F466271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 266 | 1166 | 456 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10036321|Ga0157379_100363213 |
| Length | 494 |
| Sequence | MELVTGNLESGVSKGPNSQYQIPNSSSTNKASMKTTPAIAIFDIGKTNKKLFVFNDKYQIVLEKTIQFEETKDEDGDACENLPALTEWIRQSINELMDMQDISVKAMNFSAYGASFVHIDNEGKPVAPLYNYLKPFPAALKSKFYKKYGGEVDFSIHTASPVLGNLNSGLQLYYLKEDKPALFKKIRYSLHLPQYLSYLVTGRPCSDITSIGCHTGMWNFTENRYHEWLHQEGIHDKLAPIFPSDQLITTNWHGKPLQCGAGLHDSSAALIPYLARFKEPFVLISTGTWCISLNPFNQTKLTAEELQQDCLCYMEYRGKPIKASRLFAGYEHEQQVKRLAAHFNTAEDNYRQVVFDAGLVQKLSGGMRPDPRPGKLLMPESVFGTRDLHSFASYNEAYHCLMLDIMDLQAASVNLVLKNCGVKKIFVDGGFGNNPLYMNLLASAFPQIAVYAASVPQASSIGAALAVHSYWNKNNFPPDLIDLKLYAEIGPIEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 180 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 214 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 215 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 219 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 220 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 225 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 226 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 228 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 230 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 231 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 232 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 233 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 234 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 237 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 239 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 241 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 243 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 244 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 245 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 246 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 247 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 248 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 249 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 250 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 251 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 252 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 253 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 254 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 255 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 256 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 257 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 258 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 259 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 260 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 261 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 262 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 263 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 264 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 265 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 266 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.88 |
| Metatranscriptomes | 0 |
| Isolates | 4.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.26 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 82.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157379_10036321 | 3300014968 | Bacteria | 4394 |
| 2 | JGI24740J21852_10000446 | 3300001979 | Bacteria | 17682 |
| 3 | JGI24739J22299_10015875 | 3300001989 | Bacteria | 2732 |
| 4 | JGI25154J39366_1000072 | 3300002738 | Bacteria | 93790 |
| 5 | JGI25152J39213_1000022 | 3300002773 | Bacteria | 105664 |
| 6 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 7 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 8 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 9 | JGI25153J46596_10000565 | 3300003215 | Bacteria | 22884 |
| 10 | JGI25153J46596_10000777 | 3300003215 | Bacteria | 19573 |
| 11 | rootH1_10028562 | 3300003316 | Bacteria | 7064 |
| 12 | rootH2_10001273 | 3300003320 | Bacteria | 179792 |
| 13 | rootH2_10019694 | 3300003320 | Bacteria | 26743 |
| 14 | rootH2_10026785 | 3300003320 | Bacteria | 4350 |
| 15 | rootH2_10028784 | 3300003320 | Bacteria | 31504 |
| 16 | rootL2_10022071 | 3300003322 | Bacteria | 4479 |
| 17 | rootL2_10030076 | 3300003322 | Bacteria | 2022 |
| 18 | rootL2_10061337 | 3300003322 | Bacteria | 9810 |
| 19 | rootH1_10008582 | 3300003323 | Bacteria | 172664 |
| 20 | rootH1_10230979 | 3300003323 | Bacteria | 3254 |
| 21 | JGI25160J50197_1002167 | 3300003354 | Bacteria | 9284 |
| 22 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 23 | Ga0055528_1000395 | 3300003790 | Bacteria | 35486 |
| 24 | Ga0055530_10001870 | 3300003791 | Bacteria | 14476 |
| 25 | Ga0055530_10002315 | 3300003791 | Bacteria | 12450 |
| 26 | Ga0055531_10000349 | 3300003794 | Bacteria | 45177 |
| 27 | Ga0065165_1000056 | 3300005262 | Bacteria | 186730 |
| 28 | Ga0065714_10064604 | 3300005288 | Bacteria | 29598 |
| 29 | Ga0065714_10076778 | 3300005288 | Bacteria | 2755 |
| 30 | Ga0070658_10000073 | 3300005327 | Bacteria | 96498 |
| 31 | Ga0070676_10000015 | 3300005328 | Bacteria | 52703 |
| 32 | Ga0070683_100006273 | 3300005329 | Bacteria | 9977 |
| 33 | Ga0070670_100065036 | 3300005331 | Bacteria | 3129 |
| 34 | Ga0070670_100084873 | 3300005331 | Bacteria | 2720 |
| 35 | Ga0070670_100231280 | 3300005331 | Unclassified | 1609 |
| 36 | Ga0068869_100004677 | 3300005334 | Bacteria | 8543 |
| 37 | Ga0068869_100018886 | 3300005334 | Bacteria | 4701 |
| 38 | Ga0070666_10000101 | 3300005335 | Bacteria | 58900 |
| 39 | Ga0070666_10000284 | 3300005335 | Bacteria | 33475 |
| 40 | Ga0070666_10082082 | 3300005335 | Unclassified | 2204 |
| 41 | Ga0068868_100002455 | 3300005338 | Bacteria | 12866 |
| 42 | Ga0068868_100002718 | 3300005338 | Bacteria | 12258 |
| 43 | Ga0070660_100040910 | 3300005339 | Bacteria | 3530 |
| 44 | Ga0070691_10018879 | 3300005341 | Bacteria | 3179 |
| 45 | Ga0070668_100010612 | 3300005347 | Bacteria | 6851 |
| 46 | Ga0070668_100073726 | 3300005347 | Bacteria | 2662 |
| 47 | Ga0070675_100080466 | 3300005354 | Bacteria | 2716 |
| 48 | Ga0070675_100116440 | 3300005354 | Bacteria | 2267 |
| 49 | Ga0070671_100000813 | 3300005355 | Bacteria | 22610 |
| 50 | Ga0070671_100010258 | 3300005355 | Bacteria | 7520 |
| 51 | Ga0070671_100012461 | 3300005355 | Bacteria | 6847 |
| 52 | Ga0070671_100042263 | 3300005355 | Bacteria | 3789 |
| 53 | Ga0070674_100029342 | 3300005356 | Bacteria | 3622 |
| 54 | Ga0070673_100020734 | 3300005364 | Bacteria | 4745 |
| 55 | Ga0070673_100044001 | 3300005364 | Bacteria | 3454 |
| 56 | Ga0070673_100191008 | 3300005364 | Unclassified | 1759 |
| 57 | Ga0070659_100000092 | 3300005366 | Bacteria | 67270 |
| 58 | Ga0070659_100001662 | 3300005366 | Bacteria | 15981 |
| 59 | Ga0070659_100021371 | 3300005366 | Bacteria | 4928 |
| 60 | Ga0070659_100088183 | 3300005366 | Bacteria | 2484 |
| 61 | Ga0070667_100001105 | 3300005367 | Bacteria | 24730 |
| 62 | Ga0070667_100009567 | 3300005367 | Bacteria | 8035 |
| 63 | Ga0070667_100083909 | 3300005367 | Bacteria | 2730 |
| 64 | Ga0070663_100051799 | 3300005455 | Bacteria | 2926 |
| 65 | Ga0070678_100000121 | 3300005456 | Bacteria | 30787 |
| 66 | Ga0070678_100006438 | 3300005456 | Bacteria | 6894 |
| 67 | Ga0070662_100001108 | 3300005457 | Bacteria | 16442 |
| 68 | Ga0070662_100006135 | 3300005457 | Bacteria | 7727 |
| 69 | Ga0070681_10028132 | 3300005458 | Bacteria | 5652 |
