F466279

General Info

Members Datasets Scaffolds Average Seq Length
583 397 480 68

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10182464|Ga0207706_101824642
Length 77
Sequence MQNLEDMAMRSERKTKLGRRDFLRKVGIGTVGAGATLATPLITPAQADSETDDEKRKARYKETDHVKAYYRVNRYPG

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
11 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
12 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
13 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
14 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
15 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
16 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
17 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
21 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
22 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
23 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
24 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
25 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
26 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
27 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
28 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
29 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
30 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
31 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
32 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
33 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
34 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
35 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
36 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
37 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
38 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
39 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
40 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
41 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
42 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
43 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
44 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
45 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
46 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
47 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
48 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
49 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
50 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
51 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
52 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
53 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
54 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
55 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
56 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
57 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
58 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
59 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
60 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
61 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
62 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
63 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
64 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
65 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
66 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
67 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
68 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
69 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
70 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
71 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
72 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
73 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
74 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
75 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
76 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
77 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
78 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
79 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
80 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
81 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
82 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
83 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
84 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
85 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
87 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
95 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
96 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
97 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
98 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
99 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
100 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
101 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
102 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
108 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
109 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
110 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
113 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
114 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
115 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
125 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
130 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
133 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
134 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
138 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
139 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
140 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
145 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
146 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
147 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
154 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
155 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
156 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
157 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
158 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
159 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
160 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
161 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
162 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
164 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
165 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
187 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
357 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
360 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
361 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
362 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
365 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
369 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
370 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
371 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
374 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
375 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
376 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
380 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
381 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
382 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
383 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
384 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
385 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
386 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
387 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
388 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
389 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
390 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
391 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
392 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
393 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
394 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
