F466279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 397 | 480 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10182464|Ga0207706_101824642 |
| Length | 77 |
| Sequence | MQNLEDMAMRSERKTKLGRRDFLRKVGIGTVGAGATLATPLITPAQADSETDDEKRKARYKETDHVKAYYRVNRYPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 11 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 12 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 13 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 14 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 15 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 16 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 17 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 18 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 19 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 20 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 21 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 22 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 23 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 24 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 25 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 26 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 27 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 28 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 29 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 30 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 31 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 32 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 33 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 34 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 35 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 36 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 37 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 38 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 39 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 40 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 41 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 42 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 43 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 44 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 45 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 46 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 47 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 48 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 49 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 50 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 51 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 52 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 53 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 54 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 55 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 56 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 57 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 58 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 59 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 60 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 61 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 62 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 63 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 64 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 65 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 66 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 67 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 68 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 69 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 70 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 71 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 72 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 73 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 74 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 75 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 76 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 77 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 78 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 79 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 80 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 81 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 82 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 83 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 84 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 85 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 87 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 88 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 89 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 90 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 97 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 101 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 121 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 130 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 132 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 133 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 134 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 138 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 139 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 140 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 141 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 142 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 143 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 144 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 145 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 146 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 147 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 148 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 150 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 151 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 152 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 153 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 157 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 158 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 159 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 160 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 161 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 162 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 164 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 187 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 