468
531 nmdc:mga03n38_16770_c1 3300050490 Bacteria 2857
532 nmdc:mga00v17_41493_c1 3300050491 Bacteria 2764
533 nmdc:mga00v17_96767_c1 3300050491 Bacteria 1860
534 nmdc:mga0yw44_13510_c1 3300050492 Bacteria 4303
535 nmdc:mga0yw44_39718_c1 3300050492 Bacteria 2792
536 nmdc:mga0yw44_790_c1 3300050492 Bacteria 4685
537 nmdc:mga04h51_8902_c1 3300050495 Bacteria 2700
538 nmdc:mga07m45_14203_c1 3300050496 Bacteria 4237
539 nmdc:mga09592_12744_c1 3300050508 Bacteria 6854
540 nmdc:mga06r32_27104_c1 3300050510 Bacteria 3689
541 nmdc:mga0rr50_104887_c1 3300050513 Bacteria 2227
542 Ga0495601_0000013 3300053077 Bacteria 226476
543 Ga0495601_0000124 3300053077 Bacteria 43205
544 Ga0495612_0001051 3300053078 Bacteria 11297
545 Ga0495655_0000001 3300053083 Bacteria 419518
546 Ga0495595_0000003 3300053084 Bacteria 266465
547 Ga0495595_0031516 3300053084 Bacteria 2383
548 Ga0495619_0000031 3300053085 Bacteria 145508
549 Ga0495619_0000257 3300053085 Bacteria 38653
550 Ga0495619_0001230 3300053085 Bacteria 16755
551 Ga0495619_0007664 3300053085 Bacteria 6836
552 Ga0500644_0000541 3300053088 Bacteria 15557
553 Ga0500566_0098016 3300053094 Bacteria 1611
554 Ga0500641_0004769 3300053096 Bacteria 4801
555 Ga0500593_000263 3300053117 Bacteria 21458
556 Ga0500614_012010 3300053123 Bacteria 1883
557 Ga0500628_000010 3300053129 Bacteria 122210
558 Ga0500658_0000447 3300053134 Bacteria 17605
559 Ga0500573_0043434 3300053140 Bacteria 2593
560 Ga0501084_0013369 3300054114 Bacteria 6791
561 Ga0501082_0033473 3300060353 Bacteria 4435
562 Ga0501082_0101790 3300060353 Bacteria 2485
563 Ga0466962_0002335 3300061719 Bacteria 8997
564 Ga0466962_0009905 3300061719 Bacteria 4572
565 Ga0466962_0061612 3300061719 Bacteria 1791
566 Ga0530510_0073683 3300061734 Bacteria 2479
567 2583152661 2582580736 Bacteria 5325865
568 2644089080 2643221615 Bacteria 5487866
569 2644457230 2643221681 Bacteria 3707866
570 2644537632 2643221697 Bacteria 3575694
571 2645719556 2643221961 Bacteria 3919167
572 2645726459 2643221962 Bacteria 3874254
573 2740169324 2739367898 Bacteria 4367674
574 2774392211 2773857762 Bacteria 5971770
575 2795785898 2795385470 Bacteria 8317180
576 2795795731 2795385472 Bacteria 6627535
577 2809196012 2808606439 Bacteria 5952208
578 2812351852 2811994878 Bacteria 5992952
579 2855387165 2855386786 Bacteria 4752232
580 2857482518 2857481737 Bacteria 4761446
581 2891970512 2891968417 Bacteria 5821697
582 2899361660 2899359706 Bacteria 10940472
583 2899373078 2899370129 Bacteria 6781179
584 Ga0070714_100052576
585 JGI24746J21847_1000677
586 JGI24740J21852_10026424
587 JGI24739J22299_10022631
588 JGI24735J21928_10015421
589 JGI24748J21848_1000895
590 JGI24034J26672_10000136
591 JGI25406J46586_10001784
592 Ga0070658_10006849
593 Ga0070658_10038129
594 Ga0070658_10088812
595 Ga0070683_100000641
596 Ga0070683_100002592
597 Ga0070683_100019348
598 Ga0070683_100045129
599 Ga0070683_100240051
600 Ga0070666_10016832
601 Ga0070682_100000117
602 Ga0070682_100001006
603 Ga0070682_100047031
604 Ga0068868_100000878
605 Ga0070660_100002223
606 Ga0070660_100051008
607 Ga0070689_100114918
608 Ga0070661_100001375
609 Ga0070661_100013239
610 Ga0070692_10000576