395 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
396 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
397 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.69
Metatranscriptomes 2.75
Isolates 17.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.12
Nodule 13.38
Rhizoplane 8.75
Rhizosphere 60.21
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10124885 3300001991 Bacteria 566
2 JGI25406J46586_10001448 3300003203 Bacteria 11187
3 JGI25406J46586_10002592 3300003203 Bacteria 8533
4 JGI25153J46596_10000150 3300003215 Bacteria 70192
5 rootH2_10140195 3300003320 Bacteria 5706
6 rootH2_10252760 3300003320 Bacteria 1568
7 rootH1_10047327 3300003316 Bacteria 7043
8 rootH1_10047327 3300003323 Bacteria 9811
9 rootH1_10171602 3300003323 Bacteria 4552
10 JGI25160J50197_1000263 3300003354 Bacteria 39637
11 JGI25404J52841_10063211 3300003659 Bacteria 775
12 JGI25405J52794_10097643 3300003911 Bacteria 654
13 Ga0065165_1065383 3300005262 Bacteria 982
14 Ga0070683_100228368 3300005329 Bacteria 1769
15 Ga0070690_101718218 3300005330 Bacteria 510
16 Ga0070670_101111158 3300005331 Bacteria 721
17 Ga0070670_101854210 3300005331 Bacteria 555
18 Ga0068869_100348986 3300005334 Bacteria 1206
19 Ga0070666_10955083 3300005335 Bacteria 635
20 Ga0070680_100120184 3300005336 Bacteria 2193
21 Ga0070680_100410588 3300005336 Bacteria 1155
22 Ga0070682_100585439 3300005337 Bacteria 879
23 Ga0068868_100691556 3300005338 Bacteria 912
24 Ga0070660_100046703 3300005339 Bacteria 3320
25 Ga0070691_10286465 3300005341 Bacteria 895
26 Ga0070661_100455196 3300005344 Bacteria 1019
27 Ga0070668_100002573 3300005347 Bacteria 13344
28 Ga0070669_100889198 3300005353 Bacteria 760
29 Ga0070671_100641721 3300005355 Bacteria 919
30 Ga0070673_101147970 3300005364 Bacteria 727
31 Ga0070659_100539428 3300005366 Bacteria 998
32 Ga0070667_101962776 3300005367 Bacteria 551
33 Ga0070709_10004768 3300005434 Bacteria 7327
34 Ga0070714_100002758 3300005435 Bacteria 12944
35 Ga0070714_101149522 3300005435 Bacteria 757
36 Ga0070714_101646110 3300005435 Bacteria 627
37 Ga0070714_101811643 3300005435 Bacteria 596
38 Ga0070713_100020112 3300005436 Bacteria 5111
39 Ga0070713_100973780 3300005436 Bacteria 818
40 Ga0070710_10005026 3300005437 Bacteria 6258
41 Ga0070710_10888046 3300005437 Bacteria 643
42 Ga0070711_100001108 3300005439 Bacteria 14390
43 Ga0070708_100004944 3300005445 Bacteria 10543
44 Ga0070663_100001426 3300005455 Bacteria 13081
45 Ga0070678_100595095 3300005456 Bacteria 987
46 Ga0070662_100162812 3300005457 Bacteria 1746
47 Ga0070681_10007849 3300005458 Bacteria 10436
48 Ga0068867_100338934 3300005459 Bacteria 1251
49 Ga0070685_10958923 3300005466 Bacteria 640
50 Ga0070706_100193718 3300005467 Bacteria 1899
51 Ga0070706_100684167 3300005467 Bacteria 952
52 Ga0070707_100234541 3300005468 Bacteria 1786
53 Ga0070679_100006857 3300005530 Bacteria 10619
54 Ga0070679_100130053 3300005530 Bacteria 2499
55 Ga0070679_100751666 3300005530 Bacteria 918
56 Ga0070697_100488533 3300005536 Bacteria 1076
57 Ga0068853_101600624 3300005539 Bacteria 631
58 Ga0070686_101650096 3300005544 Bacteria 543
59 Ga0070665_100062323 3300005548 Bacteria 3739
60 Ga0070665_101737716 3300005548 Bacteria 631
61 Ga0068855_100017923 3300005563 Bacteria 8507
62 Ga0068855_100181294 3300005563 Bacteria 2381
63 Ga0068855_100879491 3300005563 Bacteria 948
64 Ga0068855_101744043 3300005563 Bacteria 634
65 Ga0070664_100384936 3300005564 Bacteria 1281
66 Ga0068857_100078487 3300005577 Bacteria 2947
67 Ga0068857_100212474 3300005577 Bacteria 1766
68 Ga0068854_100111487 3300005578 Bacteria 2064
69 Ga0068856_100295315 3300005614 Bacteria 1637
70 Ga0068856_101940140 3300005614 Bacteria 600
71 Ga0068856_102083544 3300005614 Bacteria 577
72 Ga0070702_100553845 3300005615 Bacteria 854
73 Ga0068852_100029734 3300005616 Bacteria 4490
74 Ga0068852_100223132 3300005616 Bacteria 1793
75 Ga0068852_100382998 3300005616 Bacteria 1380
76 Ga0068859_100874700 3300005617 Bacteria 984
77 Ga0068864_100149875 3300005618 Bacteria 2112
78 Ga0068864_101479982 3300005618 Bacteria 682
79 Ga0068866_10160847 3300005718 Bacteria 1309
80 Ga0068861_102188441 3300005719 Bacteria 554
81 Ga0068851_10446412 3300005834 Bacteria 768
82 Ga0068851_10900062 3300005834 Bacteria 554
83 Ga0068863_100445697 3300005841 Bacteria 1270
84 Ga0068858_100033991 3300005842 Bacteria 4730
85 Ga0068860_101574587 3300005843 Bacteria 679
86 Ga0068862_100052949 3300005844 Bacteria 3474
87 Ga0081455_10026211 3300005937 Bacteria 5368
88 Ga0081540_1299850 3300005983 Bacteria 552
89 Ga0081539_10000152 3300005985 Bacteria 160005
90 Ga0081539_10176064 3300005985 Bacteria 1007
91 Ga0070717_10016263 3300006028 Bacteria 5765
92 Ga0070717_10362602 3300006028 Bacteria 1297
93 Ga0070717_10673073 3300006028 Bacteria 940
94 Ga0070717_10895771 3300006028 Bacteria 808
95 Ga0070717_11180009 3300006028 Bacteria 697
96 Ga0070717_11380940 3300006028 Bacteria 640
97 Ga0075365_10042359 3300006038 Bacteria 2976
98 Ga0075365_10863101 3300006038 Bacteria 638
99 Ga0075368_10209608 3300006042 Bacteria 826
100 Ga0075368_10373760 3300006042 Bacteria 623
101 Ga0075363_100167314 3300006048 Bacteria 1247
102 Ga0075364_10166860 3300006051 Bacteria 1488
103 Ga0070715_10003339 3300006163 Bacteria 5085
104 Ga0070716_100005187 3300006173 Bacteria 6299
105 Ga0070716_100326945 3300006173 Bacteria 1076
106 Ga0070712_100022031 3300006175 Bacteria 4192
107 Ga0070712_100519561 3300006175 Bacteria 1000
108 Ga0070712_101089239 3300006175 Bacteria 693
109 Ga0075362_10372515 3300006177 Bacteria 717
110 Ga0075367_10266434 3300006178 Bacteria 1076
111 Ga0075367_10547323 3300006178 Bacteria 735
112 Ga0075367_10794230 3300006178 Bacteria 603
113 Ga0075369_10018923 3300006186 Bacteria 2808
114 Ga0075366_10204628 3300006195 Bacteria 1201
115 Ga0075366_10250057 3300006195 Bacteria 1081
116 Ga0075370_10158303 3300006353 Bacteria 1328
117 Ga0068865_100762691 3300006881 Bacteria 832
118 Ga0097620_100874782 3300006931 Bacteria 984
119 Ga0099795_10066505 3300007788 Bacteria 1350
120 Ga0105251_10346225 3300009011 Bacteria 678
121 Ga0105240_10137257 3300009093 Bacteria 2928
122 Ga0105240_10780411 3300009093 Bacteria 1036
123 Ga0105240_11971844 3300009093 Bacteria 607
124 Ga0105247_10014736 3300009101 Bacteria 4685
125 Ga0105243_10217175 3300009148 Bacteria 1688
126 Ga0105248_10011911 3300009177 Bacteria 9592
127 Ga0105237_10207278 3300009545 Bacteria 1961
128 Ga0105237_10549275 3300009545 Bacteria 1162
129 Ga0105237_12554569 3300009545 Bacteria 521
130 Ga0105238_10030817 3300009551 Bacteria 5458
131 Ga0105238_10045500 3300009551 Bacteria 4433
132 Ga0105238_10114560 3300009551 Bacteria 2675
133 Ga0105238_11339466 3300009551 Bacteria 742
134 Ga0105238_11640681 3300009551 Bacteria 673
135 Ga0105249_10570341 3300009553 Bacteria 1184
136 Ga0105249_12497191 3300009553 Bacteria 589
137 Ga0105239_10021516 3300010375 Bacteria 7110
138 Ga0105239_10061173 3300010375 Bacteria 4132
139 Ga0105239_10129087 3300010375 Bacteria 2810
140 Ga0105246_10686128 3300011119 Bacteria 896
141 Ga0157370_10055762 3300013104 Bacteria 3763
142 Ga0157370_11368820 3300013104 Bacteria 637
143 Ga0157369_10004181 3300013105 Bacteria 17104
144 Ga0157369_10018445 3300013105 Bacteria 7824
145 Ga0157369_11044759 3300013105 Bacteria 836
146 Ga0157374_10657187 3300013296 Bacteria 1060
147 Ga0163162_10106039 3300013306 Bacteria 2905
148 Ga0163162_12543836 3300013306 Bacteria 589
149 Ga0157372_10021185 3300013307 Bacteria 7023
150 Ga0157372_10479428 3300013307 Bacteria 1450
151 Ga0157372_11083868 3300013307 Bacteria 927
152 Ga0157372_11547546 3300013307 Bacteria 764
153 Ga0157375_10017407 3300013308 Bacteria 6485
154 Ga0157375_12004604 3300013308 Bacteria 688
155 Ga0163163_10043019 3300014325 Bacteria 4427
156 Ga0163163_11141993 3300014325 Bacteria 842
157 Ga0163163_11567454 3300014325 Bacteria 720
158 Ga0157376_10795677 3300014969 Bacteria 958
159 Ga0157376_12163952 3300014969 Bacteria 595
160 Ga0163161_10780540 3300017792 Bacteria 801
161 Ga0163161_12020324 3300017792 Bacteria 513
162 Ga0197907_10163776 3300020069 Bacteria 1890
163 Ga0197907_10472093 3300020069 Bacteria 1331