365 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 369 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 370 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 371 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 372 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 373 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 374 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 377 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 380 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 381 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 382 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 383 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 384 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 385 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 386 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 387 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 388 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 389 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 390 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 391 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 392 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 393 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 394 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 395 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 396 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 397 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.69 |
| Metatranscriptomes | 2.75 |
| Isolates | 17.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.12 |
| Nodule | 13.38 |
| Rhizoplane | 8.75 |
| Rhizosphere | 60.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10124885 | 3300001991 | Bacteria | 566 |
| 2 | JGI25406J46586_10001448 | 3300003203 | Bacteria | 11187 |
| 3 | JGI25406J46586_10002592 | 3300003203 | Bacteria | 8533 |
| 4 | JGI25153J46596_10000150 | 3300003215 | Bacteria | 70192 |
| 5 | rootH2_10140195 | 3300003320 | Bacteria | 5706 |
| 6 | rootH2_10252760 | 3300003320 | Bacteria | 1568 |
| 7 | rootH1_10047327 | 3300003316 | Bacteria | 7043 |
| 8 | rootH1_10047327 | 3300003323 | Bacteria | 9811 |
| 9 | rootH1_10171602 | 3300003323 | Bacteria | 4552 |
| 10 | JGI25160J50197_1000263 | 3300003354 | Bacteria | 39637 |
| 11 | JGI25404J52841_10063211 | 3300003659 | Bacteria | 775 |
| 12 | JGI25405J52794_10097643 | 3300003911 | Bacteria | 654 |
| 13 | Ga0065165_1065383 | 3300005262 | Bacteria | 982 |
| 14 | Ga0070683_100228368 | 3300005329 | Bacteria | 1769 |
| 15 | Ga0070690_101718218 | 3300005330 | Bacteria | 510 |
| 16 | Ga0070670_101111158 | 3300005331 | Bacteria | 721 |
| 17 | Ga0070670_101854210 | 3300005331 | Bacteria | 555 |
| 18 | Ga0068869_100348986 | 3300005334 | Bacteria | 1206 |
| 19 | Ga0070666_10955083 | 3300005335 | Bacteria | 635 |
| 20 | Ga0070680_100120184 | 3300005336 | Bacteria | 2193 |
| 21 | Ga0070680_100410588 | 3300005336 | Bacteria | 1155 |
| 22 | Ga0070682_100585439 | 3300005337 | Bacteria | 879 |
| 23 | Ga0068868_100691556 | 3300005338 | Bacteria | 912 |
| 24 | Ga0070660_100046703 | 3300005339 | Bacteria | 3320 |
| 25 | Ga0070691_10286465 | 3300005341 | Bacteria | 895 |
| 26 | Ga0070661_100455196 | 3300005344 | Bacteria | 1019 |
| 27 | Ga0070668_100002573 | 3300005347 | Bacteria | 13344 |
| 28 | Ga0070669_100889198 | 3300005353 | Bacteria | 760 |
| 29 | Ga0070671_100641721 | 3300005355 | Bacteria | 919 |
| 30 | Ga0070673_101147970 | 3300005364 | Bacteria | 727 |
| 31 | Ga0070659_100539428 | 3300005366 | Bacteria | 998 |
| 32 | Ga0070667_101962776 | 3300005367 | Bacteria | 551 |
| 33 | Ga0070709_10004768 | 3300005434 | Bacteria | 7327 |
| 34 | Ga0070714_100002758 | 3300005435 | Bacteria | 12944 |
| 35 | Ga0070714_101149522 | 3300005435 | Bacteria | 757 |
| 36 | Ga0070714_101646110 | 3300005435 | Bacteria | 627 |
| 37 | Ga0070714_101811643 | 3300005435 | Bacteria | 596 |
| 38 | Ga0070713_100020112 | 3300005436 | Bacteria | 5111 |
| 39 | Ga0070713_100973780 | 3300005436 | Bacteria | 818 |
| 40 | Ga0070710_10005026 | 3300005437 | Bacteria | 6258 |
| 41 | Ga0070710_10888046 | 3300005437 | Bacteria | 643 |
| 42 | Ga0070711_100001108 | 3300005439 | Bacteria | 14390 |
| 43 | Ga0070708_100004944 | 3300005445 | Bacteria | 10543 |
| 44 | Ga0070663_100001426 | 3300005455 | Bacteria | 13081 |
| 45 | Ga0070678_100595095 | 3300005456 | Bacteria | 987 |
| 46 | Ga0070662_100162812 | 3300005457 | Bacteria | 1746 |
| 47 | Ga0070681_10007849 | 3300005458 | Bacteria | 10436 |
| 48 | Ga0068867_100338934 | 3300005459 | Bacteria | 1251 |
| 49 | Ga0070685_10958923 | 3300005466 | Bacteria | 640 |
| 50 | Ga0070706_100193718 | 3300005467 | Bacteria | 1899 |
| 51 | Ga0070706_100684167 | 3300005467 | Bacteria | 952 |
| 52 | Ga0070707_100234541 | 3300005468 | Bacteria | 1786 |
| 53 | Ga0070679_100006857 | 3300005530 | Bacteria | 10619 |
| 54 | Ga0070679_100130053 | 3300005530 | Bacteria | 2499 |
| 55 | Ga0070679_100751666 | 3300005530 | Bacteria | 918 |
| 56 | Ga0070697_100488533 | 3300005536 | Bacteria | 1076 |
| 57 | Ga0068853_101600624 | 3300005539 | Bacteria | 631 |
| 58 | Ga0070686_101650096 | 3300005544 | Bacteria | 543 |
| 59 | Ga0070665_100062323 | 3300005548 | Bacteria | 3739 |
| 60 | Ga0070665_101737716 | 3300005548 | Bacteria | 631 |
| 61 | Ga0068855_100017923 | 3300005563 | Bacteria | 8507 |
| 62 | Ga0068855_100181294 | 3300005563 | Bacteria | 2381 |
| 63 | Ga0068855_100879491 | 3300005563 | Bacteria | 948 |
| 64 | Ga0068855_101744043 | 3300005563 | Bacteria | 634 |
| 65 | Ga0070664_100384936 | 3300005564 | Bacteria | 1281 |
| 66 | Ga0068857_100078487 | 3300005577 | Bacteria | 2947 |
| 67 | Ga0068857_100212474 | 3300005577 | Bacteria | 1766 |
| 68 | Ga0068854_100111487 | 3300005578 | Bacteria | 2064 |
| 69 | Ga0068856_100295315 | 3300005614 | Bacteria | 1637 |
| 70 | Ga0068856_101940140 | 3300005614 | Bacteria | 600 |
| 71 | Ga0068856_102083544 | 3300005614 | Bacteria | 577 |
| 72 | Ga0070702_100553845 | 3300005615 | Bacteria | 854 |
| 73 | Ga0068852_100029734 | 3300005616 | Bacteria | 4490 |
| 74 | Ga0068852_100223132 | 3300005616 | Bacteria | 1793 |
| 75 | Ga0068852_100382998 | 3300005616 | Bacteria | 1380 |
| 76 | Ga0068859_100874700 | 3300005617 | Bacteria | 984 |
| 77 | Ga0068864_100149875 | 3300005618 | Bacteria | 2112 |
| 78 | Ga0068864_101479982 | 3300005618 | Bacteria | 682 |
| 79 | Ga0068866_10160847 | 3300005718 | Bacteria | 1309 |
| 80 | Ga0068861_102188441 | 3300005719 | Bacteria | 554 |
| 81 | Ga0068851_10446412 | 3300005834 | Bacteria | 768 |