| 70 | Ga0070681_10061338 | 3300005458 | Unclassified | 3735 |
| 71 | Ga0068867_100000210 | 3300005459 | Bacteria | 39145 |
| 72 | Ga0068867_100009329 | 3300005459 | Bacteria | 6925 |
| 73 | Ga0070698_100190950 | 3300005471 | Bacteria | 1986 |
| 74 | Ga0070679_100035964 | 3300005530 | Bacteria | 4914 |
| 75 | Ga0070679_100052415 | 3300005530 | Bacteria | 4064 |
| 76 | Ga0070684_100117056 | 3300005535 | Bacteria | 2394 |
| 77 | Ga0068853_100002242 | 3300005539 | Bacteria | 14447 |
| 78 | Ga0068853_100003568 | 3300005539 | Bacteria | 11910 |
| 79 | Ga0068853_100036238 | 3300005539 | Bacteria | 4193 |
| 80 | Ga0068853_100046732 | 3300005539 | Bacteria | 3713 |
| 81 | Ga0068853_100089274 | 3300005539 | Bacteria | 2707 |
| 82 | Ga0068853_100090738 | 3300005539 | Bacteria | 2686 |
| 83 | Ga0068853_100130672 | 3300005539 | Bacteria | 2248 |
| 84 | Ga0068853_100213833 | 3300005539 | Bacteria | 1758 |
| 85 | Ga0070672_100007825 | 3300005543 | Bacteria | 7292 |
| 86 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 87 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 88 | Ga0070665_100017871 | 3300005548 | Bacteria | 7120 |
| 89 | Ga0068855_100000093 | 3300005563 | Bacteria | 106968 |
| 90 | Ga0068855_100007710 | 3300005563 | Bacteria | 12999 |
| 91 | Ga0068855_100009409 | 3300005563 | Bacteria | 11800 |
| 92 | Ga0068855_100015883 | 3300005563 | Bacteria | 9059 |
| 93 | Ga0068855_100024363 | 3300005563 | Bacteria | 7242 |
| 94 | Ga0068855_100027574 | 3300005563 | Bacteria | 6794 |
| 95 | Ga0068855_100078355 | 3300005563 | Bacteria | 3834 |
| 96 | Ga0068855_100087356 | 3300005563 | Bacteria | 3604 |
| 97 | Ga0068855_100122763 | 3300005563 | Bacteria | 2972 |
| 98 | Ga0068855_100123833 | 3300005563 | Bacteria | 2957 |
| 99 | Ga0068857_100005539 | 3300005577 | Bacteria | 10772 |
| 100 | Ga0068857_100028155 | 3300005577 | Bacteria | 4957 |
| 101 | Ga0068854_100053650 | 3300005578 | Bacteria | 2896 |
| 102 | Ga0068854_100078718 | 3300005578 | Bacteria | 2429 |
| 103 | Ga0068856_100017951 | 3300005614 | Bacteria | 6860 |
| 104 | Ga0068856_100060188 | 3300005614 | Bacteria | 3752 |
| 105 | Ga0068856_100101929 | 3300005614 | Bacteria | 2863 |
| 106 | Ga0068856_100137437 | 3300005614 | Bacteria | 2450 |
| 107 | Ga0068852_100001727 | 3300005616 | Bacteria | 14898 |
| 108 | Ga0068852_100003100 | 3300005616 | Bacteria | 11571 |
| 109 | Ga0068852_100007925 | 3300005616 | Bacteria | 7781 |
| 110 | Ga0068852_100037083 | 3300005616 | Bacteria | 4085 |
| 111 | Ga0068852_100068143 | 3300005616 | Bacteria | 3113 |
| 112 | Ga0068852_100258660 | 3300005616 | Bacteria | 1671 |
| 113 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 114 | Ga0068864_100008124 | 3300005618 | Bacteria | 8653 |
| 115 | Ga0068851_10003086 | 3300005834 | Bacteria | 7376 |
| 116 | Ga0068851_10003129 | 3300005834 | Bacteria | 7336 |
| 117 | Ga0068851_10069755 | 3300005834 | Unclassified | 1816 |
| 118 | Ga0068870_10003637 | 3300005840 | Bacteria | 6551 |
| 119 | Ga0068863_100008701 | 3300005841 | Bacteria | 9915 |
| 120 | Ga0068863_100011861 | 3300005841 | Bacteria | 8423 |
| 121 | Ga0068863_100050055 | 3300005841 | Bacteria | 3962 |
| 122 | Ga0068863_100142873 | 3300005841 | Bacteria | 2288 |
| 123 | Ga0068858_100018502 | 3300005842 | Bacteria | 6522 |
| 124 | Ga0068858_100157904 | 3300005842 | Bacteria | 2134 |
| 125 | Ga0068860_100000005 | 3300005843 | Bacteria | 472349 |
| 126 | Ga0068860_100002179 | 3300005843 | Bacteria | 20606 |
| 127 | Ga0068860_100002561 | 3300005843 | Bacteria | 19014 |
| 128 | Ga0068860_100007090 | 3300005843 | Bacteria | 11212 |
| 129 | Ga0068860_100010720 | 3300005843 | Bacteria | 9050 |
| 130 | Ga0068860_100021171 | 3300005843 | Bacteria | 6299 |
| 131 | Ga0068860_100065089 | 3300005843 | Bacteria | 3462 |
| 132 | Ga0068862_100004372 | 3300005844 | Bacteria | 11954 |
| 133 | Ga0097621_100000308 | 3300006237 | Bacteria | 33071 |
| 134 | Ga0097621_100000459 | 3300006237 | Bacteria | 28552 |
| 135 | Ga0097621_100003734 | 3300006237 | Bacteria | 10549 |
| 136 | Ga0097621_100004375 | 3300006237 | Bacteria | 9826 |
| 137 | Ga0097621_100141456 | 3300006237 | Viruses | 2056 |
| 138 | Ga0097621_100163260 | 3300006237 | Bacteria | 1916 |
| 139 | Ga0068871_100000046 | 3300006358 | Bacteria | 66964 |
| 140 | Ga0068871_100000069 | 3300006358 | Bacteria | 57310 |
| 141 | Ga0068871_100015030 | 3300006358 | Bacteria | 5788 |
| 142 | Ga0068871_100033286 | 3300006358 | Bacteria | 4081 |
| 143 | Ga0068865_100000041 | 3300006881 | Bacteria | 72569 |
| 144 | Ga0068865_100015112 | 3300006881 | Bacteria | 4919 |
| 145 | Ga0068865_100017659 | 3300006881 | Bacteria | 4592 |
| 146 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 147 | Ga0105240_10000100 | 3300009093 | Bacteria | 176640 |
| 148 | Ga0105240_10003673 | 3300009093 | Bacteria | 23739 |
| 149 | Ga0105240_10003886 | 3300009093 | Bacteria | 23077 |
| 150 | Ga0105240_10008491 | 3300009093 | Bacteria | 14689 |
| 151 | Ga0105240_10038050 | 3300009093 | Bacteria | 6176 |
| 152 | Ga0105240_10046321 | 3300009093 | Bacteria | 5511 |
| 153 | Ga0105240_10060033 | 3300009093 | Bacteria | 4742 |
| 154 | Ga0105240_10065502 | 3300009093 | Bacteria | 4510 |
| 155 | Ga0105240_10083954 | 3300009093 | Bacteria | 3907 |
| 156 | Ga0105240_10120733 | 3300009093 | Bacteria | 3156 |
| 157 | Ga0105240_10188829 | 3300009093 | Bacteria | 2424 |
| 158 | Ga0105240_10275458 | 3300009093 | Bacteria | 1936 |
| 159 | Ga0105240_10315315 | 3300009093 | Bacteria | 1784 |
| 160 | Ga0111539_10211862 | 3300009094 | Bacteria | 2257 |
| 161 | Ga0105245_10035013 | 3300009098 | Bacteria | 4455 |
| 162 | Ga0105245_10136166 | 3300009098 | Bacteria | 2308 |
| 163 | Ga0105245_10200726 | 3300009098 | Bacteria | 1915 |
| 164 | Ga0105245_10262484 | 3300009098 | Bacteria | 1681 |
| 165 | Ga0105247_10011230 | 3300009101 | Bacteria | 5402 |
| 166 | Ga0114129_10001095 | 3300009147 | Bacteria | 35580 |
| 167 | Ga0105243_10037179 | 3300009148 | Bacteria | 3782 |
| 168 | Ga0105241_10000924 | 3300009174 | Bacteria | 22247 |
| 169 | Ga0105241_10008283 | 3300009174 | Bacteria | 7654 |
| 170 | Ga0105241_10050359 | 3300009174 | Bacteria | 3174 |
| 171 | Ga0105241_10094608 | 3300009174 | Bacteria | 2363 |
| 172 | Ga0105241_10131825 | 3300009174 | Bacteria | 2024 |
| 173 | Ga0105241_10253820 | 3300009174 | Unclassified | 1492 |
| 174 | Ga0105242_10009234 | 3300009176 | Bacteria | 7566 |
| 175 | Ga0105242_10042772 | 3300009176 | Bacteria | 3661 |
| 176 | Ga0105242_10046589 | 3300009176 | Bacteria | 3518 |
| 177 | Ga0105242_10216811 | 3300009176 | Bacteria | 1708 |
| 178 | Ga0105248_10077747 | 3300009177 | Bacteria | 3731 |
| 179 | Ga0105248_10141733 | 3300009177 | Bacteria | 2712 |
| 180 | Ga0105237_10000232 | 3300009545 | Bacteria | 79362 |
| 181 | Ga0105237_10000390 | 3300009545 | Bacteria | 62424 |
| 182 | Ga0105237_10001116 | 3300009545 | Bacteria | 35964 |
| 183 | Ga0105237_10001595 | 3300009545 | Bacteria | 29470 |
| 184 | Ga0105237_10002166 | 3300009545 | Bacteria | 24657 |
| 185 | Ga0105237_10002312 | 3300009545 | Bacteria | 23678 |
| 186 | Ga0105237_10006705 | 3300009545 | Bacteria | 12727 |
| 187 | Ga0105237_10029814 | 3300009545 | Bacteria | 5542 |
| 188 | Ga0105237_10034382 | 3300009545 | Bacteria | 5132 |
| 189 | Ga0105237_10040616 | 3300009545 | Bacteria | 4691 |
| 190 | Ga0105237_10050086 | 3300009545 | Bacteria | 4197 |