164 Ga0206356_10780751 3300020070 Bacteria 1059
165 Ga0206356_10800525 3300020070 Bacteria 2176
166 Ga0206356_11700925 3300020070 Bacteria 1265
167 Ga0206349_1319226 3300020075 Bacteria 3012
168 Ga0206349_1978123 3300020075 Bacteria 813
169 Ga0206355_1376153 3300020076 Bacteria 656
170 Ga0206352_10458138 3300020078 Bacteria 1239
171 Ga0206352_10698535 3300020078 Bacteria 1551
172 Ga0206350_10017517 3300020080 Bacteria 2509
173 Ga0206350_11177457 3300020080 Bacteria 5837
174 Ga0206354_11212721 3300020081 Bacteria 900
175 Ga0206353_10636173 3300020082 Bacteria 2499
176 Ga0224712_10000894 3300022467 Bacteria 6401
177 Ga0224712_10256454 3300022467 Bacteria 809
178 Ga0209673_1075328 3300025273 Bacteria 789
179 Ga0209758_1000068 3300025297 Bacteria 286488
180 Ga0209758_1040581 3300025297 Bacteria 1753
181 Ga0207426_1000225 3300025302 Bacteria 129646
182 Ga0207426_1006770 3300025302 Bacteria 4909
183 Ga0207692_10004384 3300025898 Bacteria 5588
184 Ga0207710_10007151 3300025900 Bacteria 4734
185 Ga0207680_11100461 3300025903 Bacteria 568
186 Ga0207647_10068610 3300025904 Bacteria 2146
187 Ga0207685_10013466 3300025905 Bacteria 2531
188 Ga0207685_10770592 3300025905 Bacteria 528
189 Ga0207699_10001530 3300025906 Bacteria 10975
190 Ga0207699_10581145 3300025906 Bacteria 815
191 Ga0207684_10207310 3300025910 Bacteria 1691
192 Ga0207684_10239614 3300025910 Bacteria 1565
193 Ga0207684_11273478 3300025910 Bacteria 606
194 Ga0207707_10000134 3300025912 Bacteria 77031
195 Ga0207671_10191725 3300025914 Bacteria 1594
196 Ga0207671_10347202 3300025914 Bacteria 1176
197 Ga0207693_10000530 3300025915 Bacteria 34447
198 Ga0207693_10013599 3300025915 Bacteria 6559
199 Ga0207693_10071494 3300025915 Bacteria 2716
200 Ga0207693_10652410 3300025915 Bacteria 817
201 Ga0207693_11013965 3300025915 Bacteria 633
202 Ga0207663_10003538 3300025916 Bacteria 7662
203 Ga0207660_10166460 3300025917 Bacteria 1704
204 Ga0207660_11557892 3300025917 Bacteria 533
205 Ga0207657_10105699 3300025919 Bacteria 2330
206 Ga0207657_10309769 3300025919 Bacteria 1250
207 Ga0207649_10414366 3300025920 Bacteria 1011
208 Ga0207652_10022055 3300025921 Bacteria 5263
209 Ga0207652_11129822 3300025921 Bacteria 684
210 Ga0207646_10580805 3300025922 Bacteria 1006
211 Ga0207681_10804257 3300025923 Bacteria 785
212 Ga0207694_10031190 3300025924 Bacteria 4070
213 Ga0207694_10067266 3300025924 Bacteria 2797
214 Ga0207694_10648471 3300025924 Bacteria 889
215 Ga0207694_11221237 3300025924 Bacteria 636
216 Ga0207650_11589894 3300025925 Bacteria 555
217 Ga0207700_10048624 3300025928 Bacteria 3151
218 Ga0207700_10103692 3300025928 Bacteria 2274
219 Ga0207700_11156914 3300025928 Bacteria 691
220 Ga0207664_10095797 3300025929 Bacteria 2442
221 Ga0207664_10852454 3300025929 Bacteria 819
222 Ga0207644_10444586 3300025931 Bacteria 1064
223 Ga0207644_10508964 3300025931 Bacteria 994
224 Ga0207690_10182546 3300025932 Bacteria 1581
225 Ga0207690_10669450 3300025932 Bacteria 852
226 Ga0207706_10182464 3300025933 Bacteria 1843
227 Ga0207709_10032165 3300025935 Bacteria 3070
228 Ga0207709_10326953 3300025935 Bacteria 1150
229 Ga0207665_10000303 3300025939 Bacteria 34072
230 Ga0207665_10121850 3300025939 Bacteria 1843
231 Ga0207665_10712310 3300025939 Bacteria 789
232 Ga0207711_10075068 3300025941 Bacteria 2942
233 Ga0207711_10350808 3300025941 Bacteria 1366
234 Ga0207679_10888331 3300025945 Bacteria 815
235 Ga0207667_10033358 3300025949 Bacteria 5536
236 Ga0207667_10141176 3300025949 Bacteria 2480
237 Ga0207667_10283726 3300025949 Bacteria 1692
238 Ga0207667_10437219 3300025949 Bacteria 1330
239 Ga0207668_10085255 3300025972 Bacteria 2304
240 Ga0207640_10260203 3300025981 Bacteria 1352
241 Ga0207677_10017946 3300026023 Bacteria 4236
242 Ga0207703_10082195 3300026035 Bacteria 2687
243 Ga0207639_11750764 3300026041 Bacteria 582
244 Ga0207678_10002844 3300026067 Bacteria 15692
245 Ga0207678_10271544 3300026067 Bacteria 1454
246 Ga0207678_10595743 3300026067 Bacteria 969
247 Ga0207702_10079278 3300026078 Bacteria 2846
248 Ga0207702_10459032 3300026078 Bacteria 1237
249 Ga0207702_11221814 3300026078 Bacteria 746
250 Ga0207641_10053726 3300026088 Bacteria 3416
251 Ga0207648_10070850 3300026089 Bacteria 3039
252 Ga0207676_10087430 3300026095 Bacteria 2549
253 Ga0207676_10526661 3300026095 Bacteria 1126
254 Ga0207674_10227399 3300026116 Bacteria 1814
255 Ga0207674_10633954 3300026116 Bacteria 1032
256 Ga0207674_10813840 3300026116 Bacteria 901
257 Ga0207675_101895644 3300026118 Bacteria 615
258 Ga0207683_10620132 3300026121 Bacteria 1002
259 Ga0207683_10623826 3300026121 Bacteria 998
260 Ga0207698_10052519 3300026142 Bacteria 3123
261 Ga0207698_10195571 3300026142 Bacteria 1806
262 Ga0207698_10285834 3300026142 Bacteria 1528
263 Ga0209179_1013033 3300027512 Bacteria 1503
264 Ga0209813_10050884 3300027866 Bacteria 1294
265 Ga0268266_10223372 3300028379 Bacteria 1732
266 Ga0268265_10078479 3300028380 Bacteria 2597
267 Ga0268264_10806750 3300028381 Bacteria 938
268 Ga0307517_10149689 3300028786 Bacteria 1606
269 Ga0307509_10017608 3300031507 Bacteria 8217
270 Ga0307516_10003424 3300031730 Bacteria 20395
271 Ga0307516_10016618 3300031730 Bacteria 7690
272 Ga0307406_10613612 3300031901 Bacteria 898
273 Ga0307412_11766687 3300031911 Bacteria 568
274 Ga0373932_0453784 3300035112 Bacteria 504
275 Ga0373954_0086410 3300035118 Bacteria 1503
276 Ga0373943_0060355 3300035170 Bacteria 1893
277 Ga0373946_0055274 3300035171 Bacteria 1673
278 Ga0373955_0273129 3300035172 Bacteria 1016
279 Ga0373931_0710470 3300035691 Bacteria 664
280 Ga0373927_0021587 3300035695 Bacteria 4220
281 Ga0373927_0127956 3300035695 Bacteria 1659
282 Ga0373927_0144220 3300035695 Bacteria 1558
283 Ga0373933_0034068 3300035724 Bacteria 2966
284 Ga0373947_0048103 3300035725 Bacteria 2558
285 Ga0395899_0252448 3300037312 Bacteria 1210
286 Ga0395900_0321615 3300037418 Bacteria 1527
287 Ga0395900_0815938 3300037418 Bacteria 860
288 Ga0395900_1248050 3300037418 Bacteria 658
289 Ga0395900_1483805 3300037418 Bacteria 590
290 Ga0395898_1116905 3300037466 Bacteria 721
291 Ga0395898_1301696 3300037466 Bacteria 656
292 Ga0395905_0002655 3300037471 Bacteria 19624
293 Ga0395905_0050668 3300037471 Bacteria 3889
294 Ga0395905_0780402 3300037471 Bacteria 858
295 Ga0395901_0010810 3300038443 Bacteria 9251
296 Ga0395901_0092561 3300038443 Bacteria 3165
297 Ga0395901_0127726 3300038443 Bacteria 2672
298 Ga0395901_0254431 3300038443 Bacteria 1829
299 Ga0436363_0946225 3300039450 Bacteria 15148
300 Ga0439455_0154048 3300042012 Bacteria 655
301 Ga0466972_0000284 3300044658 Bacteria 31556
302 Ga0466965_0006730 3300044683 Bacteria 5244
303 Ga0466965_0198664 3300044683 Bacteria 1063
304 Ga0466966_0441832 3300044684 Bacteria 782
305 Ga0466961_0571994 3300044693 Bacteria 680
306 Ga0466963_0037578 3300044694 Bacteria 3163
307 Ga0466964_0404675 3300044706 Bacteria 714
308 Ga0466970_0025353 3300044765 Bacteria 3105
309 Ga0466970_0336669 3300044765 Bacteria 855
310 Ga0466960_0126982 3300044901 Bacteria 1342
311 Ga0466960_0239766 3300044901 Bacteria 1004
312 Ga0466960_0655024 3300044901 Bacteria 627
313 Ga0466967_0262810 3300045976 Bacteria 1652
314 Ga0495603_0040775 3300046455 Bacteria 2778
315 Ga0495603_0046034 3300046455 Bacteria 2600
316 Ga0495603_0051083 3300046455 Bacteria 2457
317 Ga0495590_0028100 3300046457 Bacteria 1973
318 Ga0495590_0135195 3300046457 Bacteria 888
319 Ga0495641_0333147 3300046461 Bacteria 685
320 Ga0495582_0136293 3300046473 Bacteria 1389
321 Ga0495605_0003890 3300046474 Bacteria 8848
322 Ga0495639_0315894 3300046475 Bacteria 781
323 Ga0495639_0380682 3300046475 Bacteria 711
324 Ga0495584_0165974 3300046491 Bacteria 1122
325 Ga0495585_0111386 3300046492 Bacteria 1455
326 Ga0495594_0100741 3300046499 Bacteria 1625
327 Ga0495583_0150969 3300046506 Bacteria 963
328 Ga0495606_0394503 3300046507 Bacteria 722
329 Ga0495606_0498586 3300046507 Bacteria 615
330 Ga0495606_0611914 3300046507 Bacteria 533
331 Ga0495620_0064204 3300046515 Bacteria 1519
332 Ga0495643_0111418 3300046522 Bacteria 1391
333 Ga0495648_0031288 3300046524 Bacteria 3506
334 Ga0495648_0260543 3300046524 Bacteria 832