| 82 | Ga0068851_10900062 | 3300005834 | Bacteria | 554 |
| 83 | Ga0068863_100445697 | 3300005841 | Bacteria | 1270 |
| 84 | Ga0068858_100033991 | 3300005842 | Bacteria | 4730 |
| 85 | Ga0068860_101574587 | 3300005843 | Bacteria | 679 |
| 86 | Ga0068862_100052949 | 3300005844 | Bacteria | 3474 |
| 87 | Ga0081455_10026211 | 3300005937 | Bacteria | 5368 |
| 88 | Ga0081540_1299850 | 3300005983 | Bacteria | 552 |
| 89 | Ga0081539_10000152 | 3300005985 | Bacteria | 160005 |
| 90 | Ga0081539_10176064 | 3300005985 | Bacteria | 1007 |
| 91 | Ga0070717_10016263 | 3300006028 | Bacteria | 5765 |
| 92 | Ga0070717_10362602 | 3300006028 | Bacteria | 1297 |
| 93 | Ga0070717_10673073 | 3300006028 | Bacteria | 940 |
| 94 | Ga0070717_10895771 | 3300006028 | Bacteria | 808 |
| 95 | Ga0070717_11180009 | 3300006028 | Bacteria | 697 |
| 96 | Ga0070717_11380940 | 3300006028 | Bacteria | 640 |
| 97 | Ga0075365_10042359 | 3300006038 | Bacteria | 2976 |
| 98 | Ga0075365_10863101 | 3300006038 | Bacteria | 638 |
| 99 | Ga0075368_10209608 | 3300006042 | Bacteria | 826 |
| 100 | Ga0075368_10373760 | 3300006042 | Bacteria | 623 |
| 101 | Ga0075363_100167314 | 3300006048 | Bacteria | 1247 |
| 102 | Ga0075364_10166860 | 3300006051 | Bacteria | 1488 |
| 103 | Ga0070715_10003339 | 3300006163 | Bacteria | 5085 |
| 104 | Ga0070716_100005187 | 3300006173 | Bacteria | 6299 |
| 105 | Ga0070716_100326945 | 3300006173 | Bacteria | 1076 |
| 106 | Ga0070712_100022031 | 3300006175 | Bacteria | 4192 |
| 107 | Ga0070712_100519561 | 3300006175 | Bacteria | 1000 |
| 108 | Ga0070712_101089239 | 3300006175 | Bacteria | 693 |
| 109 | Ga0075362_10372515 | 3300006177 | Bacteria | 717 |
| 110 | Ga0075367_10266434 | 3300006178 | Bacteria | 1076 |
| 111 | Ga0075367_10547323 | 3300006178 | Bacteria | 735 |
| 112 | Ga0075367_10794230 | 3300006178 | Bacteria | 603 |
| 113 | Ga0075369_10018923 | 3300006186 | Bacteria | 2808 |
| 114 | Ga0075366_10204628 | 3300006195 | Bacteria | 1201 |
| 115 | Ga0075366_10250057 | 3300006195 | Bacteria | 1081 |
| 116 | Ga0075370_10158303 | 3300006353 | Bacteria | 1328 |
| 117 | Ga0068865_100762691 | 3300006881 | Bacteria | 832 |
| 118 | Ga0097620_100874782 | 3300006931 | Bacteria | 984 |
| 119 | Ga0099795_10066505 | 3300007788 | Bacteria | 1350 |
| 120 | Ga0105251_10346225 | 3300009011 | Bacteria | 678 |
| 121 | Ga0105240_10137257 | 3300009093 | Bacteria | 2928 |
| 122 | Ga0105240_10780411 | 3300009093 | Bacteria | 1036 |
| 123 | Ga0105240_11971844 | 3300009093 | Bacteria | 607 |
| 124 | Ga0105247_10014736 | 3300009101 | Bacteria | 4685 |
| 125 | Ga0105243_10217175 | 3300009148 | Bacteria | 1688 |
| 126 | Ga0105248_10011911 | 3300009177 | Bacteria | 9592 |
| 127 | Ga0105237_10207278 | 3300009545 | Bacteria | 1961 |
| 128 | Ga0105237_10549275 | 3300009545 | Bacteria | 1162 |
| 129 | Ga0105237_12554569 | 3300009545 | Bacteria | 521 |
| 130 | Ga0105238_10030817 | 3300009551 | Bacteria | 5458 |
| 131 | Ga0105238_10045500 | 3300009551 | Bacteria | 4433 |
| 132 | Ga0105238_10114560 | 3300009551 | Bacteria | 2675 |
| 133 | Ga0105238_11339466 | 3300009551 | Bacteria | 742 |
| 134 | Ga0105238_11640681 | 3300009551 | Bacteria | 673 |
| 135 | Ga0105249_10570341 | 3300009553 | Bacteria | 1184 |
| 136 | Ga0105249_12497191 | 3300009553 | Bacteria | 589 |
| 137 | Ga0105239_10021516 | 3300010375 | Bacteria | 7110 |
| 138 | Ga0105239_10061173 | 3300010375 | Bacteria | 4132 |
| 139 | Ga0105239_10129087 | 3300010375 | Bacteria | 2810 |
| 140 | Ga0105246_10686128 | 3300011119 | Bacteria | 896 |
| 141 | Ga0157370_10055762 | 3300013104 | Bacteria | 3763 |
| 142 | Ga0157370_11368820 | 3300013104 | Bacteria | 637 |
| 143 | Ga0157369_10004181 | 3300013105 | Bacteria | 17104 |
| 144 | Ga0157369_10018445 | 3300013105 | Bacteria | 7824 |
| 145 | Ga0157369_11044759 | 3300013105 | Bacteria | 836 |
| 146 | Ga0157374_10657187 | 3300013296 | Bacteria | 1060 |
| 147 | Ga0163162_10106039 | 3300013306 | Bacteria | 2905 |
| 148 | Ga0163162_12543836 | 3300013306 | Bacteria | 589 |
| 149 | Ga0157372_10021185 | 3300013307 | Bacteria | 7023 |
| 150 | Ga0157372_10479428 | 3300013307 | Bacteria | 1450 |
| 151 | Ga0157372_11083868 | 3300013307 | Bacteria | 927 |
| 152 | Ga0157372_11547546 | 3300013307 | Bacteria | 764 |
| 153 | Ga0157375_10017407 | 3300013308 | Bacteria | 6485 |
| 154 | Ga0157375_12004604 | 3300013308 | Bacteria | 688 |
| 155 | Ga0163163_10043019 | 3300014325 | Bacteria | 4427 |
| 156 | Ga0163163_11141993 | 3300014325 | Bacteria | 842 |
| 157 | Ga0163163_11567454 | 3300014325 | Bacteria | 720 |
| 158 | Ga0157376_10795677 | 3300014969 | Bacteria | 958 |
| 159 | Ga0157376_12163952 | 3300014969 | Bacteria | 595 |
| 160 | Ga0163161_10780540 | 3300017792 | Bacteria | 801 |
| 161 | Ga0163161_12020324 | 3300017792 | Bacteria | 513 |
| 162 | Ga0197907_10163776 | 3300020069 | Bacteria | 1890 |
| 163 | Ga0197907_10472093 | 3300020069 | Bacteria | 1331 |
| 164 | Ga0206356_10780751 | 3300020070 | Bacteria | 1059 |
| 165 | Ga0206356_10800525 | 3300020070 | Bacteria | 2176 |
| 166 | Ga0206356_11700925 | 3300020070 | Bacteria | 1265 |
| 167 | Ga0206349_1319226 | 3300020075 | Bacteria | 3012 |
| 168 | Ga0206349_1978123 | 3300020075 | Bacteria | 813 |
| 169 | Ga0206355_1376153 | 3300020076 | Bacteria | 656 |
| 170 | Ga0206352_10458138 | 3300020078 | Bacteria | 1239 |
| 171 | Ga0206352_10698535 | 3300020078 | Bacteria | 1551 |
| 172 | Ga0206350_10017517 | 3300020080 | Bacteria | 2509 |
| 173 | Ga0206350_11177457 | 3300020080 | Bacteria | 5837 |
| 174 | Ga0206354_11212721 | 3300020081 | Bacteria | 900 |
| 175 | Ga0206353_10636173 | 3300020082 | Bacteria | 2499 |
| 176 | Ga0224712_10000894 | 3300022467 | Bacteria | 6401 |
| 177 | Ga0224712_10256454 | 3300022467 | Bacteria | 809 |
| 178 | Ga0209673_1075328 | 3300025273 | Bacteria | 789 |
| 179 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 180 | Ga0209758_1040581 | 3300025297 | Bacteria | 1753 |
| 181 | Ga0207426_1000225 | 3300025302 | Bacteria | 129646 |
| 182 | Ga0207426_1006770 | 3300025302 | Bacteria | 4909 |
| 183 | Ga0207692_10004384 | 3300025898 | Bacteria | 5588 |
| 184 | Ga0207710_10007151 | 3300025900 | Bacteria | 4734 |
| 185 | Ga0207680_11100461 | 3300025903 | Bacteria | 568 |
| 186 | Ga0207647_10068610 | 3300025904 | Bacteria | 2146 |
| 187 | Ga0207685_10013466 | 3300025905 | Bacteria | 2531 |
| 188 | Ga0207685_10770592 | 3300025905 | Bacteria | 528 |
| 189 | Ga0207699_10001530 | 3300025906 | Bacteria | 10975 |
| 190 | Ga0207699_10581145 | 3300025906 | Bacteria | 815 |
| 191 | Ga0207684_10207310 | 3300025910 | Bacteria | 1691 |