611 Ga0070692_10001979
612 Ga0070668_100012580
613 Ga0070669_100013344
614 Ga0070675_100000111
615 Ga0070675_100041648
616 Ga0070671_100106756
617 Ga0070673_100001567
618 Ga0070673_100011909
619 Ga0070659_100000002
620 Ga0070659_100004130
621 Ga0070659_100038648
622 Ga0070667_100009407
623 Ga0070714_100000019
624 Ga0070714_100003420
625 Ga0070714_100023646
626 Ga0070714_100030746
627 Ga0070714_100148679
628 Ga0070713_100000390
629 Ga0070713_100057834
630 Ga0070710_10000006
631 Ga0070700_100011326
632 Ga0070663_100036165
633 Ga0070678_100183974
634 Ga0070662_100001863
635 Ga0070681_10025949
636 Ga0068867_100145468
637 Ga0070698_100002059
638 Ga0070679_100000068
639 Ga0070679_100007291
640 Ga0070679_100009133
641 Ga0070684_100002845
642 Ga0070684_100006126
643 Ga0070684_100011369
644 Ga0068853_100037768
645 Ga0070672_100000015
646 Ga0070672_100010387
647 Ga0070686_100047303
648 Ga0070693_100001745
649 Ga0070665_100000106
650 Ga0070665_100001502
651 Ga0070665_100008940
652 Ga0070665_100217255
653 Ga0070664_100034103
654 Ga0070664_100306580
655 Ga0068857_100005857
656 Ga0068857_100027364
657 Ga0068857_100193749
658 Ga0068854_100000183
659 Ga0068856_100000757
660 Ga0068856_100033907
661 Ga0070702_100033692
662 Ga0070702_100055460
663 Ga0068852_100000093
664 Ga0068852_100057097
665 Ga0068864_100000053
666 Ga0068864_100003161
667 Ga0068851_10011784
668 Ga0068851_10027612
669 Ga0068863_100003824
670 Ga0068863_100023158
671 Ga0068858_100000009
672 Ga0068858_100000091
673 Ga0068860_100000400
674 Ga0068860_100055881
675 Ga0081455_10000112
676 Ga0081455_10028530
677 Ga0081455_10089101
678 Ga0081540_1000049
679 Ga0081539_10000086
680 Ga0081539_10002609
681 Ga0081539_10040313
682 Ga0070717_10000005
683 Ga0070717_10000352
684 Ga0070717_10038928
685 Ga0070717_10083720
686 Ga0075365_10003743
687 Ga0075365_10044988
688 Ga0075365_10059039
689 Ga0075365_10145185
690 Ga0075365_10150161
691 Ga0075368_10049932
692 Ga0075368_10067331
693 Ga0075363_100000378
694 Ga0075363_100021867
695 Ga0075364_10008289
696 Ga0075364_10008329
697 Ga0070712_100000007
698 Ga0070712_100002695
699 Ga0070712_100008485
700 Ga0075362_10003323
701 Ga0075367_10012558
702 Ga0075370_10000475
703 Ga0075370_10001223
704 Ga0075428_100121351
705 Ga0075430_100012368
706 Ga0075429_100003759
707 Ga0068865_100001277
708 Ga0068865_100039288
709 Ga0105240_10108860
710 Ga0111539_10099425
711 Ga0111539_10364164
712 Ga0105245_10001831
713 Ga0105245_10001895
714 Ga0105245_10024675
715 Ga0105245_10039587
716 Ga0105245_10050223
717 Ga0105245_10099935
718 Ga0105245_10205720
719 Ga0114129_10371161
720 Ga0105243_10002147
721 Ga0105243_10009602
722 Ga0105243_10154308
723 Ga0105242_10002368
724 Ga0105242_10038851
725 Ga0105242_10219474
726 Ga0105248_10000008
727 Ga0105248_10270004
728 Ga0105238_10000011
729 Ga0105249_10109885
730 Ga0105249_10113743
731 Ga0105249_10148463
732 Ga0105239_10050812
733 Ga0105239_10056910
734 Ga0105239_10073144
735 Ga0105239_10102334
736 Ga0105246_10001248
737 Ga0105246_10008649
738 Ga0105246_10132755
739 Ga0157371_10072030
740 Ga0157370_10073477
741 Ga0157369_10000110
742 Ga0157374_10165305
743 Ga0157374_10523449
744 Ga0157378_10031281
745 Ga0157378_10042428
746 Ga0163162_10032523