| 191 | Ga0105237_10050315 | 3300009545 | Unclassified | 4187 |
| 192 | Ga0105237_10156643 | 3300009545 | Bacteria | 2275 |
| 193 | Ga0105238_10002309 | 3300009551 | Bacteria | 19195 |
| 194 | Ga0105238_10020489 | 3300009551 | Bacteria | 6732 |
| 195 | Ga0105238_10128375 | 3300009551 | Bacteria | 2514 |
| 196 | Ga0105249_10008407 | 3300009553 | Bacteria | 8991 |
| 197 | Ga0105249_10014072 | 3300009553 | Bacteria | 7072 |
| 198 | Ga0105249_10171939 | 3300009553 | Unclassified | 2102 |
| 199 | Ga0105239_10000093 | 3300010375 | Bacteria | 125821 |
| 200 | Ga0105239_10000811 | 3300010375 | Bacteria | 44304 |
| 201 | Ga0105239_10002220 | 3300010375 | Bacteria | 24921 |
| 202 | Ga0105239_10006964 | 3300010375 | Bacteria | 13025 |
| 203 | Ga0105239_10009313 | 3300010375 | Bacteria | 11100 |
| 204 | Ga0105239_10010978 | 3300010375 | Bacteria | 10113 |
| 205 | Ga0105239_10019355 | 3300010375 | Bacteria | 7518 |
| 206 | Ga0105239_10025593 | 3300010375 | Bacteria | 6497 |
| 207 | Ga0105239_10049953 | 3300010375 | Bacteria | 4587 |
| 208 | Ga0105239_10050628 | 3300010375 | Bacteria | 4555 |
| 209 | Ga0105239_10134790 | 3300010375 | Bacteria | 2749 |
| 210 | Ga0157373_10000523 | 3300013100 | Bacteria | 30125 |
| 211 | Ga0157373_10054929 | 3300013100 | Bacteria | 2829 |
| 212 | Ga0157371_10000276 | 3300013102 | Bacteria | 69547 |
| 213 | Ga0157371_10062263 | 3300013102 | Bacteria | 2645 |
| 214 | Ga0157371_10088759 | 3300013102 | Bacteria | 2189 |
| 215 | Ga0157371_10100874 | 3300013102 | Bacteria | 2048 |
| 216 | Ga0157371_10132437 | 3300013102 | Bacteria | 1774 |
| 217 | Ga0157370_10000536 | 3300013104 | Bacteria | 47516 |
| 218 | Ga0157370_10002639 | 3300013104 | Bacteria | 21536 |
| 219 | Ga0157370_10052661 | 3300013104 | Bacteria | 3886 |
| 220 | Ga0157369_10000040 | 3300013105 | Bacteria | 183469 |
| 221 | Ga0157369_10000516 | 3300013105 | Bacteria | 50779 |
| 222 | Ga0157369_10018288 | 3300013105 | Bacteria | 7860 |
| 223 | Ga0157369_10025570 | 3300013105 | Bacteria | 6551 |
| 224 | Ga0157369_10050194 | 3300013105 | Bacteria | 4520 |
| 225 | Ga0157369_10173810 | 3300013105 | Bacteria | 2268 |
| 226 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 227 | Ga0157374_10000137 | 3300013296 | Bacteria | 66006 |
| 228 | Ga0157374_10000563 | 3300013296 | Bacteria | 32897 |
| 229 | Ga0157374_10018540 | 3300013296 | Bacteria | 6143 |
| 230 | Ga0157374_10076017 | 3300013296 | Bacteria | 3174 |
| 231 | Ga0157378_10003261 | 3300013297 | Bacteria | 14423 |
| 232 | Ga0157378_10048959 | 3300013297 | Bacteria | 3759 |
| 233 | Ga0157378_10054759 | 3300013297 | Bacteria | 3552 |
| 234 | Ga0163162_10000026 | 3300013306 | Bacteria | 178701 |
| 235 | Ga0163162_10000350 | 3300013306 | Bacteria | 41929 |
| 236 | Ga0163162_10001413 | 3300013306 | Bacteria | 22327 |
| 237 | Ga0163162_10002843 | 3300013306 | Bacteria | 16481 |
| 238 | Ga0163162_10004561 | 3300013306 | Bacteria | 13346 |
| 239 | Ga0163162_10009962 | 3300013306 | Bacteria | 9244 |
| 240 | Ga0163162_10010516 | 3300013306 | Bacteria | 9000 |
| 241 | Ga0163162_10152946 | 3300013306 | Bacteria | 2426 |
| 242 | Ga0163162_10208339 | 3300013306 | Bacteria | 2084 |
| 243 | Ga0157372_10000010 | 3300013307 | Bacteria | 300658 |
| 244 | Ga0157372_10000052 | 3300013307 | Bacteria | 135497 |
| 245 | Ga0157372_10000428 | 3300013307 | Bacteria | 46270 |
| 246 | Ga0157372_10001180 | 3300013307 | Bacteria | 28252 |
| 247 | Ga0157372_10028236 | 3300013307 | Bacteria | 6123 |
| 248 | Ga0157372_10226379 | 3300013307 | Bacteria | 2168 |
| 249 | Ga0157372_10342286 | 3300013307 | Bacteria | 1742 |
| 250 | Ga0157372_10366828 | 3300013307 | Bacteria | 1678 |
| 251 | Ga0157375_10000646 | 3300013308 | Bacteria | 30874 |
| 252 | Ga0157375_10014533 | 3300013308 | Bacteria | 7026 |
| 253 | Ga0157375_10021180 | 3300013308 | Bacteria | 5955 |
| 254 | Ga0157375_10075835 | 3300013308 | Bacteria | 3388 |
| 255 | Ga0157375_10084265 | 3300013308 | Bacteria | 3226 |
| 256 | Ga0157375_10155412 | 3300013308 | Bacteria | 2426 |
| 257 | Ga0163163_10000508 | 3300014325 | Bacteria | 34914 |
| 258 | Ga0163163_10010072 | 3300014325 | Bacteria | 8480 |
| 259 | Ga0163163_10041586 | 3300014325 | Bacteria | 4495 |
| 260 | Ga0163163_10386409 | 3300014325 | Unclassified | 1457 |
| 261 | Ga0157380_10016417 | 3300014326 | Bacteria | 5461 |
| 262 | Ga0157380_10028007 | 3300014326 | Bacteria | 4292 |
| 263 | Ga0157377_10000798 | 3300014745 | Bacteria | 13020 |
| 264 | Ga0157379_10015800 | 3300014968 | Bacteria | 6633 |
| 265 | Ga0157379_10042832 | 3300014968 | Bacteria | 4042 |
| 266 | Ga0157379_10169402 | 3300014968 | Bacteria | 1971 |
| 267 | Ga0157376_10001099 | 3300014969 | Bacteria | 17757 |
| 268 | Ga0157376_10006711 | 3300014969 | Bacteria | 8148 |
| 269 | Ga0157376_10010382 | 3300014969 | Bacteria | 6809 |
| 270 | Ga0157376_10011464 | 3300014969 | Bacteria | 6536 |
| 271 | Ga0157376_10037106 | 3300014969 | Unclassified | 3953 |
| 272 | Ga0157376_10121138 | 3300014969 | Bacteria | 2319 |
| 273 | Ga0182006_1000302 | 3300015261 | Bacteria | 43116 |
| 274 | Ga0182006_1001597 | 3300015261 | Bacteria | 13410 |
| 275 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 276 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 277 | Ga0163161_10000284 | 3300017792 | Bacteria | 44309 |
| 278 | Ga0163161_10001539 | 3300017792 | Bacteria | 17026 |
| 279 | Ga0163161_10099102 | 3300017792 | Bacteria | 2167 |
| 280 | Ga0213876_10000584 | 3300021384 | Bacteria | 27185 |
| 281 | Ga0209258_100303 | 3300025242 | Bacteria | 79506 |
| 282 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 283 | Ga0209646_1000037 | 3300025246 | Bacteria | 355116 |
| 284 | Ga0209026_1000542 | 3300025250 | Bacteria | 25955 |
| 285 | Ga0209026_1001067 | 3300025250 | Bacteria | 13292 |
| 286 | Ga0209148_1000329 | 3300025254 | Bacteria | 65492 |
| 287 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 288 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 289 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 290 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 291 | Ga0209564_1007304 | 3300025295 | Bacteria | 5732 |
| 292 | Ga0209564_1016977 | 3300025295 | Bacteria | 2865 |
| 293 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 294 | Ga0209758_1001126 | 3300025297 | Bacteria | 34321 |
| 295 | Ga0209758_1006838 | 3300025297 | Bacteria | 7989 |
| 296 | Ga0209758_1010043 | 3300025297 | Bacteria | 5744 |
| 297 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 298 | Ga0209050_1000539 | 3300025298 | Bacteria | 62759 |
| 299 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 300 | Ga0207426_1000193 | 3300025302 | Bacteria | 151669 |
| 301 | Ga0207426_1000786 | 3300025302 | Bacteria | 34729 |
| 302 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 303 | Ga0209257_1009803 | 3300025304 | Bacteria | 5014 |
| 304 | Ga0207656_10001168 | 3300025321 | Bacteria | 8635 |
| 305 | Ga0207710_10017270 | 3300025900 | Bacteria | 3060 |
| 306 | Ga0207680_10000067 | 3300025903 | Bacteria | 46002 |
| 307 | Ga0207680_10058938 | 3300025903 | Unclassified | 2330 |
| 308 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 309 | Ga0207645_10000058 | 3300025907 | Bacteria | 78487 |
| 310 | Ga0207645_10000599 | 3300025907 | Bacteria | 29884 |
| 311 | Ga0207705_10000225 | 3300025909 | Bacteria | 56142 |
| 312 | Ga0207654_10008988 | 3300025911 | Bacteria | 5069 |
| 313 | Ga0207654_10012339 | 3300025911 | Bacteria | 4378 |