| 192 | Ga0207684_10239614 | 3300025910 | Bacteria | 1565 |
| 193 | Ga0207684_11273478 | 3300025910 | Bacteria | 606 |
| 194 | Ga0207707_10000134 | 3300025912 | Bacteria | 77031 |
| 195 | Ga0207671_10191725 | 3300025914 | Bacteria | 1594 |
| 196 | Ga0207671_10347202 | 3300025914 | Bacteria | 1176 |
| 197 | Ga0207693_10000530 | 3300025915 | Bacteria | 34447 |
| 198 | Ga0207693_10013599 | 3300025915 | Bacteria | 6559 |
| 199 | Ga0207693_10071494 | 3300025915 | Bacteria | 2716 |
| 200 | Ga0207693_10652410 | 3300025915 | Bacteria | 817 |
| 201 | Ga0207693_11013965 | 3300025915 | Bacteria | 633 |
| 202 | Ga0207663_10003538 | 3300025916 | Bacteria | 7662 |
| 203 | Ga0207660_10166460 | 3300025917 | Bacteria | 1704 |
| 204 | Ga0207660_11557892 | 3300025917 | Bacteria | 533 |
| 205 | Ga0207657_10105699 | 3300025919 | Bacteria | 2330 |
| 206 | Ga0207657_10309769 | 3300025919 | Bacteria | 1250 |
| 207 | Ga0207649_10414366 | 3300025920 | Bacteria | 1011 |
| 208 | Ga0207652_10022055 | 3300025921 | Bacteria | 5263 |
| 209 | Ga0207652_11129822 | 3300025921 | Bacteria | 684 |
| 210 | Ga0207646_10580805 | 3300025922 | Bacteria | 1006 |
| 211 | Ga0207681_10804257 | 3300025923 | Bacteria | 785 |
| 212 | Ga0207694_10031190 | 3300025924 | Bacteria | 4070 |
| 213 | Ga0207694_10067266 | 3300025924 | Bacteria | 2797 |
| 214 | Ga0207694_10648471 | 3300025924 | Bacteria | 889 |
| 215 | Ga0207694_11221237 | 3300025924 | Bacteria | 636 |
| 216 | Ga0207650_11589894 | 3300025925 | Bacteria | 555 |
| 217 | Ga0207700_10048624 | 3300025928 | Bacteria | 3151 |
| 218 | Ga0207700_10103692 | 3300025928 | Bacteria | 2274 |
| 219 | Ga0207700_11156914 | 3300025928 | Bacteria | 691 |
| 220 | Ga0207664_10095797 | 3300025929 | Bacteria | 2442 |
| 221 | Ga0207664_10852454 | 3300025929 | Bacteria | 819 |
| 222 | Ga0207644_10444586 | 3300025931 | Bacteria | 1064 |
| 223 | Ga0207644_10508964 | 3300025931 | Bacteria | 994 |
| 224 | Ga0207690_10182546 | 3300025932 | Bacteria | 1581 |
| 225 | Ga0207690_10669450 | 3300025932 | Bacteria | 852 |
| 226 | Ga0207706_10182464 | 3300025933 | Bacteria | 1843 |
| 227 | Ga0207709_10032165 | 3300025935 | Bacteria | 3070 |
| 228 | Ga0207709_10326953 | 3300025935 | Bacteria | 1150 |
| 229 | Ga0207665_10000303 | 3300025939 | Bacteria | 34072 |
| 230 | Ga0207665_10121850 | 3300025939 | Bacteria | 1843 |
| 231 | Ga0207665_10712310 | 3300025939 | Bacteria | 789 |
| 232 | Ga0207711_10075068 | 3300025941 | Bacteria | 2942 |
| 233 | Ga0207711_10350808 | 3300025941 | Bacteria | 1366 |
| 234 | Ga0207679_10888331 | 3300025945 | Bacteria | 815 |
| 235 | Ga0207667_10033358 | 3300025949 | Bacteria | 5536 |
| 236 | Ga0207667_10141176 | 3300025949 | Bacteria | 2480 |
| 237 | Ga0207667_10283726 | 3300025949 | Bacteria | 1692 |
| 238 | Ga0207667_10437219 | 3300025949 | Bacteria | 1330 |
| 239 | Ga0207668_10085255 | 3300025972 | Bacteria | 2304 |
| 240 | Ga0207640_10260203 | 3300025981 | Bacteria | 1352 |
| 241 | Ga0207677_10017946 | 3300026023 | Bacteria | 4236 |
| 242 | Ga0207703_10082195 | 3300026035 | Bacteria | 2687 |
| 243 | Ga0207639_11750764 | 3300026041 | Bacteria | 582 |
| 244 | Ga0207678_10002844 | 3300026067 | Bacteria | 15692 |
| 245 | Ga0207678_10271544 | 3300026067 | Bacteria | 1454 |
| 246 | Ga0207678_10595743 | 3300026067 | Bacteria | 969 |
| 247 | Ga0207702_10079278 | 3300026078 | Bacteria | 2846 |
| 248 | Ga0207702_10459032 | 3300026078 | Bacteria | 1237 |
| 249 | Ga0207702_11221814 | 3300026078 | Bacteria | 746 |
| 250 | Ga0207641_10053726 | 3300026088 | Bacteria | 3416 |
| 251 | Ga0207648_10070850 | 3300026089 | Bacteria | 3039 |
| 252 | Ga0207676_10087430 | 3300026095 | Bacteria | 2549 |
| 253 | Ga0207676_10526661 | 3300026095 | Bacteria | 1126 |
| 254 | Ga0207674_10227399 | 3300026116 | Bacteria | 1814 |
| 255 | Ga0207674_10633954 | 3300026116 | Bacteria | 1032 |
| 256 | Ga0207674_10813840 | 3300026116 | Bacteria | 901 |
| 257 | Ga0207675_101895644 | 3300026118 | Bacteria | 615 |
| 258 | Ga0207683_10620132 | 3300026121 | Bacteria | 1002 |
| 259 | Ga0207683_10623826 | 3300026121 | Bacteria | 998 |
| 260 | Ga0207698_10052519 | 3300026142 | Bacteria | 3123 |
| 261 | Ga0207698_10195571 | 3300026142 | Bacteria | 1806 |
| 262 | Ga0207698_10285834 | 3300026142 | Bacteria | 1528 |
| 263 | Ga0209179_1013033 | 3300027512 | Bacteria | 1503 |
| 264 | Ga0209813_10050884 | 3300027866 | Bacteria | 1294 |
| 265 | Ga0268266_10223372 | 3300028379 | Bacteria | 1732 |
| 266 | Ga0268265_10078479 | 3300028380 | Bacteria | 2597 |
| 267 | Ga0268264_10806750 | 3300028381 | Bacteria | 938 |
| 268 | Ga0307517_10149689 | 3300028786 | Bacteria | 1606 |
| 269 | Ga0307509_10017608 | 3300031507 | Bacteria | 8217 |
| 270 | Ga0307516_10003424 | 3300031730 | Bacteria | 20395 |
| 271 | Ga0307516_10016618 | 3300031730 | Bacteria | 7690 |
| 272 | Ga0307406_10613612 | 3300031901 | Bacteria | 898 |
| 273 | Ga0307412_11766687 | 3300031911 | Bacteria | 568 |
| 274 | Ga0373932_0453784 | 3300035112 | Bacteria | 504 |
| 275 | Ga0373954_0086410 | 3300035118 | Bacteria | 1503 |
| 276 | Ga0373943_0060355 | 3300035170 | Bacteria | 1893 |
| 277 | Ga0373946_0055274 | 3300035171 | Bacteria | 1673 |
| 278 | Ga0373955_0273129 | 3300035172 | Bacteria | 1016 |
| 279 | Ga0373931_0710470 | 3300035691 | Bacteria | 664 |
| 280 | Ga0373927_0021587 | 3300035695 | Bacteria | 4220 |
| 281 | Ga0373927_0127956 | 3300035695 | Bacteria | 1659 |
| 282 | Ga0373927_0144220 | 3300035695 | Bacteria | 1558 |
| 283 | Ga0373933_0034068 | 3300035724 | Bacteria | 2966 |
| 284 | Ga0373947_0048103 | 3300035725 | Bacteria | 2558 |
| 285 | Ga0395899_0252448 | 3300037312 | Bacteria | 1210 |
| 286 | Ga0395900_0321615 | 3300037418 | Bacteria | 1527 |
| 287 | Ga0395900_0815938 | 3300037418 | Bacteria | 860 |
| 288 | Ga0395900_1248050 | 3300037418 | Bacteria | 658 |
| 289 | Ga0395900_1483805 | 3300037418 | Bacteria | 590 |
| 290 | Ga0395898_1116905 | 3300037466 | Bacteria | 721 |
| 291 | Ga0395898_1301696 | 3300037466 | Bacteria | 656 |
| 292 | Ga0395905_0002655 | 3300037471 | Bacteria | 19624 |
| 293 | Ga0395905_0050668 | 3300037471 | Bacteria | 3889 |
| 294 | Ga0395905_0780402 | 3300037471 | Bacteria | 858 |
| 295 | Ga0395901_0010810 | 3300038443 | Bacteria | 9251 |
| 296 | Ga0395901_0092561 | 3300038443 | Bacteria | 3165 |
| 297 | Ga0395901_0127726 | 3300038443 | Bacteria | 2672 |
| 298 | Ga0395901_0254431 | 3300038443 | Bacteria | 1829 |
| 299 | Ga0436363_0946225 | 3300039450 | Bacteria | 15148 |
| 300 | Ga0439455_0154048 | 3300042012 | Bacteria | 655 |
| 301 | Ga0466972_0000284 | 3300044658 | Bacteria | 31556 |