747 Ga0163162_10133134
748 Ga0163162_10482755
749 Ga0157372_10001384
750 Ga0157372_10003488
751 Ga0157375_10026372
752 Ga0157375_10039653
753 Ga0157380_10000843
754 Ga0157377_10024159
755 Ga0157379_10159632
756 Ga0157376_10064613
757 Ga0213873_10015371
758 Ga0213876_10060287
759 Ga0213876_10068727
760 Ga0213875_10041266
761 Ga0224712_10044474
762 Ga0207656_10002156
763 Ga0207656_10002232
764 Ga0207656_10022538
765 Ga0207692_10000001
766 Ga0207688_10010454
767 Ga0207688_10012057
768 Ga0207705_10039266
769 Ga0207705_10050406
770 Ga0207705_10076394
771 Ga0207705_10083163
772 Ga0207707_10011031
773 Ga0207695_10226847
774 Ga0207693_10000001
775 Ga0207693_10004920
776 Ga0207693_10006065
777 Ga0207663_10079161
778 Ga0207660_10013455
779 Ga0207662_10023772
780 Ga0207662_10088563
781 Ga0207657_10000475
782 Ga0207649_10004012
783 Ga0207649_10026695
784 Ga0207652_10000044
785 Ga0207652_10057318
786 Ga0207646_10287884
787 Ga0207681_10008037
788 Ga0207694_10000004
789 Ga0207650_10040316
790 Ga0207659_10000010
791 Ga0207659_10026112
792 Ga0207687_10000007
793 Ga0207687_10001023
794 Ga0207687_10002454
795 Ga0207687_10005746
796 Ga0207687_10030821
797 Ga0207700_10000027
798 Ga0207700_10152818
799 Ga0207664_10000008
800 Ga0207664_10000529
801 Ga0207664_10012473
802 Ga0207664_10032387
803 Ga0207664_10044110
804 Ga0207664_10125303
805 Ga0207690_10000088
806 Ga0207690_10005795
807 Ga0207706_10004835
808 Ga0207686_10000048
809 Ga0207670_10020188
810 Ga0207670_10023297
811 Ga0207704_10000093
812 Ga0207704_10009888
813 Ga0207691_10000044
814 Ga0207691_10022858
815 Ga0207711_10000006
816 Ga0207661_10001262
817 Ga0207661_10010771
818 Ga0207661_10018784
819 Ga0207661_10040792
820 Ga0207661_10087624
821 Ga0207679_10033917
822 Ga0207679_10252051
823 Ga0207651_10021082
824 Ga0207712_10016409
825 Ga0207668_10221809
826 Ga0207640_10000200
827 Ga0207658_10003525
828 Ga0207658_10052319
829 Ga0207677_10003263
830 Ga0207703_10000023
831 Ga0207703_10000152
832 Ga0207639_10027752
833 Ga0207639_10040770
834 Ga0207678_10014283
835 Ga0207678_10065920
836 Ga0207708_10000842
837 Ga0207702_10000060
838 Ga0207702_10003333
839 Ga0207702_10027029
840 Ga0207702_10061229
841 Ga0207648_10071310
842 Ga0207676_10000094
843 Ga0207674_10001502
844 Ga0207674_10040696
845 Ga0207675_100060076
846 Ga0207683_10170782
847 Ga0207683_10196375
848 Ga0207683_10202083
849 Ga0207698_10000440
850 Ga0207698_10052617
851 Ga0209813_10002809
852 Ga0209813_10030764
853 Ga0268266_10000047
854 Ga0268266_10000285
855 Ga0268266_10005034
856 Ga0268266_10379628
857 Ga0268264_10046651
858 Ga0265326_10000003
859 Ga0265319_1000664
860 Ga0265336_10004622
861 Ga0307515_10080725
862 Ga0307515_10149740
863 Ga0265338_10000844
864 Ga0265324_10001900
865 Ga0307513_10012431
866 Ga0307508_10239324
867 Ga0307413_10005794
868 Ga0307409_100033771
869 Ga0307416_100193848
870 Ga0307414_10061438
871 Ga0307415_100003742
872 Ga0307415_100041426
873 Ga0307507_10002484
874 Ga0373953_0052238
875 Ga0373937_0022173
876 Ga0373937_0177048
877 Ga0395900_0092948
878 Ga0395898_0004969
879 Ga0436364_0112430
880 Ga0400485_08597
881 Ga0400488_44500
882 Ga0400486_21500
883 Ga0436365_0018303
884 Ga0436365_0131291