335 Ga0495665_0135727 3300046531 Bacteria 1287
336 Ga0495609_0021812 3300046538 Bacteria 2955
337 Ga0495622_0006990 3300046557 Bacteria 5239
338 Ga0495622_0335033 3300046557 Bacteria 656
339 Ga0495668_0035902 3300046616 Bacteria 2779
340 Ga0495668_0107581 3300046616 Bacteria 1525
341 Ga0495611_0026689 3300046648 Bacteria 2521
342 Ga0495625_0014732 3300046660 Bacteria 6225
343 Ga0495661_0012845 3300046665 Bacteria 5647
344 Ga0495661_0022442 3300046665 Bacteria 4106
345 Ga0495588_0000946 3300046674 Bacteria 12663
346 Ga0495588_0163778 3300046674 Bacteria 1176
347 Ga0495588_0274617 3300046674 Bacteria 888
348 Ga0495658_0097286 3300046683 Bacteria 1752
349 Ga0495669_0099801 3300046684 Bacteria 1348
350 Ga0495624_0070519 3300046690 Bacteria 2176
351 Ga0495624_0073905 3300046690 Bacteria 2119
352 Ga0495671_0028293 3300046692 Bacteria 2890
353 Ga0495649_0067463 3300046694 Bacteria 1919
354 Ga0495649_0490983 3300046694 Bacteria 611
355 Ga0495589_0026240 3300046794 Bacteria 2953
356 Ga0495581_0278652 3300047315 Bacteria 978
357 Ga0495672_0057823 3300047320 Bacteria 2251
358 Ga0495676_0083376 3300047321 Bacteria 2416
359 Ga0495676_0666296 3300047321 Bacteria 675
360 Ga0495676_0860059 3300047321 Bacteria 582
361 Ga0495687_056250 3300047443 Bacteria 1642
362 Ga0495673_0097410 3300047469 Bacteria 1194
363 Ga0495673_0117455 3300047469 Bacteria 1056
364 Ga0496100_0010861 3300048903 Bacteria 5168
365 Ga0496100_0106710 3300048903 Bacteria 1939
366 Ga0496100_0256656 3300048903 Bacteria 1295
367 Ga0496101_0045045 3300048904 Bacteria 3158
368 Ga0496101_0965365 3300048904 Bacteria 670
369 Ga0496102_0012305 3300048905 Bacteria 7400
370 Ga0496102_0226680 3300048905 Bacteria 1762
371 Ga0496102_1872494 3300048905 Bacteria 517
372 Ga0496103_0468481 3300048906 Bacteria 807
373 Ga0496103_0646459 3300048906 Bacteria 672
374 Ga0496103_0895351 3300048906 Bacteria 556
375 Ga0496104_0063170 3300048907 Bacteria 3512
376 Ga0496104_0091388 3300048907 Bacteria 2909
377 Ga0496104_0231971 3300048907 Bacteria 1758
378 Ga0496104_0249393 3300048907 Bacteria 1688
379 Ga0496105_0001482 3300048908 Bacteria 16572
380 Ga0496106_0017502 3300048909 Bacteria 5302
381 Ga0496106_0018930 3300048909 Bacteria 5101
382 Ga0496106_0444368 3300048909 Bacteria 1042
383 Ga0496106_0754828 3300048909 Bacteria 773
384 Ga0496107_0004674 3300048910 Bacteria 9292
385 Ga0496107_0012614 3300048910 Bacteria 5901
386 Ga0496107_0332245 3300048910 Bacteria 1131
387 Ga0496108_0003728 3300048911 Bacteria 12217
388 Ga0496108_0287964 3300048911 Bacteria 1430
389 Ga0496109_0002393 3300048912 Bacteria 15686
390 Ga0496109_0219983 3300048912 Bacteria 1786
391 Ga0496109_0610766 3300048912 Bacteria 1027
392 Ga0496109_0874594 3300048912 Bacteria 836
393 Ga0496109_1131070 3300048912 Bacteria 720
394 Ga0496110_0015225 3300048913 Bacteria 6398
395 Ga0496110_0396961 3300048913 Bacteria 1257
396 Ga0496110_0435919 3300048913 Bacteria 1194
397 Ga0496110_0610078 3300048913 Bacteria 989
398 Ga0496110_0639741 3300048913 Bacteria 963
399 Ga0496110_1025010 3300048913 Bacteria 733
400 Ga0496111_0070727 3300048914 Bacteria 2539
401 Ga0496111_0287431 3300048914 Bacteria 1219
402 Ga0496111_0956974 3300048914 Bacteria 615
403 Ga0496112_0019781 3300048915 Bacteria 6366
404 Ga0496112_0126588 3300048915 Bacteria 2525
405 Ga0496112_0460945 3300048915 Bacteria 1208
406 Ga0496112_0747059 3300048915 Bacteria 905
407 Ga0496112_0831677 3300048915 Bacteria 847
408 Ga0496113_0042305 3300048916 Bacteria 3366
409 Ga0496113_0058544 3300048916 Bacteria 2899
410 Ga0496114_0002836 3300048917 Bacteria 13279
411 Ga0496115_0035664 3300048918 Bacteria 3936
412 Ga0496115_0044775 3300048918 Bacteria 3532
413 Ga0496115_0737846 3300048918 Bacteria 771
414 Ga0496116_0022742 3300048919 Bacteria 4689
415 Ga0496117_0395645 3300048920 Bacteria 699
416 Ga0496118_0014217 3300048921 Bacteria 7463
417 Ga0496119_0016691 3300048922 Bacteria 5571
418 Ga0496120_0137579 3300048923 Bacteria 1243
419 Ga0496121_0004922 3300048924 Bacteria 17527
420 Ga0496121_0019396 3300048924 Bacteria 6800
421 Ga0496124_0346342 3300048927 Bacteria 1053
422 Ga0496125_0006229 3300048928 Bacteria 12976
423 Ga0496126_0024788 3300048929 Bacteria 5785
424 Ga0495682_0132003 3300049460 Bacteria 893
425 Ga0501031_0340827 3300049568 Bacteria 970
426 Ga0501032_0072102 3300049569 Bacteria 2302
427 Ga0501034_0033799 3300049571 Bacteria 5184
428 Ga0501037_0206876 3300049573 Bacteria 1385
429 Ga0501038_0205582 3300049574 Bacteria 1578
430 Ga0501039_0329963 3300049575 Unclassified 1199
431 Ga0501042_0572714 3300049578 Bacteria 821
432 Ga0501046_0494141 3300049580 Bacteria 877
433 Ga0501047_0120570 3300049581 Bacteria 2505
434 Ga0501067_0092243 3300049583 Bacteria 1681
435 Ga0501072_0179865 3300049588 Bacteria 1687
436 Ga0501073_0887010 3300049589 Unclassified 614
437 Ga0501074_0622171 3300049590 Bacteria 763
438 Ga0501079_0417966 3300049741 Bacteria 1052
439 Ga0501080_1745447 3300049742 Unclassified 524
440 Ga0501083_0029785 3300049744 Bacteria 3751
441 Ga0501035_0757070 3300049822 Bacteria 779
442 Ga0501044_0329151 3300049823 Bacteria 1451
443 nmdc:mga03683_544730_c1 3300050489 Bacteria 564
444 nmdc:mga03n38_37300_c1 3300050490 Bacteria 2095
445 nmdc:mga03n38_411173_c1 3300050490 Bacteria 746
446 nmdc:mga00v17_74820_c1 3300050491 Bacteria 2105
447 nmdc:mga0yw44_17344_c1 3300050492 Bacteria 3916
448 nmdc:mga0k408_93730_c1 3300050493 Bacteria 1765
449 nmdc:mga06z11_364901_c1 3300050494 Bacteria 866
450 nmdc:mga06z11_540163_c1 3300050494 Bacteria 707
451 nmdc:mga04h51_194524_c1 3300050495 Bacteria 794
452 nmdc:mga04h51_50730_c1 3300050495 Bacteria 1391
453 nmdc:mga07m45_73760_c1 3300050496 Bacteria 1943
454 nmdc:mga07m45_808641_c1 3300050496 Bacteria 537
455 nmdc:mga08y16_2019711_c1 3300050511 Bacteria 525
456 nmdc:mga0sz30_22563_c1 3300050516 Bacteria 2556
457 nmdc:mga0sz30_485543_c1 3300050516 Bacteria 555
458 Ga0500610_0021997 3300053079 Bacteria 3138
459 Ga0495655_0025657 3300053083 Bacteria 1381
460 Ga0500578_0099457 3300053086 Bacteria 1842
461 Ga0500643_000007 3300053087 Bacteria 462836
462 Ga0500643_128325 3300053087 Bacteria 682
463 Ga0500583_0037379 3300053092 Bacteria 2181
464 Ga0500583_0135540 3300053092 Bacteria 1222
465 Ga0500651_0005130 3300053093 Bacteria 7450
466 Ga0500641_0306351 3300053096 Bacteria 651
467 Ga0500555_029069 3300053103 Bacteria 1572
468 Ga0500569_000535 3300053109 Bacteria 6346
469 Ga0500628_113493 3300053129 Bacteria 729
470 Ga0500642_0000547 3300053130 Bacteria 11388
471 Ga0500655_006251 3300053133 Bacteria 2146
472 Ga0500568_0017118 3300053139 Bacteria 3206
473 Ga0500573_0249290 3300053140 Bacteria 916
474 Ga0500577_0159355 3300053142 Bacteria 960
475 Ga0500577_0318578 3300053142 Bacteria 679
476 Ga0500588_0009573 3300053146 Bacteria 2308
477 Ga0500589_114597 3300053147 Bacteria 1151
478 Ga0500627_0062807 3300053158 Bacteria 1636
479 Ga0500636_0163906 3300053177 Bacteria 1209
480 Ga0500609_002160 3300053731 Bacteria 2810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10595743 Ga0207678_105957431 59
2 3300017792 Ga0163161_10780540 Ga0163161_107805401 60
3 3300046616 Ga0495668_0035902 Ga0495668_0035902_1385_1591 60
4 3300005434 Ga0070709_10004768 Ga0070709_100047682 63
5 3300005435 Ga0070714_100002758 Ga0070714_10000275810 63
6 3300005436 Ga0070713_100020112 Ga0070713_1000201122 63
7 3300005437 Ga0070710_10005026 Ga0070710_100050267 63
8 3300005439 Ga0070711_100001108 Ga0070711_1000011081 63
9 3300006028 Ga0070717_10016263 Ga0070717_100162637 63
10 3300006163 Ga0070715_10003339 Ga0070715_100033392 63
11 3300006173 Ga0070716_100005187 Ga0070716_1000051872 63
12 3300006175 Ga0070712_100022031 Ga0070712_1000220312 63
13 3300025898 Ga0207692_10004384 Ga0207692_100043842 63
14 3300025905 Ga0207685_10013466 Ga0207685_100134662 63
15 3300025906 Ga0207699_10001530 Ga0207699_100015305 63
16 3300025915 Ga0207693_10000530 Ga0207693_100005309 63
17 3300025916 Ga0207663_10003538 Ga0207663_100035388 63
18 3300025928 Ga0207700_10103692 Ga0207700_101036922 63
19 3300025929 Ga0207664_10095797 Ga0207664_100957972 63
20 3300025939 Ga0207665_10000303 Ga0207665_1000030340 63