| 302 | Ga0466965_0006730 | 3300044683 | Bacteria | 5244 |
| 303 | Ga0466965_0198664 | 3300044683 | Bacteria | 1063 |
| 304 | Ga0466966_0441832 | 3300044684 | Bacteria | 782 |
| 305 | Ga0466961_0571994 | 3300044693 | Bacteria | 680 |
| 306 | Ga0466963_0037578 | 3300044694 | Bacteria | 3163 |
| 307 | Ga0466964_0404675 | 3300044706 | Bacteria | 714 |
| 308 | Ga0466970_0025353 | 3300044765 | Bacteria | 3105 |
| 309 | Ga0466970_0336669 | 3300044765 | Bacteria | 855 |
| 310 | Ga0466960_0126982 | 3300044901 | Bacteria | 1342 |
| 311 | Ga0466960_0239766 | 3300044901 | Bacteria | 1004 |
| 312 | Ga0466960_0655024 | 3300044901 | Bacteria | 627 |
| 313 | Ga0466967_0262810 | 3300045976 | Bacteria | 1652 |
| 314 | Ga0495603_0040775 | 3300046455 | Bacteria | 2778 |
| 315 | Ga0495603_0046034 | 3300046455 | Bacteria | 2600 |
| 316 | Ga0495603_0051083 | 3300046455 | Bacteria | 2457 |
| 317 | Ga0495590_0028100 | 3300046457 | Bacteria | 1973 |
| 318 | Ga0495590_0135195 | 3300046457 | Bacteria | 888 |
| 319 | Ga0495641_0333147 | 3300046461 | Bacteria | 685 |
| 320 | Ga0495582_0136293 | 3300046473 | Bacteria | 1389 |
| 321 | Ga0495605_0003890 | 3300046474 | Bacteria | 8848 |
| 322 | Ga0495639_0315894 | 3300046475 | Bacteria | 781 |
| 323 | Ga0495639_0380682 | 3300046475 | Bacteria | 711 |
| 324 | Ga0495584_0165974 | 3300046491 | Bacteria | 1122 |
| 325 | Ga0495585_0111386 | 3300046492 | Bacteria | 1455 |
| 326 | Ga0495594_0100741 | 3300046499 | Bacteria | 1625 |
| 327 | Ga0495583_0150969 | 3300046506 | Bacteria | 963 |
| 328 | Ga0495606_0394503 | 3300046507 | Bacteria | 722 |
| 329 | Ga0495606_0498586 | 3300046507 | Bacteria | 615 |
| 330 | Ga0495606_0611914 | 3300046507 | Bacteria | 533 |
| 331 | Ga0495620_0064204 | 3300046515 | Bacteria | 1519 |
| 332 | Ga0495643_0111418 | 3300046522 | Bacteria | 1391 |
| 333 | Ga0495648_0031288 | 3300046524 | Bacteria | 3506 |
| 334 | Ga0495648_0260543 | 3300046524 | Bacteria | 832 |
| 335 | Ga0495665_0135727 | 3300046531 | Bacteria | 1287 |
| 336 | Ga0495609_0021812 | 3300046538 | Bacteria | 2955 |
| 337 | Ga0495622_0006990 | 3300046557 | Bacteria | 5239 |
| 338 | Ga0495622_0335033 | 3300046557 | Bacteria | 656 |
| 339 | Ga0495668_0035902 | 3300046616 | Bacteria | 2779 |
| 340 | Ga0495668_0107581 | 3300046616 | Bacteria | 1525 |
| 341 | Ga0495611_0026689 | 3300046648 | Bacteria | 2521 |
| 342 | Ga0495625_0014732 | 3300046660 | Bacteria | 6225 |
| 343 | Ga0495661_0012845 | 3300046665 | Bacteria | 5647 |
| 344 | Ga0495661_0022442 | 3300046665 | Bacteria | 4106 |
| 345 | Ga0495588_0000946 | 3300046674 | Bacteria | 12663 |
| 346 | Ga0495588_0163778 | 3300046674 | Bacteria | 1176 |
| 347 | Ga0495588_0274617 | 3300046674 | Bacteria | 888 |
| 348 | Ga0495658_0097286 | 3300046683 | Bacteria | 1752 |
| 349 | Ga0495669_0099801 | 3300046684 | Bacteria | 1348 |
| 350 | Ga0495624_0070519 | 3300046690 | Bacteria | 2176 |
| 351 | Ga0495624_0073905 | 3300046690 | Bacteria | 2119 |
| 352 | Ga0495671_0028293 | 3300046692 | Bacteria | 2890 |
| 353 | Ga0495649_0067463 | 3300046694 | Bacteria | 1919 |
| 354 | Ga0495649_0490983 | 3300046694 | Bacteria | 611 |
| 355 | Ga0495589_0026240 | 3300046794 | Bacteria | 2953 |
| 356 | Ga0495581_0278652 | 3300047315 | Bacteria | 978 |
| 357 | Ga0495672_0057823 | 3300047320 | Bacteria | 2251 |
| 358 | Ga0495676_0083376 | 3300047321 | Bacteria | 2416 |
| 359 | Ga0495676_0666296 | 3300047321 | Bacteria | 675 |
| 360 | Ga0495676_0860059 | 3300047321 | Bacteria | 582 |
| 361 | Ga0495687_056250 | 3300047443 | Bacteria | 1642 |
| 362 | Ga0495673_0097410 | 3300047469 | Bacteria | 1194 |
| 363 | Ga0495673_0117455 | 3300047469 | Bacteria | 1056 |
| 364 | Ga0496100_0010861 | 3300048903 | Bacteria | 5168 |
| 365 | Ga0496100_0106710 | 3300048903 | Bacteria | 1939 |
| 366 | Ga0496100_0256656 | 3300048903 | Bacteria | 1295 |
| 367 | Ga0496101_0045045 | 3300048904 | Bacteria | 3158 |
| 368 | Ga0496101_0965365 | 3300048904 | Bacteria | 670 |
| 369 | Ga0496102_0012305 | 3300048905 | Bacteria | 7400 |
| 370 | Ga0496102_0226680 | 3300048905 | Bacteria | 1762 |
| 371 | Ga0496102_1872494 | 3300048905 | Bacteria | 517 |
| 372 | Ga0496103_0468481 | 3300048906 | Bacteria | 807 |
| 373 | Ga0496103_0646459 | 3300048906 | Bacteria | 672 |
| 374 | Ga0496103_0895351 | 3300048906 | Bacteria | 556 |
| 375 | Ga0496104_0063170 | 3300048907 | Bacteria | 3512 |
| 376 | Ga0496104_0091388 | 3300048907 | Bacteria | 2909 |
| 377 | Ga0496104_0231971 | 3300048907 | Bacteria | 1758 |
| 378 | Ga0496104_0249393 | 3300048907 | Bacteria | 1688 |
| 379 | Ga0496105_0001482 | 3300048908 | Bacteria | 16572 |
| 380 | Ga0496106_0017502 | 3300048909 | Bacteria | 5302 |
| 381 | Ga0496106_0018930 | 3300048909 | Bacteria | 5101 |
| 382 | Ga0496106_0444368 | 3300048909 | Bacteria | 1042 |
| 383 | Ga0496106_0754828 | 3300048909 | Bacteria | 773 |
| 384 | Ga0496107_0004674 | 3300048910 | Bacteria | 9292 |
| 385 | Ga0496107_0012614 | 3300048910 | Bacteria | 5901 |
| 386 | Ga0496107_0332245 | 3300048910 | Bacteria | 1131 |
| 387 | Ga0496108_0003728 | 3300048911 | Bacteria | 12217 |
| 388 | Ga0496108_0287964 | 3300048911 | Bacteria | 1430 |
| 389 | Ga0496109_0002393 | 3300048912 | Bacteria | 15686 |
| 390 | Ga0496109_0219983 | 3300048912 | Bacteria | 1786 |
| 391 | Ga0496109_0610766 | 3300048912 | Bacteria | 1027 |
| 392 | Ga0496109_0874594 | 3300048912 | Bacteria | 836 |
| 393 | Ga0496109_1131070 | 3300048912 | Bacteria | 720 |
| 394 | Ga0496110_0015225 | 3300048913 | Bacteria | 6398 |
| 395 | Ga0496110_0396961 | 3300048913 | Bacteria | 1257 |
| 396 | Ga0496110_0435919 | 3300048913 | Bacteria | 1194 |
| 397 | Ga0496110_0610078 | 3300048913 | Bacteria | 989 |
| 398 | Ga0496110_0639741 | 3300048913 | Bacteria | 963 |
| 399 | Ga0496110_1025010 | 3300048913 | Bacteria | 733 |
| 400 | Ga0496111_0070727 | 3300048914 | Bacteria | 2539 |
| 401 | Ga0496111_0287431 | 3300048914 | Bacteria | 1219 |
| 402 | Ga0496111_0956974 | 3300048914 | Bacteria | 615 |
| 403 | Ga0496112_0019781 | 3300048915 | Bacteria | 6366 |
| 404 | Ga0496112_0126588 | 3300048915 | Bacteria | 2525 |
| 405 | Ga0496112_0460945 | 3300048915 | Bacteria | 1208 |
| 406 | Ga0496112_0747059 | 3300048915 | Bacteria | 905 |
| 407 | Ga0496112_0831677 | 3300048915 | Bacteria | 847 |
| 408 | Ga0496113_0042305 | 3300048916 | Bacteria | 3366 |
| 409 | Ga0496113_0058544 | 3300048916 | Bacteria | 2899 |
| 410 | Ga0496114_0002836 | 3300048917 | Bacteria | 13279 |
| 411 | Ga0496115_0035664 | 3300048918 | Bacteria | 3936 |
| 412 | Ga0496115_0044775 | 3300048918 | Bacteria | 3532 |
| 413 | Ga0496115_0737846 | 3300048918 | Bacteria | 771 |