885 Ga0436365_0457026
886 Ga0436365_1486515
887 Ga0436365_1691212
888 Ga0436360_0079068
889 Ga0436363_0334812
890 Ga0436363_0932759
891 Ga0436363_0970724
892 Ga0436362_0215426
893 Ga0439436_0007563
894 Ga0439438_028297
895 Ga0439447_000769
896 Ga0439466_0001145
897 Ga0451853_4057189
898 Ga0439432_002550
899 Ga0439452_001054
900 Ga0439446_0000840
901 Ga0439434_0000780
902 Ga0451577_0001435
903 Ga0466969_0001191
904 Ga0466969_0040728
905 Ga0466966_0016687
906 Ga0466966_0089662
907 Ga0466961_0002800
908 Ga0466961_0015150
909 Ga0466961_0016137
910 Ga0466963_0000510
911 Ga0466963_0005861
912 Ga0466963_0020021
913 Ga0466963_0084469
914 Ga0466963_0088228
915 Ga0466963_0112747
916 Ga0466964_0019908
917 Ga0466968_0041509
918 Ga0466970_0021172
919 Ga0466970_0071264
920 Ga0466970_0153435
921 Ga0466957_0019515
922 Ga0466957_0021361
923 Ga0466957_0050730
924 Ga0466957_0054239
925 Ga0466960_0000222
926 Ga0466960_0002576
927 Ga0466960_0015176
928 Ga0466960_0043509
929 Ga0466959_0002073
930 Ga0466959_0009424
931 Ga0466959_0016457
932 Ga0466959_0028418
933 Ga0466959_0050133
934 Ga0466959_0057183
935 Ga0466958_0005046
936 Ga0466958_0013922
937 Ga0466958_0050862
938 Ga0466967_0000478
939 Ga0466967_0028857
940 Ga0466967_0043094
941 Ga0466967_0050219
942 Ga0466967_0055985
943 Ga0466967_0082168
944 Ga0466967_0127720
945 Ga0495592_0101174
946 Ga0495592_0132251
947 Ga0495629_0005201
948 Ga0495638_0037115
949 Ga0495641_0000874
950 Ga0495641_0088801
951 Ga0495651_0119930
952 Ga0495653_0035665
953 Ga0495580_0016747
954 Ga0495639_0084345
955 Ga0495606_0000565
956 Ga0495608_0000068
957 Ga0495608_0020646
958 Ga0495628_0121590
959 Ga0495628_0123099
960 Ga0495630_0000056
961 Ga0495630_0034134
962 Ga0495630_0064261
963 Ga0495652_0004685
964 Ga0495652_0083622
965 Ga0495640_0106975
966 Ga0495645_0002246
967 Ga0495645_0018914
968 Ga0495645_0162027
969 Ga0495667_0189895
970 Ga0495634_0007615
971 Ga0495625_0000587
972 Ga0495635_0071064
973 Ga0495588_0000165
974 Ga0495657_0000004
975 Ga0495657_0047034
976 Ga0495599_0013295
977 Ga0495647_0000018
978 Ga0495613_0000179
979 Ga0495624_0000008
980 Ga0495624_0000073
981 Ga0495649_0000751
982 Ga0495600_0016433
983 Ga0495604_0000357
984 Ga0495604_0078304
985 Ga0495604_0167644
986 Ga0495674_0035657
987 Ga0495674_0152494
988 Ga0495672_0030883
989 Ga0495676_0004999
990 Ga0495676_0027971
991 Ga0495676_0038541
992 Ga0495680_0000496
993 Ga0495687_000406
994 Ga0495675_0000175
995 Ga0495684_0043493
996 Ga0495593_0061865
997 Ga0495602_0002588
998 Ga0495602_0031032
999 Ga0496100_0000018
1000 Ga0496100_0003651
1001 Ga0496101_0000062
1002 Ga0496101_0004877
1003 Ga0496101_0173669
1004 Ga0496102_0000039
1005 Ga0496102_0010620
1006 Ga0496102_0183577
1007 Ga0496103_0000008
1008 Ga0496103_0029605
1009 Ga0496104_0000650
1010 Ga0496105_0000347
1011 Ga0496105_0033730
1012 Ga0496105_0082806
1013 Ga0496106_0000122
1014 Ga0496106_0000312
1015 Ga0496106_0017353
1016 Ga0496107_0000006
1017 Ga0496107_0019934
1018 Ga0496107_0028789
1019 Ga0496107_0095337
1020 Ga0496108_0000062
1021 Ga0496108_0008150
1022 Ga0496108_0009387
1023 Ga0496108_0203029
1024 Ga0496109_0000121
1025 Ga0496109_0000129
1026 Ga0496109_0003623
1027 Ga0496109_0007583
1028 Ga0496110_0000089