21 iso_pu_bacteria 2824661429 2824665927 64
22 iso_pu_bacteria 2508501042 2508692124 65
23 iso_pu_bacteria 2508501128 2509149209 65
24 iso_pu_bacteria 2513237094 2513644222 65
25 iso_pu_bacteria 2513237139 2513878941 65
26 iso_pu_bacteria 2513237161 2514009903 65
27 iso_pu_bacteria 2524023228 2524534018 65
28 iso_pu_bacteria 2617270735 2617346262 65
29 iso_pu_bacteria 2667528175 2671123071 65
30 iso_pu_bacteria 2728368998 2728753100 65
31 iso_pu_bacteria 2802429603 2805918201 65
32 iso_pu_bacteria 2824600985 2824601813 65
33 iso_pu_bacteria 2824609381 2824612873 65
34 iso_pu_bacteria 2824653114 2824653295 65
35 iso_pu_bacteria 2824671348 2824672139 65
36 iso_pu_bacteria 2824687955 2824688738 65
37 iso_pu_bacteria 2824696289 2824697536 65
38 iso_pu_bacteria 2824753945 2824756501 65
39 iso_pu_bacteria 2824763712 2824765995 65
40 iso_pu_bacteria 2824773399 2824774346 65
41 iso_pu_bacteria 2838122688 2838123137 65
42 iso_pu_bacteria 2841941048 2841948219 65
43 iso_pu_bacteria 2841949485 2841954346 65
44 iso_pu_bacteria 2841966195 2841969717 65
45 iso_pu_bacteria 2841974524 2841978846 65
46 iso_pu_bacteria 2841983080 2841984038 65
47 iso_pu_bacteria 2847939898 2847947234 65
48 iso_pu_bacteria 2857509624 2857516281 65
49 iso_pu_bacteria 2874620515 2874626546 65
50 iso_pu_bacteria 2876761206 2876762180 65
51 iso_pu_bacteria 2879099564 2879106306 65
52 iso_pu_bacteria 2885366525 2885369532 65
53 iso_pu_bacteria 2885374607 2885382720 65
54 iso_pu_bacteria 2885409591 2885417231 65
55 iso_pu_bacteria 2888419890 2888422414 65
56 iso_pu_bacteria 2904666416 2904671887 65
57 iso_pu_bacteria 2904690495 2904695086 65
58 iso_pu_bacteria 2904699407 2904704105 65
59 iso_pu_bacteria 2904711408 2904715274 65
60 iso_pu_bacteria 2906626472 2906632585 65
61 iso_pu_bacteria 2908756301 2908756900 65
62 iso_pu_bacteria 2922368715 2922376750 65
63 iso_pu_bacteria 2932784394 2932790285 65
64 iso_pu_bacteria 2932809354 2932815812 65
65 iso_pu_bacteria 2932818245 2932824700 65
66 iso_pu_bacteria 2932828146 2932833257 65
67 iso_pu_bacteria 2935616580 2935621468 65
68 iso_pu_bacteria 2935630451 2935636449 65
69 iso_pu_bacteria 2935638405 2935644818 65
70 iso_pu_bacteria 2935648319 2935655342 65
71 iso_pu_bacteria 2935656913 2935664222 65
72 iso_pu_bacteria 2935665750 2935672421 65
73 iso_pu_bacteria 2935675223 2935684557 65
74 iso_pu_bacteria 2935684952 2935693233 65
75 iso_pu_bacteria 2935694250 2935702861 65
76 iso_pu_bacteria 2935703347 2935710961 65
77 iso_pu_bacteria 2935713505 2935720978 65
78 iso_pu_bacteria 2935722832 2935730535 65
79 iso_pu_bacteria 2935732158 2935740700 65
80 iso_pu_bacteria 2935741537 2935749826 65
81 iso_pu_bacteria 2935750917 2935759354 65
82 iso_pu_bacteria 2935760218 2935767197 65
83 iso_pu_bacteria 2935801545 2935808910 65
84 iso_pu_bacteria 2935810662 2935817706 65
85 iso_pu_bacteria 2935827899 2935834068 65
86 iso_pu_bacteria 2935837841 2935845442 65
87 iso_pu_bacteria 2935855204 2935859339 65
88 iso_pu_bacteria 2935864058 2935870019 65
89 iso_pu_bacteria 2935873716 2935880981 65
90 iso_pu_bacteria 2935984226 2935989809 65
91 iso_pu_bacteria 2935992306 2935998245 65
92 iso_pu_bacteria 2936002035 2936009148 65
93 iso_pu_bacteria 2936011229 2936018292 65
94 iso_pu_bacteria 2936019824 2936026794 65
95 iso_pu_bacteria 2936028420 2936035675 65
96 iso_pu_bacteria 2936037263 2936044393 65
97 iso_pu_bacteria 2936046547 2936053753 65
98 iso_pu_bacteria 2936055302 2936062851 65
99 iso_pu_bacteria 2940556831 2940565120 65
100 iso_pu_bacteria 2941507105 2941509841 65
101 iso_pu_bacteria 2941515067 2941520915 65
102 iso_pu_bacteria 2941523033 2941525240 65
103 iso_pu_bacteria 2941538514 2941542954 65
104 iso_pu_bacteria 3005474847 3005480679 65
105 iso_pu_bacteria 3005506211 3005507863 65
106 iso_pu_bacteria 8006926726 8006929189 65
107 iso_pu_bacteria 8006933436 8006940090 65
108 iso_pu_bacteria 8006973647 8006979872 65
109 iso_pu_bacteria 8016511872 8016519849 65
110 iso_pu_bacteria 8016583857 8016589487 65
111 iso_pu_bacteria 8016603502 8016603922 65
112 iso_pu_bacteria 8016603502 8016609885 65
113 iso_pu_bacteria 8016613128 8016615055 65
114 iso_pu_bacteria 8016630954 8016639769 65
115 iso_pu_bacteria 8017057580 8017065692 65
116 iso_pu_bacteria 8019538911 8019545484 65
117 iso_pu_bacteria 8019555841 8019558090 65
118 iso_pu_bacteria 8019565922 8019567200 65
119 iso_pu_bacteria 8019576017 8019585120 65
120 iso_pu_bacteria 8019586578 8019593087 65
121 iso_pu_bacteria 8019597564 8019598372 65
122 iso_pu_bacteria 8019608314 8019610004 65
123 iso_pu_bacteria 8019619141 8019621311 65
124 iso_pu_bacteria 8056689827 8056692443 65
125 3300049568 Ga0501031_0340827 Ga0501031_0340827_631_834 66
126 3300049569 Ga0501032_0072102 Ga0501032_0072102_1201_1404 66
127 3300049571 Ga0501034_0033799 Ga0501034_0033799_3607_3810 66
128 3300049573 Ga0501037_0206876 Ga0501037_0206876_1137_1340 66
129 3300049574 Ga0501038_0205582 Ga0501038_0205582_502_705 66
130 3300049575 Ga0501039_0329963 Ga0501039_0329963_55_258 66
131 3300049578 Ga0501042_0572714 Ga0501042_0572714_46_249 66
132 3300049580 Ga0501046_0494141 Ga0501046_0494141_489_692 66
133 3300049581 Ga0501047_0120570 Ga0501047_0120570_1693_1896 66
134 3300049588 Ga0501072_0179865 Ga0501072_0179865_847_1050 66
135 3300049589 Ga0501073_0887010 Ga0501073_0887010_183_386 66
136 3300049590 Ga0501074_0622171 Ga0501074_0622171_397_600 66
137 3300049741 Ga0501079_0417966 Ga0501079_0417966_543_746 66
138 3300049742 Ga0501080_1745447 Ga0501080_1745447_76_279 66
139 3300049744 Ga0501083_0029785 Ga0501083_0029785_3381_3584 66
140 3300049822 Ga0501035_0757070 Ga0501035_0757070_26_229 66
141 3300049823 Ga0501044_0329151 Ga0501044_0329151_735_938 66
142 3300007788 Ga0099795_10066505 Ga0099795_100665052 67
143 3300009545 Ga0105237_12554569 Ga0105237_125545692 67
144 3300027512 Ga0209179_1013033 Ga0209179_10130332 67
145 3300005329 Ga0070683_100228368 Ga0070683_1002283682 68
146 3300005614 Ga0068856_100295315 Ga0068856_1002953152 68
147 3300006028 Ga0070717_10362602 Ga0070717_103626021 68
148 3300006175 Ga0070712_101089239 Ga0070712_1010892392 68
149 3300006195 Ga0075366_10204628 Ga0075366_102046282 68
150 3300020070 Ga0206356_10780751 Ga0206356_107807512 68
151 3300020075 Ga0206349_1978123 Ga0206349_19781232 68
152 3300020080 Ga0206350_10017517 Ga0206350_100175172 68
153 3300022467 Ga0224712_10256454 Ga0224712_102564542 68
154 3300025915 Ga0207693_11013965 Ga0207693_110139652 68
155 3300025928 Ga0207700_11156914 Ga0207700_111569142 68
156 3300048903 Ga0496100_0106710 Ga0496100_0106710_1312_1518 68
157 3300048907 Ga0496104_0249393 Ga0496104_0249393_678_884 68
158 3300048909 Ga0496106_0018930 Ga0496106_0018930_2096_2302 68
159 3300048910 Ga0496107_0012614 Ga0496107_0012614_4831_5037 68
160 3300048911 Ga0496108_0003728 Ga0496108_0003728_9592_9798 68
161 3300048912 Ga0496109_0002393 Ga0496109_0002393_10319_10525 68
162 3300048913 Ga0496110_0015225 Ga0496110_0015225_1367_1573 68
163 3300048914 Ga0496111_0956974 Ga0496111_0956974_347_553 68
164 3300048915 Ga0496112_0126588 Ga0496112_0126588_2230_2436 68
165 3300048918 Ga0496115_0737846 Ga0496115_0737846_466_672 68
166 3300001991 JGI24743J22301_10124885 JGI24743J22301_101248852 69
167 3300003203 JGI25406J46586_10001448 JGI25406J46586_100014489 69
168 3300003203 JGI25406J46586_10002592 JGI25406J46586_100025923 69
169 3300003215 JGI25153J46596_10000150 JGI25153J46596_1000015040 69
170 3300003320 rootH2_10140195 rootH2_101401957 69
171 3300003320 rootH2_10252760 rootH2_102527601 69
172 3300003323 rootH1_10047327 rootH1_1004732712 69
173 3300003323 rootH1_10171602 rootH1_101716022 69
174 3300003354 JGI25160J50197_1000263 JGI25160J50197_10002638 69
175 3300003659 JGI25404J52841_10063211 JGI25404J52841_100632112 69
176 3300003911 JGI25405J52794_10097643 JGI25405J52794_100976432 69
177 3300005262 Ga0065165_1065383 Ga0065165_10653831 69
178 3300005330 Ga0070690_101718218 Ga0070690_1017182181 69
179 3300005331 Ga0070670_101111158 Ga0070670_1011111582 69
180 3300005331 Ga0070670_101854210 Ga0070670_1018542102 69
181 3300005334 Ga0068869_100348986 Ga0068869_1003489861 69