| 414 | Ga0496116_0022742 | 3300048919 | Bacteria | 4689 |
| 415 | Ga0496117_0395645 | 3300048920 | Bacteria | 699 |
| 416 | Ga0496118_0014217 | 3300048921 | Bacteria | 7463 |
| 417 | Ga0496119_0016691 | 3300048922 | Bacteria | 5571 |
| 418 | Ga0496120_0137579 | 3300048923 | Bacteria | 1243 |
| 419 | Ga0496121_0004922 | 3300048924 | Bacteria | 17527 |
| 420 | Ga0496121_0019396 | 3300048924 | Bacteria | 6800 |
| 421 | Ga0496124_0346342 | 3300048927 | Bacteria | 1053 |
| 422 | Ga0496125_0006229 | 3300048928 | Bacteria | 12976 |
| 423 | Ga0496126_0024788 | 3300048929 | Bacteria | 5785 |
| 424 | Ga0495682_0132003 | 3300049460 | Bacteria | 893 |
| 425 | Ga0501031_0340827 | 3300049568 | Bacteria | 970 |
| 426 | Ga0501032_0072102 | 3300049569 | Bacteria | 2302 |
| 427 | Ga0501034_0033799 | 3300049571 | Bacteria | 5184 |
| 428 | Ga0501037_0206876 | 3300049573 | Bacteria | 1385 |
| 429 | Ga0501038_0205582 | 3300049574 | Bacteria | 1578 |
| 430 | Ga0501039_0329963 | 3300049575 | Unclassified | 1199 |
| 431 | Ga0501042_0572714 | 3300049578 | Bacteria | 821 |
| 432 | Ga0501046_0494141 | 3300049580 | Bacteria | 877 |
| 433 | Ga0501047_0120570 | 3300049581 | Bacteria | 2505 |
| 434 | Ga0501067_0092243 | 3300049583 | Bacteria | 1681 |
| 435 | Ga0501072_0179865 | 3300049588 | Bacteria | 1687 |
| 436 | Ga0501073_0887010 | 3300049589 | Unclassified | 614 |
| 437 | Ga0501074_0622171 | 3300049590 | Bacteria | 763 |
| 438 | Ga0501079_0417966 | 3300049741 | Bacteria | 1052 |
| 439 | Ga0501080_1745447 | 3300049742 | Unclassified | 524 |
| 440 | Ga0501083_0029785 | 3300049744 | Bacteria | 3751 |
| 441 | Ga0501035_0757070 | 3300049822 | Bacteria | 779 |
| 442 | Ga0501044_0329151 | 3300049823 | Bacteria | 1451 |
| 443 | nmdc:mga03683_544730_c1 | 3300050489 | Bacteria | 564 |
| 444 | nmdc:mga03n38_37300_c1 | 3300050490 | Bacteria | 2095 |
| 445 | nmdc:mga03n38_411173_c1 | 3300050490 | Bacteria | 746 |
| 446 | nmdc:mga00v17_74820_c1 | 3300050491 | Bacteria | 2105 |
| 447 | nmdc:mga0yw44_17344_c1 | 3300050492 | Bacteria | 3916 |
| 448 | nmdc:mga0k408_93730_c1 | 3300050493 | Bacteria | 1765 |
| 449 | nmdc:mga06z11_364901_c1 | 3300050494 | Bacteria | 866 |
| 450 | nmdc:mga06z11_540163_c1 | 3300050494 | Bacteria | 707 |
| 451 | nmdc:mga04h51_194524_c1 | 3300050495 | Bacteria | 794 |
| 452 | nmdc:mga04h51_50730_c1 | 3300050495 | Bacteria | 1391 |
| 453 | nmdc:mga07m45_73760_c1 | 3300050496 | Bacteria | 1943 |
| 454 | nmdc:mga07m45_808641_c1 | 3300050496 | Bacteria | 537 |
| 455 | nmdc:mga08y16_2019711_c1 | 3300050511 | Bacteria | 525 |
| 456 | nmdc:mga0sz30_22563_c1 | 3300050516 | Bacteria | 2556 |
| 457 | nmdc:mga0sz30_485543_c1 | 3300050516 | Bacteria | 555 |
| 458 | Ga0500610_0021997 | 3300053079 | Bacteria | 3138 |
| 459 | Ga0495655_0025657 | 3300053083 | Bacteria | 1381 |
| 460 | Ga0500578_0099457 | 3300053086 | Bacteria | 1842 |
| 461 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 462 | Ga0500643_128325 | 3300053087 | Bacteria | 682 |
| 463 | Ga0500583_0037379 | 3300053092 | Bacteria | 2181 |
| 464 | Ga0500583_0135540 | 3300053092 | Bacteria | 1222 |
| 465 | Ga0500651_0005130 | 3300053093 | Bacteria | 7450 |
| 466 | Ga0500641_0306351 | 3300053096 | Bacteria | 651 |
| 467 | Ga0500555_029069 | 3300053103 | Bacteria | 1572 |
| 468 | Ga0500569_000535 | 3300053109 | Bacteria | 6346 |
| 469 | Ga0500628_113493 | 3300053129 | Bacteria | 729 |
| 470 | Ga0500642_0000547 | 3300053130 | Bacteria | 11388 |
| 471 | Ga0500655_006251 | 3300053133 | Bacteria | 2146 |
| 472 | Ga0500568_0017118 | 3300053139 | Bacteria | 3206 |
| 473 | Ga0500573_0249290 | 3300053140 | Bacteria | 916 |
| 474 | Ga0500577_0159355 | 3300053142 | Bacteria | 960 |
| 475 | Ga0500577_0318578 | 3300053142 | Bacteria | 679 |
| 476 | Ga0500588_0009573 | 3300053146 | Bacteria | 2308 |
| 477 | Ga0500589_114597 | 3300053147 | Bacteria | 1151 |
| 478 | Ga0500627_0062807 | 3300053158 | Bacteria | 1636 |
| 479 | Ga0500636_0163906 | 3300053177 | Bacteria | 1209 |
| 480 | Ga0500609_002160 | 3300053731 | Bacteria | 2810 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10595743 | Ga0207678_105957431 | 59 |
| 2 | 3300017792 | Ga0163161_10780540 | Ga0163161_107805401 | 60 |
| 3 | 3300046616 | Ga0495668_0035902 | Ga0495668_0035902_1385_1591 | 60 |
| 4 | 3300005434 | Ga0070709_10004768 | Ga0070709_100047682 | 63 |
| 5 | 3300005435 | Ga0070714_100002758 | Ga0070714_10000275810 | 63 |
| 6 | 3300005436 | Ga0070713_100020112 | Ga0070713_1000201122 | 63 |
| 7 | 3300005437 | Ga0070710_10005026 | Ga0070710_100050267 | 63 |
| 8 | 3300005439 | Ga0070711_100001108 | Ga0070711_1000011081 | 63 |
| 9 | 3300006028 | Ga0070717_10016263 | Ga0070717_100162637 | 63 |
| 10 | 3300006163 | Ga0070715_10003339 | Ga0070715_100033392 | 63 |
| 11 | 3300006173 | Ga0070716_100005187 | Ga0070716_1000051872 | 63 |
| 12 | 3300006175 | Ga0070712_100022031 | Ga0070712_1000220312 | 63 |
| 13 | 3300025898 | Ga0207692_10004384 | Ga0207692_100043842 | 63 |
| 14 | 3300025905 | Ga0207685_10013466 | Ga0207685_100134662 | 63 |
| 15 | 3300025906 | Ga0207699_10001530 | Ga0207699_100015305 | 63 |
| 16 | 3300025915 | Ga0207693_10000530 | Ga0207693_100005309 | 63 |
| 17 | 3300025916 | Ga0207663_10003538 | Ga0207663_100035388 | 63 |
| 18 | 3300025928 | Ga0207700_10103692 | Ga0207700_101036922 | 63 |
| 19 | 3300025929 | Ga0207664_10095797 | Ga0207664_100957972 | 63 |
| 20 | 3300025939 | Ga0207665_10000303 | Ga0207665_1000030340 | 63 |
| 21 | iso_pu_bacteria | 2824661429 | 2824665927 | 64 |
| 22 | iso_pu_bacteria | 2508501042 | 2508692124 | 65 |
| 23 | iso_pu_bacteria | 2508501128 | 2509149209 | 65 |
| 24 | iso_pu_bacteria | 2513237094 | 2513644222 | 65 |
| 25 | iso_pu_bacteria | 2513237139 | 2513878941 | 65 |
| 26 | iso_pu_bacteria | 2513237161 | 2514009903 | 65 |
| 27 | iso_pu_bacteria | 2524023228 | 2524534018 | 65 |
| 28 | iso_pu_bacteria | 2617270735 | 2617346262 | 65 |
| 29 | iso_pu_bacteria | 2667528175 | 2671123071 | 65 |
| 30 | iso_pu_bacteria | 2728368998 | 2728753100 | 65 |
| 31 | iso_pu_bacteria | 2802429603 | 2805918201 | 65 |
| 32 | iso_pu_bacteria | 2824600985 | 2824601813 | 65 |
| 33 | iso_pu_bacteria | 2824609381 | 2824612873 | 65 |
| 34 | iso_pu_bacteria | 2824653114 | 2824653295 | 65 |
| 35 | iso_pu_bacteria | 2824671348 | 2824672139 | 65 |
| 36 | iso_pu_bacteria | 2824687955 | 2824688738 | 65 |
| 37 | iso_pu_bacteria | 2824696289 | 2824697536 | 65 |
| 38 | iso_pu_bacteria | 2824753945 | 2824756501 | 65 |
| 39 | iso_pu_bacteria | 2824763712 | 2824765995 | 65 |
| 40 | iso_pu_bacteria | 2824773399 | 2824774346 | 65 |