| 314 | Ga0207654_10052043 | 3300025911 | Bacteria | 2359 |
| 315 | Ga0207707_10095301 | 3300025912 | Bacteria | 2601 |
| 316 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 317 | Ga0207695_10000055 | 3300025913 | Bacteria | 382776 |
| 318 | Ga0207695_10000164 | 3300025913 | Bacteria | 196777 |
| 319 | Ga0207695_10006874 | 3300025913 | Bacteria | 14642 |
| 320 | Ga0207695_10013890 | 3300025913 | Bacteria | 9574 |
| 321 | Ga0207695_10019581 | 3300025913 | Bacteria | 7788 |
| 322 | Ga0207695_10039756 | 3300025913 | Bacteria | 5052 |
| 323 | Ga0207695_10040889 | 3300025913 | Unclassified | 4966 |
| 324 | Ga0207695_10106848 | 3300025913 | Bacteria | 2785 |
| 325 | Ga0207695_10162907 | 3300025913 | Bacteria | 2160 |
| 326 | Ga0207695_10195231 | 3300025913 | Bacteria | 1940 |
| 327 | Ga0207695_10214587 | 3300025913 | Unclassified | 1834 |
| 328 | Ga0207671_10000259 | 3300025914 | Bacteria | 79366 |
| 329 | Ga0207671_10000584 | 3300025914 | Bacteria | 48796 |
| 330 | Ga0207671_10000923 | 3300025914 | Bacteria | 36887 |
| 331 | Ga0207671_10004787 | 3300025914 | Bacteria | 12757 |
| 332 | Ga0207671_10010514 | 3300025914 | Bacteria | 7628 |
| 333 | Ga0207671_10019043 | 3300025914 | Bacteria | 5258 |
| 334 | Ga0207671_10019863 | 3300025914 | Bacteria | 5128 |
| 335 | Ga0207671_10041671 | 3300025914 | Bacteria | 3398 |
| 336 | Ga0207671_10043233 | 3300025914 | Bacteria | 3331 |
| 337 | Ga0207671_10060482 | 3300025914 | Bacteria | 2810 |
| 338 | Ga0207657_10028327 | 3300025919 | Bacteria | 5111 |
| 339 | Ga0207657_10118593 | 3300025919 | Bacteria | 2178 |
| 340 | Ga0207652_10046020 | 3300025921 | Bacteria | 3721 |
| 341 | Ga0207694_10032653 | 3300025924 | Bacteria | 3986 |
| 342 | Ga0207694_10153973 | 3300025924 | Bacteria | 1853 |
| 343 | Ga0207650_10048494 | 3300025925 | Bacteria | 3133 |
| 344 | Ga0207650_10102827 | 3300025925 | Unclassified | 2202 |
| 345 | Ga0207659_10051388 | 3300025926 | Bacteria | 2932 |
| 346 | Ga0207659_10109228 | 3300025926 | Bacteria | 2099 |
| 347 | Ga0207687_10052178 | 3300025927 | Bacteria | 2853 |
| 348 | Ga0207687_10150549 | 3300025927 | Bacteria | 1775 |
| 349 | Ga0207644_10034395 | 3300025931 | Bacteria | 3546 |
| 350 | Ga0207644_10047527 | 3300025931 | Bacteria | 3063 |
| 351 | Ga0207690_10000123 | 3300025932 | Bacteria | 64409 |
| 352 | Ga0207690_10000302 | 3300025932 | Bacteria | 34397 |
| 353 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 354 | Ga0207706_10012244 | 3300025933 | Bacteria | 7818 |
| 355 | Ga0207686_10020122 | 3300025934 | Bacteria | 3808 |
| 356 | Ga0207709_10028723 | 3300025935 | Bacteria | 3218 |
| 357 | Ga0207669_10023375 | 3300025937 | Bacteria | 3301 |
| 358 | Ga0207704_10000152 | 3300025938 | Bacteria | 37143 |
| 359 | Ga0207704_10010912 | 3300025938 | Bacteria | 4454 |
| 360 | Ga0207704_10082910 | 3300025938 | Bacteria | 2079 |
| 361 | Ga0207691_10008833 | 3300025940 | Bacteria | 9669 |
| 362 | Ga0207691_10012734 | 3300025940 | Bacteria | 8056 |
| 363 | Ga0207691_10073778 | 3300025940 | Bacteria | 3078 |
| 364 | Ga0207689_10010659 | 3300025942 | Bacteria | 7911 |
| 365 | Ga0207689_10015490 | 3300025942 | Bacteria | 6456 |
| 366 | Ga0207689_10028844 | 3300025942 | Bacteria | 4640 |
| 367 | Ga0207689_10071032 | 3300025942 | Bacteria | 2860 |
| 368 | Ga0207661_10009913 | 3300025944 | Bacteria | 6841 |
| 369 | Ga0207667_10000588 | 3300025949 | Bacteria | 47296 |
| 370 | Ga0207667_10002388 | 3300025949 | Bacteria | 23501 |
| 371 | Ga0207667_10014958 | 3300025949 | Bacteria | 8825 |
| 372 | Ga0207667_10018379 | 3300025949 | Bacteria | 7841 |
| 373 | Ga0207667_10040394 | 3300025949 | Bacteria | 4968 |
| 374 | Ga0207667_10042723 | 3300025949 | Bacteria | 4817 |
| 375 | Ga0207667_10049187 | 3300025949 | Bacteria | 4455 |
| 376 | Ga0207667_10059535 | 3300025949 | Bacteria | 4000 |
| 377 | Ga0207667_10102417 | 3300025949 | Bacteria | 2954 |
| 378 | Ga0207667_10196451 | 3300025949 | Bacteria | 2070 |
| 379 | Ga0207651_10104682 | 3300025960 | Bacteria | 2109 |
| 380 | Ga0207712_10015307 | 3300025961 | Bacteria | 4944 |
| 381 | Ga0207712_10162822 | 3300025961 | Bacteria | 1736 |
| 382 | Ga0207668_10003719 | 3300025972 | Bacteria | 8974 |
| 383 | Ga0207658_10004128 | 3300025986 | Bacteria | 10129 |
| 384 | Ga0207658_10095890 | 3300025986 | Bacteria | 2312 |
| 385 | Ga0207677_10006267 | 3300026023 | Bacteria | 6507 |
| 386 | Ga0207703_10014260 | 3300026035 | Bacteria | 6198 |
| 387 | Ga0207639_10001566 | 3300026041 | Bacteria | 15344 |
| 388 | Ga0207639_10024995 | 3300026041 | Bacteria | 4328 |
| 389 | Ga0207639_10034951 | 3300026041 | Bacteria | 3718 |
| 390 | Ga0207639_10038170 | 3300026041 | Bacteria | 3571 |
| 391 | Ga0207639_10055047 | 3300026041 | Bacteria | 3043 |
| 392 | Ga0207639_10074379 | 3300026041 | Bacteria | 2668 |
| 393 | Ga0207639_10098018 | 3300026041 | Bacteria | 2362 |
| 394 | Ga0207639_10113336 | 3300026041 | Bacteria | 2214 |
| 395 | Ga0207678_10073395 | 3300026067 | Bacteria | 2932 |
| 396 | Ga0207678_10300219 | 3300026067 | Unclassified | 1380 |
| 397 | Ga0207702_10006138 | 3300026078 | Bacteria | 10404 |
| 398 | Ga0207702_10027092 | 3300026078 | Bacteria | 4759 |
| 399 | Ga0207702_10090023 | 3300026078 | Bacteria | 2684 |
| 400 | Ga0207702_10153037 | 3300026078 | Bacteria | 2100 |
| 401 | Ga0207702_10300519 | 3300026078 | Bacteria | 1523 |
| 402 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 403 | Ga0207641_10007665 | 3300026088 | Bacteria | 8975 |
| 404 | Ga0207641_10120612 | 3300026088 | Bacteria | 2339 |
| 405 | Ga0207648_10001009 | 3300026089 | Bacteria | 31692 |
| 406 | Ga0207648_10020759 | 3300026089 | Bacteria | 5913 |
| 407 | Ga0207648_10209007 | 3300026089 | Bacteria | 1732 |
| 408 | Ga0207676_10012082 | 3300026095 | Bacteria | 6179 |
| 409 | Ga0207674_10023520 | 3300026116 | Bacteria | 6597 |
| 410 | Ga0207675_100054473 | 3300026118 | Bacteria | 3731 |
| 411 | Ga0207683_10046348 | 3300026121 | Bacteria | 3804 |
| 412 | Ga0207698_10004294 | 3300026142 | Bacteria | 8679 |
| 413 | Ga0207698_10043103 | 3300026142 | Bacteria | 3378 |
| 414 | Ga0207698_10063733 | 3300026142 | Bacteria | 2886 |
| 415 | Ga0207698_10077233 | 3300026142 | Bacteria | 2669 |
| 416 | Ga0207698_10083562 | 3300026142 | Bacteria | 2585 |
| 417 | Ga0207698_10176560 | 3300026142 | Bacteria | 1887 |
| 418 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 419 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 420 | Ga0268265_10018586 | 3300028380 | Bacteria | 4820 |
| 421 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 422 | Ga0268264_10005516 | 3300028381 | Bacteria | 10729 |
| 423 | Ga0268264_10008123 | 3300028381 | Bacteria | 8726 |
| 424 | Ga0268264_10010682 | 3300028381 | Bacteria | 7584 |
| 425 | Ga0268264_10021004 | 3300028381 | Bacteria | 5335 |
| 426 | Ga0268264_10025804 | 3300028381 | Bacteria | 4799 |
| 427 | Ga0268264_10064233 | 3300028381 | Bacteria | 3089 |
| 428 | Ga0307517_10000129 | 3300028786 | Bacteria | 114359 |
| 429 | Ga0307517_10013371 | 3300028786 | Bacteria | 11154 |
| 430 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 431 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 432 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 433 | Ga0307515_10139375 | 3300028794 | Bacteria | 2612 |
| 434 | Ga0307515_10163932 | 3300028794 | Bacteria | 2251 |
| 435 | Ga0265327_10000191 | 3300031251 | Bacteria | 130083 |
| 436 | Ga0265327_10017292 | 3300031251 | Bacteria | 4534 |