182 3300005335 Ga0070666_10955083 Ga0070666_109550831 69
183 3300005336 Ga0070680_100120184 Ga0070680_1001201842 69
184 3300005336 Ga0070680_100410588 Ga0070680_1004105882 69
185 3300005337 Ga0070682_100585439 Ga0070682_1005854392 69
186 3300005338 Ga0068868_100691556 Ga0068868_1006915562 69
187 3300005339 Ga0070660_100046703 Ga0070660_1000467033 69
188 3300005341 Ga0070691_10286465 Ga0070691_102864652 69
189 3300005344 Ga0070661_100455196 Ga0070661_1004551962 69
190 3300005347 Ga0070668_100002573 Ga0070668_1000025733 69
191 3300005353 Ga0070669_100889198 Ga0070669_1008891981 69
192 3300005355 Ga0070671_100641721 Ga0070671_1006417211 69
193 3300005364 Ga0070673_101147970 Ga0070673_1011479701 69
194 3300005366 Ga0070659_100539428 Ga0070659_1005394281 69
195 3300005367 Ga0070667_101962776 Ga0070667_1019627761 69
196 3300005435 Ga0070714_101149522 Ga0070714_1011495222 69
197 3300005435 Ga0070714_101646110 Ga0070714_1016461102 69
198 3300005435 Ga0070714_101811643 Ga0070714_1018116432 69
199 3300005436 Ga0070713_100973780 Ga0070713_1009737801 69
200 3300005437 Ga0070710_10888046 Ga0070710_108880462 69
201 3300005445 Ga0070708_100004944 Ga0070708_1000049446 69
202 3300005455 Ga0070663_100001426 Ga0070663_10000142610 69
203 3300005456 Ga0070678_100595095 Ga0070678_1005950951 69
204 3300005457 Ga0070662_100162812 Ga0070662_1001628122 69
205 3300005458 Ga0070681_10007849 Ga0070681_100078498 69
206 3300005459 Ga0068867_100338934 Ga0068867_1003389342 69
207 3300005466 Ga0070685_10958923 Ga0070685_109589232 69
208 3300005467 Ga0070706_100193718 Ga0070706_1001937182 69
209 3300005467 Ga0070706_100684167 Ga0070706_1006841672 69
210 3300005468 Ga0070707_100234541 Ga0070707_1002345412 69
211 3300005530 Ga0070679_100006857 Ga0070679_1000068576 69
212 3300005530 Ga0070679_100130053 Ga0070679_1001300532 69
213 3300005530 Ga0070679_100751666 Ga0070679_1007516661 69
214 3300005536 Ga0070697_100488533 Ga0070697_1004885332 69
215 3300005539 Ga0068853_101600624 Ga0068853_1016006242 69
216 3300005544 Ga0070686_101650096 Ga0070686_1016500961 69
217 3300005548 Ga0070665_100062323 Ga0070665_1000623232 69
218 3300005548 Ga0070665_101737716 Ga0070665_1017377162 69
219 3300005563 Ga0068855_100017923 Ga0068855_1000179232 69
220 3300005563 Ga0068855_100181294 Ga0068855_1001812942 69
221 3300005563 Ga0068855_100879491 Ga0068855_1008794911 69
222 3300005563 Ga0068855_101744043 Ga0068855_1017440432 69
223 3300005564 Ga0070664_100384936 Ga0070664_1003849362 69
224 3300005577 Ga0068857_100078487 Ga0068857_1000784872 69
225 3300005577 Ga0068857_100212474 Ga0068857_1002124742 69
226 3300005578 Ga0068854_100111487 Ga0068854_1001114872 69
227 3300005614 Ga0068856_101940140 Ga0068856_1019401402 69
228 3300005614 Ga0068856_102083544 Ga0068856_1020835441 69
229 3300005615 Ga0070702_100553845 Ga0070702_1005538452 69
230 3300005616 Ga0068852_100029734 Ga0068852_1000297344 69
231 3300005616 Ga0068852_100223132 Ga0068852_1002231322 69
232 3300005616 Ga0068852_100382998 Ga0068852_1003829982 69
233 3300005617 Ga0068859_100874700 Ga0068859_1008747002 69
234 3300005618 Ga0068864_100149875 Ga0068864_1001498752 69
235 3300005618 Ga0068864_101479982 Ga0068864_1014799822 69
236 3300005718 Ga0068866_10160847 Ga0068866_101608472 69
237 3300005719 Ga0068861_102188441 Ga0068861_1021884411 69
238 3300005834 Ga0068851_10446412 Ga0068851_104464122 69
239 3300005834 Ga0068851_10900062 Ga0068851_109000622 69
240 3300005841 Ga0068863_100445697 Ga0068863_1004456972 69
241 3300005842 Ga0068858_100033991 Ga0068858_1000339913 69
242 3300005843 Ga0068860_101574587 Ga0068860_1015745872 69
243 3300005844 Ga0068862_100052949 Ga0068862_1000529492 69
244 3300005937 Ga0081455_10026211 Ga0081455_100262111 69
245 3300005983 Ga0081540_1299850 Ga0081540_12998502 69
246 3300005985 Ga0081539_10000152 Ga0081539_100001525 69
247 3300005985 Ga0081539_10176064 Ga0081539_101760642 69
248 3300006028 Ga0070717_10673073 Ga0070717_106730732 69
249 3300006028 Ga0070717_10895771 Ga0070717_108957712 69
250 3300006028 Ga0070717_11180009 Ga0070717_111800091 69
251 3300006028 Ga0070717_11380940 Ga0070717_113809402 69
252 3300006038 Ga0075365_10042359 Ga0075365_100423592 69
253 3300006038 Ga0075365_10863101 Ga0075365_108631012 69
254 3300006042 Ga0075368_10209608 Ga0075368_102096082 69
255 3300006042 Ga0075368_10373760 Ga0075368_103737602 69
256 3300006048 Ga0075363_100167314 Ga0075363_1001673142 69
257 3300006051 Ga0075364_10166860 Ga0075364_101668602 69
258 3300006173 Ga0070716_100326945 Ga0070716_1003269451 69
259 3300006175 Ga0070712_100519561 Ga0070712_1005195612 69
260 3300006177 Ga0075362_10372515 Ga0075362_103725152 69
261 3300006178 Ga0075367_10266434 Ga0075367_102664342 69
262 3300006178 Ga0075367_10547323 Ga0075367_105473231 69
263 3300006178 Ga0075367_10794230 Ga0075367_107942302 69
264 3300006186 Ga0075369_10018923 Ga0075369_100189234 69
265 3300006195 Ga0075366_10250057 Ga0075366_102500572 69
266 3300006353 Ga0075370_10158303 Ga0075370_101583032 69
267 3300006881 Ga0068865_100762691 Ga0068865_1007626912 69
268 3300006931 Ga0097620_100874782 Ga0097620_1008747822 69
269 3300009011 Ga0105251_10346225 Ga0105251_103462251 69
270 3300009093 Ga0105240_10137257 Ga0105240_101372575 69
271 3300009093 Ga0105240_10780411 Ga0105240_107804112 69
272 3300009093 Ga0105240_11971844 Ga0105240_119718441 69
273 3300009101 Ga0105247_10014736 Ga0105247_100147363 69
274 3300009148 Ga0105243_10217175 Ga0105243_102171752 69
275 3300009177 Ga0105248_10011911 Ga0105248_100119114 69
276 3300009545 Ga0105237_10207278 Ga0105237_102072782 69
277 3300009545 Ga0105237_10549275 Ga0105237_105492752 69
278 3300009551 Ga0105238_10030817 Ga0105238_100308178 69
279 3300009551 Ga0105238_10045500 Ga0105238_100455002 69
280 3300009551 Ga0105238_10114560 Ga0105238_101145602 69
281 3300009551 Ga0105238_11339466 Ga0105238_113394662 69
282 3300009551 Ga0105238_11640681 Ga0105238_116406812 69
283 3300009553 Ga0105249_10570341 Ga0105249_105703412 69
284 3300009553 Ga0105249_12497191 Ga0105249_124971912 69
285 3300010375 Ga0105239_10021516 Ga0105239_100215167 69
286 3300010375 Ga0105239_10061173 Ga0105239_100611735 69
287 3300010375 Ga0105239_10129087 Ga0105239_101290873 69
288 3300011119 Ga0105246_10686128 Ga0105246_106861282 69
289 3300013104 Ga0157370_10055762 Ga0157370_100557622 69
290 3300013104 Ga0157370_11368820 Ga0157370_113688202 69
291 3300013105 Ga0157369_10004181 Ga0157369_1000418112 69
292 3300013105 Ga0157369_10018445 Ga0157369_100184458 69
293 3300013105 Ga0157369_11044759 Ga0157369_110447592 69
294 3300013296 Ga0157374_10657187 Ga0157374_106571872 69
295 3300013306 Ga0163162_10106039 Ga0163162_101060392 69
296 3300013306 Ga0163162_12543836 Ga0163162_125438362 69
297 3300013307 Ga0157372_10021185 Ga0157372_100211855 69
298 3300013307 Ga0157372_10479428 Ga0157372_104794282 69
299 3300013307 Ga0157372_11083868 Ga0157372_110838682 69
300 3300013307 Ga0157372_11547546 Ga0157372_115475462 69
301 3300013308 Ga0157375_10017407 Ga0157375_100174072 69
302 3300013308 Ga0157375_12004604 Ga0157375_120046042 69
303 3300014325 Ga0163163_10043019 Ga0163163_100430192 69
304 3300014325 Ga0163163_11141993 Ga0163163_111419932 69
305 3300014325 Ga0163163_11567454 Ga0163163_115674542 69
306 3300014969 Ga0157376_10795677 Ga0157376_107956772 69
307 3300014969 Ga0157376_12163952 Ga0157376_121639521 69
308 3300017792 Ga0163161_12020324 Ga0163161_120203241 69
309 3300020069 Ga0197907_10163776 Ga0197907_101637762 69
310 3300020069 Ga0197907_10472093 Ga0197907_104720931 69
311 3300020070 Ga0206356_10800525 Ga0206356_108005252 69
312 3300020070 Ga0206356_11700925 Ga0206356_117009252 69
313 3300020075 Ga0206349_1319226 Ga0206349_13192262 69
314 3300020076 Ga0206355_1376153 Ga0206355_13761531 69
315 3300020078 Ga0206352_10458138 Ga0206352_104581382 69
316 3300020078 Ga0206352_10698535 Ga0206352_106985352 69
317 3300020080 Ga0206350_11177457 Ga0206350_111774572 69
318 3300020081 Ga0206354_11212721 Ga0206354_112127212 69
319 3300020082 Ga0206353_10636173 Ga0206353_106361733 69
320 3300022467 Ga0224712_10000894 Ga0224712_100008946 69
321 3300025273 Ga0209673_1075328 Ga0209673_10753282 69