1029 Ga0496110_0032801
1030 Ga0496110_0056938
1031 Ga0496110_0146152
1032 Ga0496111_0076543
1033 Ga0496111_0147610
1034 Ga0496111_0182051
1035 Ga0496112_0000223
1036 Ga0496112_0001770
1037 Ga0496113_0000628
1038 Ga0496113_0010757
1039 Ga0496113_0021542
1040 Ga0496114_0045004
1041 Ga0496114_0204212
1042 Ga0496116_0001565
1043 Ga0496118_0000818
1044 Ga0496119_0052566
1045 Ga0496120_0007169
1046 Ga0496121_0006714
1047 Ga0496121_0062775
1048 Ga0496124_0045298
1049 Ga0496125_0007232
1050 Ga0501032_0002454
1051 Ga0501032_0014608
1052 Ga0501032_0051764
1053 Ga0501034_0003032
1054 Ga0501034_0006537
1055 Ga0501034_0024940
1056 Ga0501034_0066247
1057 Ga0501036_0014209
1058 Ga0501036_0024665
1059 Ga0501036_0064936
1060 Ga0501037_0006562
1061 Ga0501037_0132425
1062 Ga0501038_0012061
1063 Ga0501038_0112865
1064 Ga0501041_0006202
1065 Ga0501042_0007948
1066 Ga0501042_0119524
1067 Ga0501046_0000799
1068 Ga0501046_0001349
1069 Ga0501046_0061264
1070 Ga0501047_0053133
1071 Ga0501047_0067942
1072 Ga0501047_0080816
1073 Ga0501047_0127282
1074 Ga0501047_0246814
1075 Ga0501047_0360799
1076 Ga0501048_0003341
1077 Ga0501048_0017290
1078 Ga0501048_0196308
1079 Ga0501067_0006652
1080 Ga0501068_0166982
1081 Ga0501069_0022967
1082 Ga0501069_0076805
1083 Ga0501070_0000651
1084 Ga0501070_0004254
1085 Ga0501070_0149318
1086 Ga0501070_0152198
1087 Ga0501070_0215519
1088 Ga0501071_0022117
1089 Ga0501072_0008263
1090 Ga0501073_0003023
1091 Ga0501073_0005104
1092 Ga0501073_0031643
1093 Ga0501074_0007354
1094 Ga0501074_0022863
1095 Ga0501074_0097880
1096 Ga0501076_0042557
1097 Ga0501076_0062993
1098 Ga0501077_0017179
1099 Ga0501077_0227206
1100 Ga0501079_0009411
1101 Ga0501080_0003998
1102 Ga0501081_0055694
1103 Ga0501035_0007867
1104 Ga0501035_0033927
1105 Ga0501035_0035100
1106 Ga0501035_0051830
1107 Ga0501035_0300316
1108 Ga0501044_0025719
1109 Ga0501044_0039969
1110 Ga0501044_0097462
1111 Ga0501044_0102835
1112 Ga0501045_0098538
1113 nmdc:mga03n38_10033_c1
1114 nmdc:mga03n38_16770_c1
1115 nmdc:mga00v17_41493_c1
1116 nmdc:mga00v17_96767_c1
1117 nmdc:mga0yw44_13510_c1
1118 nmdc:mga0yw44_39718_c1
1119 nmdc:mga0yw44_790_c1
1120 nmdc:mga04h51_8902_c1
1121 nmdc:mga07m45_14203_c1
1122 nmdc:mga09592_12744_c1
1123 nmdc:mga06r32_27104_c1
1124 nmdc:mga0rr50_104887_c1
1125 Ga0495601_0000013
1126 Ga0495601_0000124
1127 Ga0495612_0001051
1128 Ga0495655_0000001
1129 Ga0495595_0000003
1130 Ga0495595_0031516
1131 Ga0495619_0000031
1132 Ga0495619_0000257
1133 Ga0495619_0001230
1134 Ga0495619_0007664
1135 Ga0500644_0000541
1136 Ga0500566_0098016
1137 Ga0500641_0004769
1138 Ga0500593_000263
1139 Ga0500614_012010
1140 Ga0500628_000010
1141 Ga0500658_0000447
1142 Ga0500573_0043434
1143 Ga0501084_0013369
1144 Ga0501082_0033473
1145 Ga0501082_0101790
1146 Ga0466962_0002335
1147 Ga0466962_0009905
1148 Ga0466962_0061612
1149 Ga0530510_0073683
1150 2583152661
1151 2644089080
1152 2644457230
1153 2644537632
1154 2645719556
1155 2645726459
1156 2740169324
1157 2774392211
1158 2795785898
1159 2795795731
1160 2809196012
1161 2812351852
1162 2855387165
1163 2857482518
1164 2891970512
1165 2899361660
1166 2899373078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