| 437 | Ga0307513_10021388 | 3300031456 | Bacteria | 7638 |
| 438 | Ga0307513_10140273 | 3300031456 | Bacteria | 2344 |
| 439 | Ga0307408_100000999 | 3300031548 | Bacteria | 21841 |
| 440 | Ga0307508_10000341 | 3300031616 | Bacteria | 56692 |
| 441 | Ga0307516_10000292 | 3300031730 | Bacteria | 65041 |
| 442 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 443 | Ga0307405_10014857 | 3300031731 | Bacteria | 4200 |
| 444 | Ga0307407_10000010 | 3300031903 | Bacteria | 186970 |
| 445 | Ga0307412_10095568 | 3300031911 | Bacteria | 2089 |
| 446 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 447 | Ga0307414_10000060 | 3300032004 | Bacteria | 112029 |
| 448 | Ga0307414_10004388 | 3300032004 | Bacteria | 7660 |
| 449 | Ga0307414_10062989 | 3300032004 | Bacteria | 2634 |
| 450 | Ga0307507_10068633 | 3300033179 | Bacteria | 3233 |
| 451 | Ga0307510_10000414 | 3300033180 | Bacteria | 40819 |
| 452 | Ga0307510_10000544 | 3300033180 | Bacteria | 37722 |
| 453 | Ga0373937_0088750 | 3300036401 | Bacteria | 2863 |
| 454 | Ga0316584_0018837 | 3300036712 | Bacteria | 4984 |
| 455 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 456 | Ga0395899_0000409 | 3300037312 | Bacteria | 50188 |
| 457 | Ga0395899_0000446 | 3300037312 | Bacteria | 47368 |
| 458 | Ga0395899_0016303 | 3300037312 | Bacteria | 5663 |
| 459 | Ga0395900_0000048 | 3300037418 | Bacteria | 227760 |
| 460 | Ga0395900_0000554 | 3300037418 | Bacteria | 51989 |
| 461 | Ga0395900_0002467 | 3300037418 | Bacteria | 20362 |
| 462 | Ga0395900_0022425 | 3300037418 | Bacteria | 6457 |
| 463 | Ga0395900_0096123 | 3300037418 | Bacteria | 3044 |
| 464 | Ga0395898_0003621 | 3300037466 | Bacteria | 17202 |
| 465 | Ga0395898_0016652 | 3300037466 | Bacteria | 7514 |
| 466 | Ga0395898_0048811 | 3300037466 | Bacteria | 4149 |
| 467 | Ga0395905_0000246 | 3300037471 | Bacteria | 81356 |
| 468 | Ga0395905_0005177 | 3300037471 | Bacteria | 13371 |
| 469 | Ga0395905_0030492 | 3300037471 | Bacteria | 5081 |
| 470 | Ga0395901_0000184 | 3300038443 | Bacteria | 81257 |
| 471 | Ga0395901_0004208 | 3300038443 | Bacteria | 14506 |
| 472 | Ga0395901_0022049 | 3300038443 | Bacteria | 6528 |
| 473 | Ga0436365_0585774 | 3300039437 | Bacteria | 54587 |
| 474 | Ga0436361_0137765 | 3300039447 | Bacteria | 20400 |
| 475 | Ga0439436_0007552 | 3300041404 | Bacteria | 3345 |
| 476 | Ga0439431_0000333 | 3300041997 | Bacteria | 9831 |
| 477 | Ga0439457_001546 | 3300042014 | Bacteria | 6901 |
| 478 | Ga0451577_0001955 | 3300042876 | Bacteria | 25990 |
| 479 | Ga0451577_0006921 | 3300042876 | Bacteria | 11210 |
| 480 | Ga0466972_0000008 | 3300044658 | Bacteria | 264518 |
| 481 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 482 | Ga0466972_0006217 | 3300044658 | Bacteria | 6000 |
| 483 | Ga0466972_0006435 | 3300044658 | Bacteria | 5900 |
| 484 | Ga0466966_0027932 | 3300044684 | Bacteria | 3677 |
| 485 | Ga0453684_0000987 | 3300044712 | Bacteria | 92919 |
| 486 | Ga0466968_0007233 | 3300044735 | Bacteria | 4217 |
| 487 | Ga0466968_0025018 | 3300044735 | Bacteria | 2443 |
| 488 | Ga0466970_0000572 | 3300044765 | Bacteria | 17985 |
| 489 | Ga0466957_0004072 | 3300044842 | Bacteria | 8093 |
| 490 | Ga0466959_0000020 | 3300045049 | Bacteria | 133659 |
| 491 | Ga0466959_0025029 | 3300045049 | Bacteria | 4421 |
| 492 | Ga0451576_0017589 | 3300045051 | Bacteria | 7856 |
| 493 | Ga0495638_0016902 | 3300046460 | Bacteria | 4878 |
| 494 | Ga0495610_0000889 | 3300046512 | Bacteria | 27794 |
| 495 | Ga0495610_0001152 | 3300046512 | Bacteria | 24038 |
| 496 | Ga0495631_0002836 | 3300046518 | Bacteria | 9627 |
| 497 | Ga0495633_0011477 | 3300046558 | Bacteria | 4772 |
| 498 | Ga0495668_0001289 | 3300046616 | Bacteria | 24742 |
| 499 | Ga0495611_0000038 | 3300046648 | Bacteria | 100121 |
| 500 | Ga0495625_0107032 | 3300046660 | Bacteria | 1914 |
| 501 | Ga0495661_0003544 | 3300046665 | Bacteria | 11503 |
| 502 | Ga0495683_0057753 | 3300047323 | Unclassified | 1928 |
| 503 | Ga0495687_000243 | 3300047443 | Bacteria | 75026 |
| 504 | Ga0495687_001365 | 3300047443 | Bacteria | 22565 |
| 505 | Ga0495686_0000663 | 3300047472 | Bacteria | 46787 |
| 506 | Ga0496102_0152923 | 3300048905 | Bacteria | 2169 |
| 507 | Ga0496108_0080324 | 3300048911 | Bacteria | 2762 |
| 508 | Ga0496109_0085847 | 3300048912 | Bacteria | 2906 |
| 509 | Ga0501298_000480 | 3300049521 | Bacteria | 5380 |
| 510 | Ga0501033_0091845 | 3300049570 | Bacteria | 2221 |
| 511 | Ga0501034_0009800 | 3300049571 | Bacteria | 10017 |
| 512 | Ga0501034_0030313 | 3300049571 | Bacteria | 5498 |
| 513 | Ga0501034_0043259 | 3300049571 | Bacteria | 4559 |
| 514 | Ga0501034_0144115 | 3300049571 | Bacteria | 2360 |
| 515 | Ga0501036_0084608 | 3300049572 | Bacteria | 2681 |
| 516 | Ga0501037_0055934 | 3300049573 | Bacteria | 2884 |
| 517 | Ga0501046_0013960 | 3300049580 | Bacteria | 6785 |
| 518 | Ga0501047_0036341 | 3300049581 | Bacteria | 4761 |
| 519 | Ga0501047_0091572 | 3300049581 | Bacteria | 2919 |
| 520 | Ga0501073_0018343 | 3300049589 | Bacteria | 5057 |
| 521 | Ga0501074_0148663 | 3300049590 | Bacteria | 1675 |
| 522 | Ga0501202_000022 | 3300049652 | Bacteria | 16472 |
| 523 | Ga0501217_007300 | 3300049661 | Bacteria | 2365 |
| 524 | Ga0501223_002835 | 3300049663 | Bacteria | 3803 |
| 525 | Ga0501233_000974 | 3300049668 | Bacteria | 4861 |
| 526 | Ga0501259_000604 | 3300049688 | Bacteria | 5746 |
| 527 | Ga0501219_000022 | 3300049703 | Bacteria | 24237 |
| 528 | Ga0501221_000181 | 3300049704 | Bacteria | 8810 |
| 529 | Ga0501225_0000455 | 3300049705 | Bacteria | 12823 |
| 530 | Ga0501225_0000601 | 3300049705 | Bacteria | 11211 |
| 531 | Ga0501241_000538 | 3300049758 | Bacteria | 8127 |
| 532 | Ga0501241_004838 | 3300049758 | Bacteria | 2515 |
| 533 | Ga0501035_0241293 | 3300049822 | Unclassified | 1537 |
| 534 | Ga0501044_0014016 | 3300049823 | Bacteria | 8658 |
| 535 | Ga0501044_0103676 | 3300049823 | Bacteria | 2859 |
| 536 | Ga0501284_00068 | 3300050005 | Bacteria | 31369 |
| 537 | nmdc:mga0k408_522_c1 | 3300050493 | Bacteria | 21138 |
| 538 | nmdc:mga05p37_36893_c1 | 3300050507 | Bacteria | 5995 |
| 539 | Ga0500578_0000065 | 3300053086 | Bacteria | 117032 |
| 540 | Ga0500644_0000237 | 3300053088 | Bacteria | 31377 |
| 541 | Ga0500583_0000083 | 3300053092 | Bacteria | 53982 |
| 542 | Ga0500583_0002800 | 3300053092 | Bacteria | 5339 |
| 543 | Ga0500583_0086954 | 3300053092 | Bacteria | 1517 |
| 544 | Ga0500562_000028 | 3300053108 | Bacteria | 95758 |
| 545 | Ga0500608_000244 | 3300053122 | Bacteria | 21445 |
| 546 | Ga0500642_0004657 | 3300053130 | Bacteria | 4324 |
| 547 | Ga0500559_0029659 | 3300053136 | Bacteria | 2344 |
| 548 | Ga0500589_036854 | 3300053147 | Bacteria | 2284 |
| 549 | Ga0500616_0055221 | 3300053153 | Bacteria | 2078 |
| 550 | Ga0500622_0000285 | 3300053156 | Bacteria | 51581 |
| 551 | Ga0500622_0003451 | 3300053156 | Bacteria | 10545 |
| 552 | Ga0500622_0004309 | 3300053156 | Bacteria | 9005 |
| 553 | Ga0500622_0092148 | 3300053156 | Bacteria | 1502 |
| 554 | Ga0500627_0004171 | 3300053158 | Bacteria | 4595 |
| 555 | Ga0500633_0006626 | 3300053160 | Bacteria | 2854 |
| 556 | Ga0500636_0070848 | 3300053177 | Bacteria | 2022 |
| 557 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 558 | Ga0500661_010710 | 3300055283 | Bacteria | 1668 |
| 559 | Ga0466962_0024442 | 3300061719 | Bacteria | 2902 |
| 560 | 2586208982 | 2585427687 | Bacteria | 5544917 |