322 3300025297 Ga0209758_1000068 Ga0209758_1000068251 69
323 3300025297 Ga0209758_1040581 Ga0209758_10405812 69
324 3300025302 Ga0207426_1000225 Ga0207426_1000225109 69
325 3300025302 Ga0207426_1006770 Ga0207426_10067702 69
326 3300025900 Ga0207710_10007151 Ga0207710_100071513 69
327 3300025903 Ga0207680_11100461 Ga0207680_111004612 69
328 3300025904 Ga0207647_10068610 Ga0207647_100686102 69
329 3300025905 Ga0207685_10770592 Ga0207685_107705922 69
330 3300025906 Ga0207699_10581145 Ga0207699_105811452 69
331 3300025910 Ga0207684_10207310 Ga0207684_102073103 69
332 3300025910 Ga0207684_10239614 Ga0207684_102396142 69
333 3300025910 Ga0207684_11273478 Ga0207684_112734782 69
334 3300025912 Ga0207707_10000134 Ga0207707_1000013451 69
335 3300025914 Ga0207671_10191725 Ga0207671_101917252 69
336 3300025914 Ga0207671_10347202 Ga0207671_103472022 69
337 3300025915 Ga0207693_10013599 Ga0207693_100135998 69
338 3300025915 Ga0207693_10071494 Ga0207693_100714942 69
339 3300025915 Ga0207693_10652410 Ga0207693_106524102 69
340 3300025917 Ga0207660_10166460 Ga0207660_101664602 69
341 3300025917 Ga0207660_11557892 Ga0207660_115578921 69
342 3300025919 Ga0207657_10105699 Ga0207657_101056992 69
343 3300025919 Ga0207657_10309769 Ga0207657_103097692 69
344 3300025920 Ga0207649_10414366 Ga0207649_104143662 69
345 3300025921 Ga0207652_10022055 Ga0207652_100220554 69
346 3300025921 Ga0207652_11129822 Ga0207652_111298222 69
347 3300025922 Ga0207646_10580805 Ga0207646_105808052 69
348 3300025923 Ga0207681_10804257 Ga0207681_108042572 69
349 3300025924 Ga0207694_10031190 Ga0207694_100311902 69
350 3300025924 Ga0207694_10067266 Ga0207694_100672662 69
351 3300025924 Ga0207694_10648471 Ga0207694_106484712 69
352 3300025924 Ga0207694_11221237 Ga0207694_112212372 69
353 3300025925 Ga0207650_11589894 Ga0207650_115898941 69
354 3300025928 Ga0207700_10048624 Ga0207700_100486241 69
355 3300025929 Ga0207664_10852454 Ga0207664_108524542 69
356 3300025931 Ga0207644_10444586 Ga0207644_104445862 69
357 3300025931 Ga0207644_10508964 Ga0207644_105089642 69
358 3300025932 Ga0207690_10182546 Ga0207690_101825461 69
359 3300025932 Ga0207690_10669450 Ga0207690_106694502 69
360 3300025933 Ga0207706_10182464 Ga0207706_101824642 69
361 3300025935 Ga0207709_10032165 Ga0207709_100321652 69
362 3300025935 Ga0207709_10326953 Ga0207709_103269532 69
363 3300025939 Ga0207665_10121850 Ga0207665_101218502 69
364 3300025939 Ga0207665_10712310 Ga0207665_107123102 69
365 3300025941 Ga0207711_10075068 Ga0207711_100750682 69
366 3300025941 Ga0207711_10350808 Ga0207711_103508082 69
367 3300025945 Ga0207679_10888331 Ga0207679_108883311 69
368 3300025949 Ga0207667_10033358 Ga0207667_100333585 69
369 3300025949 Ga0207667_10141176 Ga0207667_101411762 69
370 3300025949 Ga0207667_10283726 Ga0207667_102837262 69
371 3300025949 Ga0207667_10437219 Ga0207667_104372191 69
372 3300025972 Ga0207668_10085255 Ga0207668_100852552 69
373 3300025981 Ga0207640_10260203 Ga0207640_102602032 69
374 3300026023 Ga0207677_10017946 Ga0207677_100179462 69
375 3300026035 Ga0207703_10082195 Ga0207703_100821952 69
376 3300026041 Ga0207639_11750764 Ga0207639_117507642 69
377 3300026067 Ga0207678_10002844 Ga0207678_1000284410 69
378 3300026067 Ga0207678_10271544 Ga0207678_102715442 69
379 3300026078 Ga0207702_10079278 Ga0207702_100792785 69
380 3300026078 Ga0207702_10459032 Ga0207702_104590322 69
381 3300026078 Ga0207702_11221814 Ga0207702_112218142 69
382 3300026088 Ga0207641_10053726 Ga0207641_100537262 69
383 3300026089 Ga0207648_10070850 Ga0207648_100708504 69
384 3300026095 Ga0207676_10087430 Ga0207676_100874302 69
385 3300026095 Ga0207676_10526661 Ga0207676_105266612 69
386 3300026116 Ga0207674_10227399 Ga0207674_102273992 69
387 3300026116 Ga0207674_10633954 Ga0207674_106339541 69
388 3300026116 Ga0207674_10813840 Ga0207674_108138402 69
389 3300026118 Ga0207675_101895644 Ga0207675_1018956441 69
390 3300026121 Ga0207683_10620132 Ga0207683_106201321 69
391 3300026121 Ga0207683_10623826 Ga0207683_106238262 69
392 3300026142 Ga0207698_10052519 Ga0207698_100525192 69
393 3300026142 Ga0207698_10195571 Ga0207698_101955712 69
394 3300026142 Ga0207698_10285834 Ga0207698_102858342 69
395 3300027866 Ga0209813_10050884 Ga0209813_100508842 69
396 3300028379 Ga0268266_10223372 Ga0268266_102233722 69
397 3300028380 Ga0268265_10078479 Ga0268265_100784792 69
398 3300028381 Ga0268264_10806750 Ga0268264_108067502 69
399 3300028786 Ga0307517_10149689 Ga0307517_101496892 69
400 3300031507 Ga0307509_10017608 Ga0307509_100176089 69
401 3300031730 Ga0307516_10003424 Ga0307516_1000342412 69
402 3300031730 Ga0307516_10016618 Ga0307516_100166186 69
403 3300031901 Ga0307406_10613612 Ga0307406_106136122 69
404 3300031911 Ga0307412_11766687 Ga0307412_117666872 69
405 3300035112 Ga0373932_0453784 Ga0373932_0453784_26_235 69
406 3300035118 Ga0373954_0086410 Ga0373954_0086410_965_1174 69
407 3300035170 Ga0373943_0060355 Ga0373943_0060355_140_349 69
408 3300035171 Ga0373946_0055274 Ga0373946_0055274_327_536 69
409 3300035172 Ga0373955_0273129 Ga0373955_0273129_780_989 69
410 3300035691 Ga0373931_0710470 Ga0373931_0710470_41_250 69
411 3300035695 Ga0373927_0021587 Ga0373927_0021587_636_845 69
412 3300035695 Ga0373927_0127956 Ga0373927_0127956_772_981 69
413 3300035695 Ga0373927_0144220 Ga0373927_0144220_1308_1517 69
414 3300035724 Ga0373933_0034068 Ga0373933_0034068_386_595 69
415 3300035725 Ga0373947_0048103 Ga0373947_0048103_686_895 69
416 3300037312 Ga0395899_0252448 Ga0395899_0252448_63_272 69
417 3300037418 Ga0395900_0321615 Ga0395900_0321615_141_350 69
418 3300037418 Ga0395900_0815938 Ga0395900_0815938_314_523 69
419 3300037418 Ga0395900_1248050 Ga0395900_1248050_218_427 69
420 3300037418 Ga0395900_1483805 Ga0395900_1483805_50_259 69
421 3300037466 Ga0395898_1116905 Ga0395898_1116905_449_658 69
422 3300037466 Ga0395898_1301696 Ga0395898_1301696_86_295 69
423 3300037471 Ga0395905_0002655 Ga0395905_0002655_19382_19600 69
424 3300037471 Ga0395905_0050668 Ga0395905_0050668_3017_3226 69
425 3300037471 Ga0395905_0780402 Ga0395905_0780402_584_793 69
426 3300038443 Ga0395901_0010810 Ga0395901_0010810_6396_6605 69
427 3300038443 Ga0395901_0092561 Ga0395901_0092561_683_892 69
428 3300038443 Ga0395901_0127726 Ga0395901_0127726_112_321 69
429 3300038443 Ga0395901_0254431 Ga0395901_0254431_64_282 69
430 3300039450 Ga0436363_0946225 Ga0436363_0946225_13244_13453 69
431 3300042012 Ga0439455_0154048 Ga0439455_0154048_45_254 69
432 3300044658 Ga0466972_0000284 Ga0466972_0000284_24469_24678 69
433 3300044683 Ga0466965_0006730 Ga0466965_0006730_4855_5064 69
434 3300044683 Ga0466965_0198664 Ga0466965_0198664_799_1008 69
435 3300044684 Ga0466966_0441832 Ga0466966_0441832_354_563 69
436 3300044693 Ga0466961_0571994 Ga0466961_0571994_359_568 69
437 3300044694 Ga0466963_0037578 Ga0466963_0037578_1164_1373 69
438 3300044706 Ga0466964_0404675 Ga0466964_0404675_59_268 69
439 3300044765 Ga0466970_0025353 Ga0466970_0025353_551_760 69
440 3300044765 Ga0466970_0336669 Ga0466970_0336669_426_635 69
441 3300044901 Ga0466960_0126982 Ga0466960_0126982_599_808 69
442 3300044901 Ga0466960_0239766 Ga0466960_0239766_623_832 69
443 3300044901 Ga0466960_0655024 Ga0466960_0655024_23_232 69
444 3300045976 Ga0466967_0262810 Ga0466967_0262810_777_986 69
445 3300046455 Ga0495603_0040775 Ga0495603_0040775_349_558 69
446 3300046455 Ga0495603_0046034 Ga0495603_0046034_2000_2209 69
447 3300046455 Ga0495603_0051083 Ga0495603_0051083_802_1011 69
448 3300046457 Ga0495590_0028100 Ga0495590_0028100_479_688 69
449 3300046457 Ga0495590_0135195 Ga0495590_0135195_167_376 69
450 3300046461 Ga0495641_0333147 Ga0495641_0333147_298_507 69
451 3300046473 Ga0495582_0136293 Ga0495582_0136293_257_466 69
452 3300046474 Ga0495605_0003890 Ga0495605_0003890_5000_5209 69
453 3300046475 Ga0495639_0315894 Ga0495639_0315894_244_453 69
454 3300046475 Ga0495639_0380682 Ga0495639_0380682_105_314 69
455 3300046491 Ga0495584_0165974 Ga0495584_0165974_769_978 69
456 3300046492 Ga0495585_0111386 Ga0495585_0111386_178_387 69
457 3300046499 Ga0495594_0100741 Ga0495594_0100741_766_975 69
458 3300046506 Ga0495583_0150969 Ga0495583_0150969_652_861 69