253

405

0.96

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

140

237

0.96

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

269

394

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r7k-assembly1.cif.gz_D crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 0.7876 7 383
2vig-assembly2.cif.gz_G crystal structure of human short-chain acyl coa dehydrogenase 0.7831 6 384
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.7811 6 384
4u83-assembly2.cif.gz_D structure of brucella abortus butyryl-coa dehydrogenase 0.7808 3 382
2vig-assembly1.cif.gz_B crystal structure of human short-chain acyl coa dehydrogenase 0.7797 6 384
ID Description Score Start End Superfamily
af_P95186_131_245_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9436 133 246 2.40.110.10
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9286 131 237 2.40.110.10
af_P95186_131_245_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.928 133 246 2.40.110.10
4irnA02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9236 132 237 2.40.110.10
4n5fB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9173 132 237 2.40.110.10
ID Description Score Start End GO Terms
AF-A0A399V9H6-F1-model_v4 deleted 0.9264 2 312
AF-A0A399V9H6-F1-model_v4 deleted 0.9236 2 312
AF-X1A816-F1-model_v4 Acyl-CoA oxidase/dehydrogenase middle domain-containing protein 0.8987 106 231 GO:0003995
GO:0050660
AF-A0A164IIM7-F1-model_v4 Putative Isovaleryl-CoA dehydrogenase 0.8951 106 238 GO:0003995
GO:0050660
AF-A0A6A8AS54-F1-model_v4 Acyl-CoA dehydrogenase 0.8919 126 247 GO:0003995

Map