| 41 | iso_pu_bacteria | 2838122688 | 2838123137 | 65 |
| 42 | iso_pu_bacteria | 2841941048 | 2841948219 | 65 |
| 43 | iso_pu_bacteria | 2841949485 | 2841954346 | 65 |
| 44 | iso_pu_bacteria | 2841966195 | 2841969717 | 65 |
| 45 | iso_pu_bacteria | 2841974524 | 2841978846 | 65 |
| 46 | iso_pu_bacteria | 2841983080 | 2841984038 | 65 |
| 47 | iso_pu_bacteria | 2847939898 | 2847947234 | 65 |
| 48 | iso_pu_bacteria | 2857509624 | 2857516281 | 65 |
| 49 | iso_pu_bacteria | 2874620515 | 2874626546 | 65 |
| 50 | iso_pu_bacteria | 2876761206 | 2876762180 | 65 |
| 51 | iso_pu_bacteria | 2879099564 | 2879106306 | 65 |
| 52 | iso_pu_bacteria | 2885366525 | 2885369532 | 65 |
| 53 | iso_pu_bacteria | 2885374607 | 2885382720 | 65 |
| 54 | iso_pu_bacteria | 2885409591 | 2885417231 | 65 |
| 55 | iso_pu_bacteria | 2888419890 | 2888422414 | 65 |
| 56 | iso_pu_bacteria | 2904666416 | 2904671887 | 65 |
| 57 | iso_pu_bacteria | 2904690495 | 2904695086 | 65 |
| 58 | iso_pu_bacteria | 2904699407 | 2904704105 | 65 |
| 59 | iso_pu_bacteria | 2904711408 | 2904715274 | 65 |
| 60 | iso_pu_bacteria | 2906626472 | 2906632585 | 65 |
| 61 | iso_pu_bacteria | 2908756301 | 2908756900 | 65 |
| 62 | iso_pu_bacteria | 2922368715 | 2922376750 | 65 |
| 63 | iso_pu_bacteria | 2932784394 | 2932790285 | 65 |
| 64 | iso_pu_bacteria | 2932809354 | 2932815812 | 65 |
| 65 | iso_pu_bacteria | 2932818245 | 2932824700 | 65 |
| 66 | iso_pu_bacteria | 2932828146 | 2932833257 | 65 |
| 67 | iso_pu_bacteria | 2935616580 | 2935621468 | 65 |
| 68 | iso_pu_bacteria | 2935630451 | 2935636449 | 65 |
| 69 | iso_pu_bacteria | 2935638405 | 2935644818 | 65 |
| 70 | iso_pu_bacteria | 2935648319 | 2935655342 | 65 |
| 71 | iso_pu_bacteria | 2935656913 | 2935664222 | 65 |
| 72 | iso_pu_bacteria | 2935665750 | 2935672421 | 65 |
| 73 | iso_pu_bacteria | 2935675223 | 2935684557 | 65 |
| 74 | iso_pu_bacteria | 2935684952 | 2935693233 | 65 |
| 75 | iso_pu_bacteria | 2935694250 | 2935702861 | 65 |
| 76 | iso_pu_bacteria | 2935703347 | 2935710961 | 65 |
| 77 | iso_pu_bacteria | 2935713505 | 2935720978 | 65 |
| 78 | iso_pu_bacteria | 2935722832 | 2935730535 | 65 |
| 79 | iso_pu_bacteria | 2935732158 | 2935740700 | 65 |
| 80 | iso_pu_bacteria | 2935741537 | 2935749826 | 65 |
| 81 | iso_pu_bacteria | 2935750917 | 2935759354 | 65 |
| 82 | iso_pu_bacteria | 2935760218 | 2935767197 | 65 |
| 83 | iso_pu_bacteria | 2935801545 | 2935808910 | 65 |
| 84 | iso_pu_bacteria | 2935810662 | 2935817706 | 65 |
| 85 | iso_pu_bacteria | 2935827899 | 2935834068 | 65 |
| 86 | iso_pu_bacteria | 2935837841 | 2935845442 | 65 |
| 87 | iso_pu_bacteria | 2935855204 | 2935859339 | 65 |
| 88 | iso_pu_bacteria | 2935864058 | 2935870019 | 65 |
| 89 | iso_pu_bacteria | 2935873716 | 2935880981 | 65 |
| 90 | iso_pu_bacteria | 2935984226 | 2935989809 | 65 |
| 91 | iso_pu_bacteria | 2935992306 | 2935998245 | 65 |
| 92 | iso_pu_bacteria | 2936002035 | 2936009148 | 65 |
| 93 | iso_pu_bacteria | 2936011229 | 2936018292 | 65 |
| 94 | iso_pu_bacteria | 2936019824 | 2936026794 | 65 |
| 95 | iso_pu_bacteria | 2936028420 | 2936035675 | 65 |
| 96 | iso_pu_bacteria | 2936037263 | 2936044393 | 65 |
| 97 | iso_pu_bacteria | 2936046547 | 2936053753 | 65 |
| 98 | iso_pu_bacteria | 2936055302 | 2936062851 | 65 |
| 99 | iso_pu_bacteria | 2940556831 | 2940565120 | 65 |
| 100 | iso_pu_bacteria | 2941507105 | 2941509841 | 65 |
| 101 | iso_pu_bacteria | 2941515067 | 2941520915 | 65 |
| 102 | iso_pu_bacteria | 2941523033 | 2941525240 | 65 |
| 103 | iso_pu_bacteria | 2941538514 | 2941542954 | 65 |
| 104 | iso_pu_bacteria | 3005474847 | 3005480679 | 65 |
| 105 | iso_pu_bacteria | 3005506211 | 3005507863 | 65 |
| 106 | iso_pu_bacteria | 8006926726 | 8006929189 | 65 |
| 107 | iso_pu_bacteria | 8006933436 | 8006940090 | 65 |
| 108 | iso_pu_bacteria | 8006973647 | 8006979872 | 65 |
| 109 | iso_pu_bacteria | 8016511872 | 8016519849 | 65 |
| 110 | iso_pu_bacteria | 8016583857 | 8016589487 | 65 |
| 111 | iso_pu_bacteria | 8016603502 | 8016603922 | 65 |
| 112 | iso_pu_bacteria | 8016603502 | 8016609885 | 65 |
| 113 | iso_pu_bacteria | 8016613128 | 8016615055 | 65 |
| 114 | iso_pu_bacteria | 8016630954 | 8016639769 | 65 |
| 115 | iso_pu_bacteria | 8017057580 | 8017065692 | 65 |
| 116 | iso_pu_bacteria | 8019538911 | 8019545484 | 65 |
| 117 | iso_pu_bacteria | 8019555841 | 8019558090 | 65 |
| 118 | iso_pu_bacteria | 8019565922 | 8019567200 | 65 |
| 119 | iso_pu_bacteria | 8019576017 | 8019585120 | 65 |
| 120 | iso_pu_bacteria | 8019586578 | 8019593087 | 65 |
| 121 | iso_pu_bacteria | 8019597564 | 8019598372 | 65 |
| 122 | iso_pu_bacteria | 8019608314 | 8019610004 | 65 |
| 123 | iso_pu_bacteria | 8019619141 | 8019621311 | 65 |
| 124 | iso_pu_bacteria | 8056689827 | 8056692443 | 65 |
| 125 | 3300049568 | Ga0501031_0340827 | Ga0501031_0340827_631_834 | 66 |
| 126 | 3300049569 | Ga0501032_0072102 | Ga0501032_0072102_1201_1404 | 66 |
| 127 | 3300049571 | Ga0501034_0033799 | Ga0501034_0033799_3607_3810 | 66 |
| 128 | 3300049573 | Ga0501037_0206876 | Ga0501037_0206876_1137_1340 | 66 |
| 129 | 3300049574 | Ga0501038_0205582 | Ga0501038_0205582_502_705 | 66 |
| 130 | 3300049575 | Ga0501039_0329963 | Ga0501039_0329963_55_258 | 66 |
| 131 | 3300049578 | Ga0501042_0572714 | Ga0501042_0572714_46_249 | 66 |
| 132 | 3300049580 | Ga0501046_0494141 | Ga0501046_0494141_489_692 | 66 |
| 133 | 3300049581 | Ga0501047_0120570 | Ga0501047_0120570_1693_1896 | 66 |
| 134 | 3300049588 | Ga0501072_0179865 | Ga0501072_0179865_847_1050 | 66 |
| 135 | 3300049589 | Ga0501073_0887010 | Ga0501073_0887010_183_386 | 66 |
| 136 | 3300049590 | Ga0501074_0622171 | Ga0501074_0622171_397_600 | 66 |
| 137 | 3300049741 | Ga0501079_0417966 | Ga0501079_0417966_543_746 | 66 |
| 138 | 3300049742 | Ga0501080_1745447 | Ga0501080_1745447_76_279 | 66 |
| 139 | 3300049744 | Ga0501083_0029785 | Ga0501083_0029785_3381_3584 | 66 |
| 140 | 3300049822 | Ga0501035_0757070 | Ga0501035_0757070_26_229 | 66 |
| 141 | 3300049823 | Ga0501044_0329151 | Ga0501044_0329151_735_938 | 66 |
| 142 | 3300007788 | Ga0099795_10066505 | Ga0099795_100665052 | 67 |
| 143 | 3300009545 | Ga0105237_12554569 | Ga0105237_125545692 | 67 |
| 144 | 3300027512 | Ga0209179_1013033 | Ga0209179_10130332 | 67 |
| 145 | 3300005329 | Ga0070683_100228368 | Ga0070683_1002283682 | 68 |
| 146 | 3300005614 | Ga0068856_100295315 | Ga0068856_1002953152 | 68 |
| 147 | 3300006028 | Ga0070717_10362602 | Ga0070717_103626021 | 68 |
| 148 | 3300006175 | Ga0070712_101089239 | Ga0070712_1010892392 | 68 |
| 149 | 3300006195 | Ga0075366_10204628 | Ga0075366_102046282 | 68 |