| 561 | 2738729811 | 2738541278 | Bacteria | 9755573 |
| 562 | 2738851993 | 2738541302 | Bacteria | 5944758 |
| 563 | 2739590873 | 2739367651 | Bacteria | 6359826 |
| 564 | 2739616972 | 2739367656 | Bacteria | 5152243 |
| 565 | 2739647262 | 2739367663 | Bacteria | 5040914 |
| 566 | 2819546542 | 2818991437 | Bacteria | 5805520 |
| 567 | 2819587809 | 2818991444 | Bacteria | 6968812 |
| 568 | 2840679315 | 2840677318 | Bacteria | 2664183 |
| 569 | 2842725234 | 2842722452 | Bacteria | 6263924 |
| 570 | 2842912509 | 2842909656 | Bacteria | 6185908 |
| 571 | 2849286813 | 2849281842 | Bacteria | 6065644 |
| 572 | 2857629697 | 2857627736 | Bacteria | 5625397 |
| 573 | 2884795641 | 2884791551 | Bacteria | 8511252 |
| 574 | 2884937854 | 2884933994 | Bacteria | 4535041 |
| 575 | 2896087126 | 2896085136 | Bacteria | 6129793 |
| 576 | 2902052866 | 2902048731 | Bacteria | 4976191 |
| 577 | 2910247794 | 2910245624 | Bacteria | 6935613 |
| 578 | 2919692726 | 2919692658 | Bacteria | 5943958 |
| 579 | 2929158155 | 2929154850 | Bacteria | 6753285 |
| 580 | 2929926021 | 2929921140 | Bacteria | 8649150 |
| 581 | 2946002156 | 2945997725 | Bacteria | 6404843 |
| 582 | 2954019054 | 2954016120 | Bacteria | 6446024 |
| 583 | 8003153024 | 8003151029 | Bacteria | 8187759 |
| 584 | Ga0157379_10036321 | |||
| 585 | JGI24740J21852_10000446 | |||
| 586 | JGI24739J22299_10015875 | |||
| 587 | JGI25154J39366_1000072 | |||
| 588 | JGI25152J39213_1000022 | |||
| 589 | JGI25150J39212_1000001 | |||
| 590 | JGI25151J46595_10000001 | |||
| 591 | JGI25153J46596_10000001 | |||
| 592 | JGI25153J46596_10000565 | |||
| 593 | JGI25153J46596_10000777 | |||
| 594 | rootH1_10028562 | |||
| 595 | rootH2_10001273 | |||
| 596 | rootH2_10019694 | |||
| 597 | rootH2_10026785 | |||
| 598 | rootH2_10028784 | |||
| 599 | rootL2_10022071 | |||
| 600 | rootL2_10030076 | |||
| 601 | rootL2_10061337 | |||
| 602 | rootH1_10008582 | |||
| 603 | rootH1_10230979 | |||
| 604 | JGI25160J50197_1002167 | |||
| 605 | Ga0055536_1000001 | |||
| 606 | Ga0055528_1000395 | |||
| 607 | Ga0055530_10001870 | |||
| 608 | Ga0055530_10002315 | |||
| 609 | Ga0055531_10000349 | |||
| 610 | Ga0065165_1000056 | |||
| 611 | Ga0065714_10064604 | |||
| 612 | Ga0065714_10076778 | |||
| 613 | Ga0070658_10000073 | |||
| 614 | Ga0070676_10000015 | |||
| 615 | Ga0070683_100006273 | |||
| 616 | Ga0070670_100065036 | |||
| 617 | Ga0070670_100084873 | |||
| 618 | Ga0070670_100231280 | |||
| 619 | Ga0068869_100004677 | |||
| 620 | Ga0068869_100018886 | |||
| 621 | Ga0070666_10000101 | |||
| 622 | Ga0070666_10000284 | |||
| 623 | Ga0070666_10082082 | |||
| 624 | Ga0068868_100002455 | |||
| 625 | Ga0068868_100002718 | |||
| 626 | Ga0070660_100040910 | |||
| 627 | Ga0070691_10018879 | |||
| 628 | Ga0070668_100010612 | |||
| 629 | Ga0070668_100073726 | |||
| 630 | Ga0070675_100080466 | |||
| 631 | Ga0070675_100116440 | |||
| 632 | Ga0070671_100000813 | |||
| 633 | Ga0070671_100010258 | |||
| 634 | Ga0070671_100012461 | |||
| 635 | Ga0070671_100042263 | |||
| 636 | Ga0070674_100029342 | |||
| 637 | Ga0070673_100020734 | |||
| 638 | Ga0070673_100044001 | |||
| 639 | Ga0070673_100191008 | |||
| 640 | Ga0070659_100000092 | |||
| 641 | Ga0070659_100001662 | |||
| 642 | Ga0070659_100021371 | |||
| 643 | Ga0070659_100088183 | |||
| 644 | Ga0070667_100001105 | |||
| 645 | Ga0070667_100009567 | |||
| 646 | Ga0070667_100083909 | |||
| 647 | Ga0070663_100051799 | |||
| 648 | Ga0070678_100000121 | |||
| 649 | Ga0070678_100006438 | |||
| 650 | Ga0070662_100001108 | |||
| 651 | Ga0070662_100006135 | |||
| 652 | Ga0070681_10028132 | |||
| 653 | Ga0070681_10061338 | |||
| 654 | Ga0068867_100000210 | |||
| 655 | Ga0068867_100009329 | |||
| 656 | Ga0070698_100190950 | |||
| 657 | Ga0070679_100035964 | |||
| 658 | Ga0070679_100052415 | |||
| 659 | Ga0070684_100117056 | |||
| 660 | Ga0068853_100002242 | |||
| 661 | Ga0068853_100003568 | |||
| 662 | Ga0068853_100036238 | |||
| 663 | Ga0068853_100046732 | |||
| 664 | Ga0068853_100089274 | |||
| 665 | Ga0068853_100090738 | |||
| 666 | Ga0068853_100130672 | |||
| 667 | Ga0068853_100213833 | |||
| 668 | Ga0070672_100007825 | |||
| 669 | Ga0070665_100000006 | |||
| 670 | Ga0070665_100000017 | |||
| 671 | Ga0070665_100017871 | |||
| 672 | Ga0068855_100000093 | |||
| 673 | Ga0068855_100007710 | |||
| 674 | Ga0068855_100009409 | |||
| 675 | Ga0068855_100015883 | |||
| 676 | Ga0068855_100024363 | |||
| 677 | Ga0068855_100027574 | |||
| 678 | Ga0068855_100078355 | |||
| 679 | Ga0068855_100087356 | |||
| 680 | Ga0068855_100122763 | |||
| 681 | Ga0068855_100123833 | |||
| 682 | Ga0068857_100005539 | |||
| 683 | Ga0068857_100028155 | |||
| 684 | Ga0068854_100053650 | |||
| 685 | Ga0068854_100078718 | |||
| 686 | Ga0068856_100017951 | |||
| 687 | Ga0068856_100060188 | |||
| 688 | Ga0068856_100101929 | |||
| 689 | Ga0068856_100137437 | |||
| 690 | Ga0068852_100001727 | |||
| 691 | Ga0068852_100003100 | |||
| 692 | Ga0068852_100007925 | |||
| 693 | Ga0068852_100037083 | |||
| 694 | Ga0068852_100068143 | |||
| 695 | Ga0068852_100258660 | |||
| 696 | Ga0068859_100000007 | |||
| 697 | Ga0068864_100008124 | |||
| 698 | Ga0068851_10003086 | |||
| 699 | Ga0068851_10003129 | |||
| 700 | Ga0068851_10069755 | |||
| 701 | Ga0068870_10003637 | |||
| 702 | Ga0068863_100008701 | |||
| 703 | Ga0068863_100011861 | |||
| 704 | Ga0068863_100050055 | |||
| 705 | Ga0068863_100142873 | |||
| 706 | Ga0068858_100018502 | |||
| 707 | Ga0068858_100157904 | |||
| 708 | Ga0068860_100000005 | |||
| 709 | Ga0068860_100002179 | |||
| 710 | Ga0068860_100002561 | |||
| 711 | Ga0068860_100007090 | |||
| 712 | Ga0068860_100010720 | |||
| 713 | Ga0068860_100021171 | |||
| 714 | Ga0068860_100065089 | |||
| 715 | Ga0068862_100004372 | |||
| 716 | Ga0097621_100000308 | |||
| 717 | Ga0097621_100000459 | |||
| 718 | Ga0097621_100003734 | |||
| 719 | Ga0097621_100004375 | |||
| 720 | Ga0097621_100141456 | |||
| 721 | Ga0097621_100163260 | |||
| 722 | Ga0068871_100000046 | |||
| 723 | Ga0068871_100000069 | |||
| 724 | Ga0068871_100015030 | |||
| 725 | Ga0068871_100033286 | |||
| 726 | Ga0068865_100000041 | |||
| 727 | Ga0068865_100015112 | |||
| 728 | Ga0068865_100017659 | |||
| 729 | Ga0097620_100000007 | |||
| 730 | Ga0105240_10000100 | |||
| 731 | Ga0105240_10003673 | |||
| 732 | Ga0105240_10003886 | |||
| 733 | Ga0105240_10008491 | |||
| 734 | Ga0105240_10038050 | |||
| 735 | Ga0105240_10046321 | |||
| 736 | Ga0105240_10060033 | |||
| 737 | Ga0105240_10065502 | |||
| 738 | Ga0105240_10083954 | |||
| 739 | Ga0105240_10120733 | |||
| 740 | Ga0105240_10188829 | |||
| 741 | Ga0105240_10275458 | |||
| 742 | Ga0105240_10315315 | |||
| 743 | Ga0111539_10211862 | |||
| 744 | Ga0105245_10035013 | |||
| 745 | Ga0105245_10136166 | |||
| 746 | Ga0105245_10200726 | |||
| 747 | Ga0105245_10262484 | |||
| 748 | Ga0105247_10011230 | |||
| 749 | Ga0114129_10001095 | |||
| 750 | Ga0105243_10037179 | |||
| 751 | Ga0105241_10000924 | |||
| 752 | Ga0105241_10008283 | |||
| 753 | Ga0105241_10050359 | |||
| 754 | Ga0105241_10094608 | |||
| 755 | Ga0105241_10131825 | |||
| 756 | Ga0105241_10253820 | |||
| 757 | Ga0105242_10009234 | |||
| 758 | Ga0105242_10042772 | |||
| 759 | Ga0105242_10046589 | |||
| 760 | Ga0105242_10216811 | |||
| 761 | Ga0105248_10077747 | |||
| 762 | Ga0105248_10141733 | |||
| 763 | Ga0105237_10000232 | |||
| 764 | Ga0105237_10000390 | |||