459 3300046507 Ga0495606_0394503 Ga0495606_0394503_214_423 69
460 3300046507 Ga0495606_0498586 Ga0495606_0498586_387_596 69
461 3300046507 Ga0495606_0611914 Ga0495606_0611914_107_316 69
462 3300046515 Ga0495620_0064204 Ga0495620_0064204_277_486 69
463 3300046522 Ga0495643_0111418 Ga0495643_0111418_453_662 69
464 3300046524 Ga0495648_0031288 Ga0495648_0031288_3002_3211 69
465 3300046524 Ga0495648_0260543 Ga0495648_0260543_232_450 69
466 3300046531 Ga0495665_0135727 Ga0495665_0135727_319_528 69
467 3300046538 Ga0495609_0021812 Ga0495609_0021812_1147_1356 69
468 3300046557 Ga0495622_0006990 Ga0495622_0006990_3611_3820 69
469 3300046557 Ga0495622_0335033 Ga0495622_0335033_13_222 69
470 3300046616 Ga0495668_0107581 Ga0495668_0107581_330_539 69
471 3300046648 Ga0495611_0026689 Ga0495611_0026689_123_332 69
472 3300046660 Ga0495625_0014732 Ga0495625_0014732_5440_5649 69
473 3300046665 Ga0495661_0012845 Ga0495661_0012845_2354_2563 69
474 3300046665 Ga0495661_0022442 Ga0495661_0022442_967_1176 69
475 3300046674 Ga0495588_0000946 Ga0495588_0000946_5189_5398 69
476 3300046674 Ga0495588_0163778 Ga0495588_0163778_517_726 69
477 3300046674 Ga0495588_0274617 Ga0495588_0274617_107_316 69
478 3300046683 Ga0495658_0097286 Ga0495658_0097286_222_431 69
479 3300046684 Ga0495669_0099801 Ga0495669_0099801_445_654 69
480 3300046690 Ga0495624_0070519 Ga0495624_0070519_744_953 69
481 3300046690 Ga0495624_0073905 Ga0495624_0073905_1786_1995 69
482 3300046692 Ga0495671_0028293 Ga0495671_0028293_2423_2632 69
483 3300046694 Ga0495649_0067463 Ga0495649_0067463_179_388 69
484 3300046694 Ga0495649_0490983 Ga0495649_0490983_249_467 69
485 3300046794 Ga0495589_0026240 Ga0495589_0026240_2205_2414 69
486 3300047315 Ga0495581_0278652 Ga0495581_0278652_282_491 69
487 3300047320 Ga0495672_0057823 Ga0495672_0057823_1815_2024 69
488 3300047321 Ga0495676_0083376 Ga0495676_0083376_220_429 69
489 3300047321 Ga0495676_0666296 Ga0495676_0666296_299_508 69
490 3300047321 Ga0495676_0860059 Ga0495676_0860059_63_272 69
491 3300047443 Ga0495687_056250 Ga0495687_056250_357_575 69
492 3300047469 Ga0495673_0097410 Ga0495673_0097410_396_614 69
493 3300047469 Ga0495673_0117455 Ga0495673_0117455_235_444 69
494 3300048903 Ga0496100_0010861 Ga0496100_0010861_1173_1382 69
495 3300048903 Ga0496100_0256656 Ga0496100_0256656_690_899 69
496 3300048904 Ga0496101_0045045 Ga0496101_0045045_675_884 69
497 3300048904 Ga0496101_0965365 Ga0496101_0965365_338_553 69
498 3300048905 Ga0496102_0012305 Ga0496102_0012305_2207_2416 69
499 3300048905 Ga0496102_0226680 Ga0496102_0226680_50_259 69
500 3300048905 Ga0496102_1872494 Ga0496102_1872494_91_300 69
501 3300048906 Ga0496103_0468481 Ga0496103_0468481_488_697 69
502 3300048906 Ga0496103_0646459 Ga0496103_0646459_185_394 69
503 3300048906 Ga0496103_0895351 Ga0496103_0895351_289_498 69
504 3300048907 Ga0496104_0063170 Ga0496104_0063170_1361_1570 69
505 3300048907 Ga0496104_0091388 Ga0496104_0091388_1446_1655 69
506 3300048907 Ga0496104_0231971 Ga0496104_0231971_1308_1517 69
507 3300048908 Ga0496105_0001482 Ga0496105_0001482_8136_8345 69
508 3300048909 Ga0496106_0017502 Ga0496106_0017502_668_877 69
509 3300048909 Ga0496106_0444368 Ga0496106_0444368_767_976 69
510 3300048909 Ga0496106_0754828 Ga0496106_0754828_38_256 69
511 3300048910 Ga0496107_0004674 Ga0496107_0004674_3313_3522 69
512 3300048910 Ga0496107_0332245 Ga0496107_0332245_292_501 69
513 3300048911 Ga0496108_0287964 Ga0496108_0287964_974_1183 69
514 3300048912 Ga0496109_0219983 Ga0496109_0219983_1140_1349 69
515 3300048912 Ga0496109_0610766 Ga0496109_0610766_492_701 69
516 3300048912 Ga0496109_0874594 Ga0496109_0874594_506_715 69
517 3300048912 Ga0496109_1131070 Ga0496109_1131070_171_380 69
518 3300048913 Ga0496110_0396961 Ga0496110_0396961_455_664 69
519 3300048913 Ga0496110_0435919 Ga0496110_0435919_756_965 69
520 3300048913 Ga0496110_0610078 Ga0496110_0610078_494_703 69
521 3300048913 Ga0496110_0639741 Ga0496110_0639741_336_545 69
522 3300048913 Ga0496110_1025010 Ga0496110_1025010_188_397 69
523 3300048914 Ga0496111_0070727 Ga0496111_0070727_1746_1955 69
524 3300048914 Ga0496111_0287431 Ga0496111_0287431_848_1057 69
525 3300048915 Ga0496112_0019781 Ga0496112_0019781_1160_1369 69
526 3300048915 Ga0496112_0460945 Ga0496112_0460945_927_1136 69
527 3300048915 Ga0496112_0747059 Ga0496112_0747059_577_786 69
528 3300048915 Ga0496112_0831677 Ga0496112_0831677_420_629 69
529 3300048916 Ga0496113_0042305 Ga0496113_0042305_727_936 69
530 3300048916 Ga0496113_0058544 Ga0496113_0058544_2560_2769 69
531 3300048917 Ga0496114_0002836 Ga0496114_0002836_9326_9535 69
532 3300048918 Ga0496115_0035664 Ga0496115_0035664_3183_3392 69
533 3300048918 Ga0496115_0044775 Ga0496115_0044775_437_646 69
534 3300048919 Ga0496116_0022742 Ga0496116_0022742_3351_3560 69
535 3300048920 Ga0496117_0395645 Ga0496117_0395645_471_680 69
536 3300048921 Ga0496118_0014217 Ga0496118_0014217_1120_1329 69
537 3300048922 Ga0496119_0016691 Ga0496119_0016691_4895_5104 69
538 3300048923 Ga0496120_0137579 Ga0496120_0137579_773_982 69
539 3300048924 Ga0496121_0004922 Ga0496121_0004922_6374_6589 69
540 3300048924 Ga0496121_0019396 Ga0496121_0019396_3039_3248 69
541 3300048927 Ga0496124_0346342 Ga0496124_0346342_20_229 69
542 3300048928 Ga0496125_0006229 Ga0496125_0006229_9870_10088 69
543 3300048929 Ga0496126_0024788 Ga0496126_0024788_466_675 69
544 3300049460 Ga0495682_0132003 Ga0495682_0132003_330_539 69
545 3300049583 Ga0501067_0092243 Ga0501067_0092243_420_629 69
546 3300050489 nmdc:mga03683_544730_c1 nmdc:mga03683_544730_c1_282_491 69
547 3300050490 nmdc:mga03n38_37300_c1 nmdc:mga03n38_37300_c1_98_316 69
548 3300050490 nmdc:mga03n38_411173_c1 nmdc:mga03n38_411173_c1_50_259 69
549 3300050491 nmdc:mga00v17_74820_c1 nmdc:mga00v17_74820_c1_1112_1330 69
550 3300050492 nmdc:mga0yw44_17344_c1 nmdc:mga0yw44_17344_c1_2876_3094 69
551 3300050493 nmdc:mga0k408_93730_c1 nmdc:mga0k408_93730_c1_746_964 69
552 3300050494 nmdc:mga06z11_364901_c1 nmdc:mga06z11_364901_c1_352_570 69
553 3300050494 nmdc:mga06z11_540163_c1 nmdc:mga06z11_540163_c1_277_486 69
554 3300050495 nmdc:mga04h51_194524_c1 nmdc:mga04h51_194524_c1_346_555 69
555 3300050495 nmdc:mga04h51_50730_c1 nmdc:mga04h51_50730_c1_898_1116 69
556 3300050496 nmdc:mga07m45_73760_c1 nmdc:mga07m45_73760_c1_917_1135 69
557 3300050496 nmdc:mga07m45_808641_c1 nmdc:mga07m45_808641_c1_63_272 69
558 3300050511 nmdc:mga08y16_2019711_c1 nmdc:mga08y16_2019711_c1_232_447 69
559 3300050516 nmdc:mga0sz30_22563_c1 nmdc:mga0sz30_22563_c1_19_237 69
560 3300050516 nmdc:mga0sz30_485543_c1 nmdc:mga0sz30_485543_c1_161_370 69
561 3300053079 Ga0500610_0021997 Ga0500610_0021997_135_344 69
562 3300053083 Ga0495655_0025657 Ga0495655_0025657_418_627 69
563 3300053086 Ga0500578_0099457 Ga0500578_0099457_1590_1799 69
564 3300053087 Ga0500643_000007 Ga0500643_000007_115442_115657 69
565 3300053087 Ga0500643_128325 Ga0500643_128325_18_227 69
566 3300053092 Ga0500583_0037379 Ga0500583_0037379_92_301 69
567 3300053092 Ga0500583_0135540 Ga0500583_0135540_801_1016 69
568 3300053093 Ga0500651_0005130 Ga0500651_0005130_2712_2921 69
569 3300053096 Ga0500641_0306351 Ga0500641_0306351_367_582 69
570 3300053103 Ga0500555_029069 Ga0500555_029069_165_374 69
571 3300053109 Ga0500569_000535 Ga0500569_000535_2840_3049 69
572 3300053129 Ga0500628_113493 Ga0500628_113493_163_372 69
573 3300053130 Ga0500642_0000547 Ga0500642_0000547_8020_8229 69
574 3300053133 Ga0500655_006251 Ga0500655_006251_215_424 69
575 3300053139 Ga0500568_0017118 Ga0500568_0017118_1657_1866 69
576 3300053140 Ga0500573_0249290 Ga0500573_0249290_117_326 69
577 3300053142 Ga0500577_0159355 Ga0500577_0159355_92_301 69
578 3300053142 Ga0500577_0318578 Ga0500577_0318578_135_344 69
579 3300053146 Ga0500588_0009573 Ga0500588_0009573_923_1132 69
580 3300053147 Ga0500589_114597 Ga0500589_114597_594_803 69
581 3300053158 Ga0500627_0062807 Ga0500627_0062807_739_948 69
582 3300053177 Ga0500636_0163906 Ga0500636_0163906_352_561 69
583 3300053731 Ga0500609_002160 Ga0500609_002160_2477_2686 69

Feature Viewer

pLDDT pTM Quality
59.41 0.18 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map