| 765 | Ga0105237_10001116 | |||
| 766 | Ga0105237_10001595 | |||
| 767 | Ga0105237_10002166 | |||
| 768 | Ga0105237_10002312 | |||
| 769 | Ga0105237_10006705 | |||
| 770 | Ga0105237_10029814 | |||
| 771 | Ga0105237_10034382 | |||
| 772 | Ga0105237_10040616 | |||
| 773 | Ga0105237_10050086 | |||
| 774 | Ga0105237_10050315 | |||
| 775 | Ga0105237_10156643 | |||
| 776 | Ga0105238_10002309 | |||
| 777 | Ga0105238_10020489 | |||
| 778 | Ga0105238_10128375 | |||
| 779 | Ga0105249_10008407 | |||
| 780 | Ga0105249_10014072 | |||
| 781 | Ga0105249_10171939 | |||
| 782 | Ga0105239_10000093 | |||
| 783 | Ga0105239_10000811 | |||
| 784 | Ga0105239_10002220 | |||
| 785 | Ga0105239_10006964 | |||
| 786 | Ga0105239_10009313 | |||
| 787 | Ga0105239_10010978 | |||
| 788 | Ga0105239_10019355 | |||
| 789 | Ga0105239_10025593 | |||
| 790 | Ga0105239_10049953 | |||
| 791 | Ga0105239_10050628 | |||
| 792 | Ga0105239_10134790 | |||
| 793 | Ga0157373_10000523 | |||
| 794 | Ga0157373_10054929 | |||
| 795 | Ga0157371_10000276 | |||
| 796 | Ga0157371_10062263 | |||
| 797 | Ga0157371_10088759 | |||
| 798 | Ga0157371_10100874 | |||
| 799 | Ga0157371_10132437 | |||
| 800 | Ga0157370_10000536 | |||
| 801 | Ga0157370_10002639 | |||
| 802 | Ga0157370_10052661 | |||
| 803 | Ga0157369_10000040 | |||
| 804 | Ga0157369_10000516 | |||
| 805 | Ga0157369_10018288 | |||
| 806 | Ga0157369_10025570 | |||
| 807 | Ga0157369_10050194 | |||
| 808 | Ga0157369_10173810 | |||
| 809 | Ga0157374_10000004 | |||
| 810 | Ga0157374_10000137 | |||
| 811 | Ga0157374_10000563 | |||
| 812 | Ga0157374_10018540 | |||
| 813 | Ga0157374_10076017 | |||
| 814 | Ga0157378_10003261 | |||
| 815 | Ga0157378_10048959 | |||
| 816 | Ga0157378_10054759 | |||
| 817 | Ga0163162_10000026 | |||
| 818 | Ga0163162_10000350 | |||
| 819 | Ga0163162_10001413 | |||
| 820 | Ga0163162_10002843 | |||
| 821 | Ga0163162_10004561 | |||
| 822 | Ga0163162_10009962 | |||
| 823 | Ga0163162_10010516 | |||
| 824 | Ga0163162_10152946 | |||
| 825 | Ga0163162_10208339 | |||
| 826 | Ga0157372_10000010 | |||
| 827 | Ga0157372_10000052 | |||
| 828 | Ga0157372_10000428 | |||
| 829 | Ga0157372_10001180 | |||
| 830 | Ga0157372_10028236 | |||
| 831 | Ga0157372_10226379 | |||
| 832 | Ga0157372_10342286 | |||
| 833 | Ga0157372_10366828 | |||
| 834 | Ga0157375_10000646 | |||
| 835 | Ga0157375_10014533 | |||
| 836 | Ga0157375_10021180 | |||
| 837 | Ga0157375_10075835 | |||
| 838 | Ga0157375_10084265 | |||
| 839 | Ga0157375_10155412 | |||
| 840 | Ga0163163_10000508 | |||
| 841 | Ga0163163_10010072 | |||
| 842 | Ga0163163_10041586 | |||
| 843 | Ga0163163_10386409 | |||
| 844 | Ga0157380_10016417 | |||
| 845 | Ga0157380_10028007 | |||
| 846 | Ga0157377_10000798 | |||
| 847 | Ga0157379_10015800 | |||
| 848 | Ga0157379_10042832 | |||
| 849 | Ga0157379_10169402 | |||
| 850 | Ga0157376_10001099 | |||
| 851 | Ga0157376_10006711 | |||
| 852 | Ga0157376_10010382 | |||
| 853 | Ga0157376_10011464 | |||
| 854 | Ga0157376_10037106 | |||
| 855 | Ga0157376_10121138 | |||
| 856 | Ga0182006_1000302 | |||
| 857 | Ga0182006_1001597 | |||
| 858 | Ga0182007_10000003 | |||
| 859 | Ga0183373_1001 | |||
| 860 | Ga0163161_10000284 | |||
| 861 | Ga0163161_10001539 | |||
| 862 | Ga0163161_10099102 | |||
| 863 | Ga0213876_10000584 | |||
| 864 | Ga0209258_100303 | |||
| 865 | Ga0207425_1000002 | |||
| 866 | Ga0209646_1000037 | |||
| 867 | Ga0209026_1000542 | |||
| 868 | Ga0209026_1001067 | |||
| 869 | Ga0209148_1000329 | |||
| 870 | Ga0209129_1000002 | |||
| 871 | Ga0209673_1000014 | |||
| 872 | Ga0209676_1000008 | |||
| 873 | Ga0209025_1000004 | |||
| 874 | Ga0209564_1007304 | |||
| 875 | Ga0209564_1016977 | |||
| 876 | Ga0209758_1000006 | |||
| 877 | Ga0209758_1001126 | |||
| 878 | Ga0209758_1006838 | |||
| 879 | Ga0209758_1010043 | |||
| 880 | Ga0209050_1000055 | |||
| 881 | Ga0209050_1000539 | |||
| 882 | Ga0207426_1000002 | |||
| 883 | Ga0207426_1000193 | |||
| 884 | Ga0207426_1000786 | |||
| 885 | Ga0209257_1000008 | |||
| 886 | Ga0209257_1009803 | |||
| 887 | Ga0207656_10001168 | |||
| 888 | Ga0207710_10017270 | |||
| 889 | Ga0207680_10000067 | |||
| 890 | Ga0207680_10058938 | |||
| 891 | Ga0207647_10000049 | |||
| 892 | Ga0207645_10000058 | |||
| 893 | Ga0207645_10000599 | |||
| 894 | Ga0207705_10000225 | |||
| 895 | Ga0207654_10008988 | |||
| 896 | Ga0207654_10012339 | |||
| 897 | Ga0207654_10052043 | |||
| 898 | Ga0207707_10095301 | |||
| 899 | Ga0207695_10000027 | |||
| 900 | Ga0207695_10000055 | |||
| 901 | Ga0207695_10000164 | |||
| 902 | Ga0207695_10006874 | |||
| 903 | Ga0207695_10013890 | |||
| 904 | Ga0207695_10019581 | |||
| 905 | Ga0207695_10039756 | |||
| 906 | Ga0207695_10040889 | |||
| 907 | Ga0207695_10106848 | |||
| 908 | Ga0207695_10162907 | |||
| 909 | Ga0207695_10195231 | |||
| 910 | Ga0207695_10214587 | |||
| 911 | Ga0207671_10000259 | |||
| 912 | Ga0207671_10000584 | |||
| 913 | Ga0207671_10000923 | |||
| 914 | Ga0207671_10004787 | |||
| 915 | Ga0207671_10010514 | |||
| 916 | Ga0207671_10019043 | |||
| 917 | Ga0207671_10019863 | |||
| 918 | Ga0207671_10041671 | |||
| 919 | Ga0207671_10043233 | |||
| 920 | Ga0207671_10060482 | |||
| 921 | Ga0207657_10028327 | |||
| 922 | Ga0207657_10118593 | |||
| 923 | Ga0207652_10046020 | |||
| 924 | Ga0207694_10032653 | |||
| 925 | Ga0207694_10153973 | |||
| 926 | Ga0207650_10048494 | |||
| 927 | Ga0207650_10102827 | |||
| 928 | Ga0207659_10051388 | |||
| 929 | Ga0207659_10109228 | |||
| 930 | Ga0207687_10052178 | |||
| 931 | Ga0207687_10150549 | |||
| 932 | Ga0207644_10034395 | |||
| 933 | Ga0207644_10047527 | |||
| 934 | Ga0207690_10000123 | |||
| 935 | Ga0207690_10000302 | |||
| 936 | Ga0207706_10000111 | |||
| 937 | Ga0207706_10012244 | |||
| 938 | Ga0207686_10020122 | |||
| 939 | Ga0207709_10028723 | |||
| 940 | Ga0207669_10023375 | |||
| 941 | Ga0207704_10000152 | |||
| 942 | Ga0207704_10010912 | |||
| 943 | Ga0207704_10082910 | |||
| 944 | Ga0207691_10008833 | |||
| 945 | Ga0207691_10012734 | |||
| 946 | Ga0207691_10073778 | |||
| 947 | Ga0207689_10010659 | |||
| 948 | Ga0207689_10015490 | |||
| 949 | Ga0207689_10028844 | |||
| 950 | Ga0207689_10071032 | |||
| 951 | Ga0207661_10009913 | |||
| 952 | Ga0207667_10000588 | |||
| 953 | Ga0207667_10002388 | |||
| 954 | Ga0207667_10014958 | |||
| 955 | Ga0207667_10018379 | |||
| 956 | Ga0207667_10040394 | |||
| 957 | Ga0207667_10042723 | |||
| 958 | Ga0207667_10049187 | |||
| 959 | Ga0207667_10059535 | |||
| 960 | Ga0207667_10102417 | |||
| 961 | Ga0207667_10196451 | |||
| 962 | Ga0207651_10104682 | |||
| 963 | Ga0207712_10015307 | |||
| 964 | Ga0207712_10162822 | |||
| 965 | Ga0207668_10003719 | |||
| 966 | Ga0207658_10004128 | |||
| 967 | Ga0207658_10095890 | |||
| 968 | Ga0207677_10006267 | |||
| 969 | Ga0207703_10014260 | |||
| 970 | Ga0207639_10001566 | |||
| 971 | Ga0207639_10024995 | |||
| 972 | Ga0207639_10034951 | |||
| 973 | Ga0207639_10038170 | |||
| 974 | Ga0207639_10055047 | |||
| 975 | Ga0207639_10074379 | |||
| 976 | Ga0207639_10098018 | |||
| 977 | Ga0207639_10113336 | |||
| 978 | Ga0207678_10073395 | |||
| 979 | Ga0207678_10300219 | |||
| 980 | Ga0207702_10006138 | |||
| 981 | Ga0207702_10027092 | |||
| 982 | Ga0207702_10090023 | |||
| 983 | Ga0207702_10153037 | |||
| 984 | Ga0207702_10300519 | |||
| 985 | Ga0207641_10000056 | |||
| 986 | Ga0207641_10007665 | |||
| 987 | Ga0207641_10120612 | |||
| 988 | Ga0207648_10001009 | |||
| 989 | Ga0207648_10020759 | |||
| 990 | Ga0207648_10209007 | |||
| 991 | Ga0207676_10012082 | |||
| 992 | Ga0207674_10023520 | |||
| 993 | Ga0207675_100054473 | |||
| 994 | Ga0207683_10046348 | |||
| 995 | Ga0207698_10004294 | |||
| 996 | Ga0207698_10043103 | |||
| 997 | Ga0207698_10063733 | |||
| 998 | Ga0207698_10077233 | |||
| 999 | Ga0207698_10083562 | |||
| 1000 | Ga0207698_10176560 | |||
| 1001 | Ga0268266_10000010 | |||
| 1002 | Ga0268266_10000037 | |||
| 1003 | Ga0268265_10018586 | |||
| 1004 | Ga0268264_10000012 | |||
| 1005 | Ga0268264_10005516 | |||
| 1006 | Ga0268264_10008123 | |||
| 1007 | Ga0268264_10010682 | |||
| 1008 | Ga0268264_10021004 | |||
| 1009 | Ga0268264_10025804 | |||
| 1010 | Ga0268264_10064233 | |||
| 1011 | Ga0307517_10000129 | |||
| 1012 | Ga0307517_10013371 | |||
| 1013 | Ga0307515_10000002 | |||
| 1014 | Ga0307515_10000003 | |||
| 1015 | Ga0307515_10000078 | |||
| 1016 | Ga0307515_10139375 | |||
| 1017 | Ga0307515_10163932 | |||
| 1018 | Ga0265327_10000191 | |||
| 1019 | Ga0265327_10017292 | |||
| 1020 | Ga0307513_10021388 | |||
| 1021 | Ga0307513_10140273 | |||
| 1022 | Ga0307408_100000999 | |||
| 1023 | Ga0307508_10000341 | |||
| 1024 | Ga0307516_10000292 | |||
| 1025 | Ga0307405_10000003 | |||
| 1026 | Ga0307405_10014857 | |||
| 1027 | Ga0307407_10000010 | |||
| 1028 | Ga0307412_10095568 | |||
| 1029 | Ga0307416_100000014 | |||
| 1030 | Ga0307414_10000060 | |||
| 1031 | Ga0307414_10004388 | |||
| 1032 | Ga0307414_10062989 | |||
| 1033 | Ga0307507_10068633 | |||
| 1034 | Ga0307510_10000414 | |||
| 1035 | Ga0307510_10000544 | |||
| 1036 | Ga0373937_0088750 | |||
| 1037 | Ga0316584_0018837 | |||
| 1038 | Ga0395899_0000001 | |||
| 1039 | Ga0395899_0000409 | |||
| 1040 | Ga0395899_0000446 | |||
| 1041 | Ga0395899_0016303 | |||
| 1042 | Ga0395900_0000048 | |||
| 1043 | Ga0395900_0000554 | |||
| 1044 | Ga0395900_0002467 | |||
| 1045 | Ga0395900_0022425 | |||
| 1046 | Ga0395900_0096123 | |||
| 1047 | Ga0395898_0003621 | |||
| 1048 | Ga0395898_0016652 | |||
| 1049 | Ga0395898_0048811 | |||
| 1050 | Ga0395905_0000246 | |||
| 1051 | Ga0395905_0005177 | |||
| 1052 | Ga0395905_0030492 | |||
| 1053 | Ga0395901_0000184 | |||
| 1054 | Ga0395901_0004208 | |||
| 1055 | Ga0395901_0022049 | |||
| 1056 | Ga0436365_0585774 | |||
| 1057 | Ga0436361_0137765 | |||
| 1058 | Ga0439436_0007552 | |||
| 1059 | Ga0439431_0000333 | |||
| 1060 | Ga0439457_001546 | |||
| 1061 | Ga0451577_0001955 | |||
| 1062 | Ga0451577_0006921 | |||
| 1063 | Ga0466972_0000008 | |||
| 1064 | Ga0466972_0000010 | |||
| 1065 | Ga0466972_0006217 | |||
| 1066 | Ga0466972_0006435 | |||
| 1067 | Ga0466966_0027932 | |||
| 1068 | Ga0453684_0000987 | |||
| 1069 | Ga0466968_0007233 | |||
| 1070 | Ga0466968_0025018 | |||
| 1071 | Ga0466970_0000572 | |||
| 1072 | Ga0466957_0004072 | |||
| 1073 | Ga0466959_0000020 | |||
| 1074 | Ga0466959_0025029 | |||
| 1075 | Ga0451576_0017589 | |||
| 1076 | Ga0495638_0016902 | |||
| 1077 | Ga0495610_0000889 | |||
| 1078 | Ga0495610_0001152 | |||
| 1079 | Ga0495631_0002836 | |||
| 1080 | Ga0495633_0011477 | |||
| 1081 | Ga0495668_0001289 | |||
| 1082 | Ga0495611_0000038 | |||
| 1083 | Ga0495625_0107032 | |||
| 1084 | Ga0495661_0003544 | |||
| 1085 | Ga0495683_0057753 | |||
| 1086 | Ga0495687_000243 | |||
| 1087 | Ga0495687_001365 | |||
| 1088 | Ga0495686_0000663 | |||
| 1089 | Ga0496102_0152923 | |||
| 1090 | Ga0496108_0080324 | |||
| 1091 | Ga0496109_0085847 | |||
| 1092 | Ga0501298_000480 | |||
| 1093 | Ga0501033_0091845 | |||
| 1094 | Ga0501034_0009800 | |||
| 1095 | Ga0501034_0030313 | |||
| 1096 | Ga0501034_0043259 | |||
| 1097 | Ga0501034_0144115 | |||
| 1098 | Ga0501036_0084608 | |||
| 1099 | Ga0501037_0055934 | |||
| 1100 | Ga0501046_0013960 | |||
| 1101 | Ga0501047_0036341 | |||
| 1102 | Ga0501047_0091572 | |||
| 1103 | Ga0501073_0018343 | |||
| 1104 | Ga0501074_0148663 | |||
| 1105 | Ga0501202_000022 | |||
| 1106 | Ga0501217_007300 | |||
| 1107 | Ga0501223_002835 | |||
| 1108 | Ga0501233_000974 | |||
| 1109 | Ga0501259_000604 | |||
| 1110 | Ga0501219_000022 | |||
| 1111 | Ga0501221_000181 | |||
| 1112 | Ga0501225_0000455 | |||
| 1113 | Ga0501225_0000601 | |||
| 1114 | Ga0501241_000538 | |||
| 1115 | Ga0501241_004838 | |||
| 1116 | Ga0501035_0241293 | |||
| 1117 | Ga0501044_0014016 | |||
| 1118 | Ga0501044_0103676 | |||
| 1119 | Ga0501284_00068 | |||
| 1120 | nmdc:mga0k408_522_c1 | |||
| 1121 | nmdc:mga05p37_36893_c1 | |||
| 1122 | Ga0500578_0000065 | |||
| 1123 | Ga0500644_0000237 | |||
| 1124 | Ga0500583_0000083 | |||
| 1125 | Ga0500583_0002800 | |||
| 1126 | Ga0500583_0086954 | |||
| 1127 | Ga0500562_000028 | |||
| 1128 | Ga0500608_000244 | |||
| 1129 | Ga0500642_0004657 | |||
| 1130 | Ga0500559_0029659 | |||
| 1131 | Ga0500589_036854 | |||
| 1132 | Ga0500616_0055221 | |||
| 1133 | Ga0500622_0000285 | |||
| 1134 | Ga0500622_0003451 | |||
| 1135 | Ga0500622_0004309 | |||
| 1136 | Ga0500622_0092148 | |||
| 1137 | Ga0500627_0004171 | |||
| 1138 | Ga0500633_0006626 | |||
| 1139 | Ga0500636_0070848 | |||
| 1140 | Ga0500611_000002 | |||
| 1141 | Ga0500661_010710 | |||
| 1142 | Ga0466962_0024442 | |||
| 1143 | 2586208982 | |||
| 1144 | 2738729811 | |||
| 1145 | 2738851993 | |||
| 1146 | 2739590873 | |||
| 1147 | 2739616972 | |||
| 1148 | 2739647262 | |||
| 1149 | 2819546542 | |||
| 1150 | 2819587809 | |||
| 1151 | 2840679315 | |||
| 1152 | 2842725234 | |||
| 1153 | 2842912509 | |||
| 1154 | 2849286813 | |||
| 1155 | 2857629697 | |||
| 1156 | 2884795641 | |||
| 1157 | 2884937854 | |||
| 1158 | 2896087126 | |||
| 1159 | 2902052866 | |||
| 1160 | 2910247794 | |||
| 1161 | 2919692726 | |||
| 1162 | 2929158155 | |||
| 1163 | 2929926021 | |||
| 1164 | 2946002156 | |||
| 1165 | 2954019054 | |||
| 1166 | 8003153024 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ifr-assembly3.cif.gz_A | the crystal structure of xylulose kinase from rhodospirillum rubrum | 0.82 | 10 | 454 |
| 3h6e-assembly2.cif.gz_B | the crystal structure of a carbohydrate kinase from novosphingobium aromaticivorans | 0.8182 | 7 | 450 |
| 3ll3-assembly1.cif.gz_B | the crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus | 0.8031 | 8 | 454 |
| 3ifr-assembly3.cif.gz_A | the crystal structure of xylulose kinase from rhodospirillum rubrum | 0.7969 | 10 | 454 |
| 3h6e-assembly1.cif.gz_A | the crystal structure of a carbohydrate kinase from novosphingobium aromaticivorans | 0.7945 | 12 | 450 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hz6A01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8594 | 8 | 241 | 3.30.420.40 |
| af_Q9C0U6_3_276_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8551 | 14 | 238 | 3.30.420.40 |
| 3h6eA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8486 | 12 | 83 | 3.30.420.40 |
| af_P11553_2_245_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8433 | 7 | 235 | 3.30.420.40 |
| 4c23A01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8415 | 2 | 232 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520EAW4-F1-model_v4 | Carbohydrate kinase | 0.9822 | 7 | 102 |
GO:0005975
GO:0016301 |
| AF-A0A520HL05-F1-model_v4 | Carbohydrate kinase | 0.9796 | 7 | 140 |
GO:0016301
|
| AF-A0A7Y2DGK2-F1-model_v4 | Carbohydrate kinase | 0.9785 | 7 | 170 |
GO:0005975
GO:0016301 |
| AF-A0A3B9AK58-F1-model_v4 | Carbohydrate kinase | 0.9779 | 9 | 171 |
GO:0005975
GO:0016301 |
| AF-A0A519TF07-F1-model_v4 | Carbohydrate kinase | 0.9765 | 52 | 411 |
GO:0005975
GO:0016301 |