| 150 | 3300020070 | Ga0206356_10780751 | Ga0206356_107807512 | 68 |
| 151 | 3300020075 | Ga0206349_1978123 | Ga0206349_19781232 | 68 |
| 152 | 3300020080 | Ga0206350_10017517 | Ga0206350_100175172 | 68 |
| 153 | 3300022467 | Ga0224712_10256454 | Ga0224712_102564542 | 68 |
| 154 | 3300025915 | Ga0207693_11013965 | Ga0207693_110139652 | 68 |
| 155 | 3300025928 | Ga0207700_11156914 | Ga0207700_111569142 | 68 |
| 156 | 3300048903 | Ga0496100_0106710 | Ga0496100_0106710_1312_1518 | 68 |
| 157 | 3300048907 | Ga0496104_0249393 | Ga0496104_0249393_678_884 | 68 |
| 158 | 3300048909 | Ga0496106_0018930 | Ga0496106_0018930_2096_2302 | 68 |
| 159 | 3300048910 | Ga0496107_0012614 | Ga0496107_0012614_4831_5037 | 68 |
| 160 | 3300048911 | Ga0496108_0003728 | Ga0496108_0003728_9592_9798 | 68 |
| 161 | 3300048912 | Ga0496109_0002393 | Ga0496109_0002393_10319_10525 | 68 |
| 162 | 3300048913 | Ga0496110_0015225 | Ga0496110_0015225_1367_1573 | 68 |
| 163 | 3300048914 | Ga0496111_0956974 | Ga0496111_0956974_347_553 | 68 |
| 164 | 3300048915 | Ga0496112_0126588 | Ga0496112_0126588_2230_2436 | 68 |
| 165 | 3300048918 | Ga0496115_0737846 | Ga0496115_0737846_466_672 | 68 |
| 166 | 3300001991 | JGI24743J22301_10124885 | JGI24743J22301_101248852 | 69 |
| 167 | 3300003203 | JGI25406J46586_10001448 | JGI25406J46586_100014489 | 69 |
| 168 | 3300003203 | JGI25406J46586_10002592 | JGI25406J46586_100025923 | 69 |
| 169 | 3300003215 | JGI25153J46596_10000150 | JGI25153J46596_1000015040 | 69 |
| 170 | 3300003320 | rootH2_10140195 | rootH2_101401957 | 69 |
| 171 | 3300003320 | rootH2_10252760 | rootH2_102527601 | 69 |
| 172 | 3300003323 | rootH1_10047327 | rootH1_1004732712 | 69 |
| 173 | 3300003323 | rootH1_10171602 | rootH1_101716022 | 69 |
| 174 | 3300003354 | JGI25160J50197_1000263 | JGI25160J50197_10002638 | 69 |
| 175 | 3300003659 | JGI25404J52841_10063211 | JGI25404J52841_100632112 | 69 |
| 176 | 3300003911 | JGI25405J52794_10097643 | JGI25405J52794_100976432 | 69 |
| 177 | 3300005262 | Ga0065165_1065383 | Ga0065165_10653831 | 69 |
| 178 | 3300005330 | Ga0070690_101718218 | Ga0070690_1017182181 | 69 |
| 179 | 3300005331 | Ga0070670_101111158 | Ga0070670_1011111582 | 69 |
| 180 | 3300005331 | Ga0070670_101854210 | Ga0070670_1018542102 | 69 |
| 181 | 3300005334 | Ga0068869_100348986 | Ga0068869_1003489861 | 69 |
| 182 | 3300005335 | Ga0070666_10955083 | Ga0070666_109550831 | 69 |
| 183 | 3300005336 | Ga0070680_100120184 | Ga0070680_1001201842 | 69 |
| 184 | 3300005336 | Ga0070680_100410588 | Ga0070680_1004105882 | 69 |
| 185 | 3300005337 | Ga0070682_100585439 | Ga0070682_1005854392 | 69 |
| 186 | 3300005338 | Ga0068868_100691556 | Ga0068868_1006915562 | 69 |
| 187 | 3300005339 | Ga0070660_100046703 | Ga0070660_1000467033 | 69 |
| 188 | 3300005341 | Ga0070691_10286465 | Ga0070691_102864652 | 69 |
| 189 | 3300005344 | Ga0070661_100455196 | Ga0070661_1004551962 | 69 |
| 190 | 3300005347 | Ga0070668_100002573 | Ga0070668_1000025733 | 69 |
| 191 | 3300005353 | Ga0070669_100889198 | Ga0070669_1008891981 | 69 |
| 192 | 3300005355 | Ga0070671_100641721 | Ga0070671_1006417211 | 69 |
| 193 | 3300005364 | Ga0070673_101147970 | Ga0070673_1011479701 | 69 |
| 194 | 3300005366 | Ga0070659_100539428 | Ga0070659_1005394281 | 69 |
| 195 | 3300005367 | Ga0070667_101962776 | Ga0070667_1019627761 | 69 |
| 196 | 3300005435 | Ga0070714_101149522 | Ga0070714_1011495222 | 69 |
| 197 | 3300005435 | Ga0070714_101646110 | Ga0070714_1016461102 | 69 |
| 198 | 3300005435 | Ga0070714_101811643 | Ga0070714_1018116432 | 69 |
| 199 | 3300005436 | Ga0070713_100973780 | Ga0070713_1009737801 | 69 |
| 200 | 3300005437 | Ga0070710_10888046 | Ga0070710_108880462 | 69 |
| 201 | 3300005445 | Ga0070708_100004944 | Ga0070708_1000049446 | 69 |
| 202 | 3300005455 | Ga0070663_100001426 | Ga0070663_10000142610 | 69 |
| 203 | 3300005456 | Ga0070678_100595095 | Ga0070678_1005950951 | 69 |
| 204 | 3300005457 | Ga0070662_100162812 | Ga0070662_1001628122 | 69 |
| 205 | 3300005458 | Ga0070681_10007849 | Ga0070681_100078498 | 69 |
| 206 | 3300005459 | Ga0068867_100338934 | Ga0068867_1003389342 | 69 |
| 207 | 3300005466 | Ga0070685_10958923 | Ga0070685_109589232 | 69 |
| 208 | 3300005467 | Ga0070706_100193718 | Ga0070706_1001937182 | 69 |
| 209 | 3300005467 | Ga0070706_100684167 | Ga0070706_1006841672 | 69 |
| 210 | 3300005468 | Ga0070707_100234541 | Ga0070707_1002345412 | 69 |
| 211 | 3300005530 | Ga0070679_100006857 | Ga0070679_1000068576 | 69 |
| 212 | 3300005530 | Ga0070679_100130053 | Ga0070679_1001300532 | 69 |
| 213 | 3300005530 | Ga0070679_100751666 | Ga0070679_1007516661 | 69 |
| 214 | 3300005536 | Ga0070697_100488533 | Ga0070697_1004885332 | 69 |
| 215 | 3300005539 | Ga0068853_101600624 | Ga0068853_1016006242 | 69 |
| 216 | 3300005544 | Ga0070686_101650096 | Ga0070686_1016500961 | 69 |
| 217 | 3300005548 | Ga0070665_100062323 | Ga0070665_1000623232 | 69 |
| 218 | 3300005548 | Ga0070665_101737716 | Ga0070665_1017377162 | 69 |
| 219 | 3300005563 | Ga0068855_100017923 | Ga0068855_1000179232 | 69 |
| 220 | 3300005563 | Ga0068855_100181294 | Ga0068855_1001812942 | 69 |
| 221 | 3300005563 | Ga0068855_100879491 | Ga0068855_1008794911 | 69 |
| 222 | 3300005563 | Ga0068855_101744043 | Ga0068855_1017440432 | 69 |
| 223 | 3300005564 | Ga0070664_100384936 | Ga0070664_1003849362 | 69 |
| 224 | 3300005577 | Ga0068857_100078487 | Ga0068857_1000784872 | 69 |
| 225 | 3300005577 | Ga0068857_100212474 | Ga0068857_1002124742 | 69 |
| 226 | 3300005578 | Ga0068854_100111487 | Ga0068854_1001114872 | 69 |
| 227 | 3300005614 | Ga0068856_101940140 | Ga0068856_1019401402 | 69 |
| 228 | 3300005614 | Ga0068856_102083544 | Ga0068856_1020835441 | 69 |
| 229 | 3300005615 | Ga0070702_100553845 | Ga0070702_1005538452 | 69 |
| 230 | 3300005616 | Ga0068852_100029734 | Ga0068852_1000297344 | 69 |
| 231 | 3300005616 | Ga0068852_100223132 | Ga0068852_1002231322 | 69 |
| 232 | 3300005616 | Ga0068852_100382998 | Ga0068852_1003829982 | 69 |
| 233 | 3300005617 | Ga0068859_100874700 | Ga0068859_1008747002 | 69 |
| 234 | 3300005618 | Ga0068864_100149875 | Ga0068864_1001498752 | 69 |
| 235 | 3300005618 | Ga0068864_101479982 | Ga0068864_1014799822 | 69 |
| 236 | 3300005718 | Ga0068866_10160847 | Ga0068866_101608472 | 69 |
| 237 | 3300005719 | Ga0068861_102188441 | Ga0068861_1021884411 | 69 |
| 238 | 3300005834 | Ga0068851_10446412 | Ga0068851_104464122 | 69 |
| 239 | 3300005834 | Ga0068851_10900062 | Ga0068851_109000622 | 69 |
| 240 | 3300005841 | Ga0068863_100445697 | Ga0068863_1004456972 | 69 |
| 241 | 3300005842 | Ga0068858_100033991 | Ga0068858_1000339913 | 69 |
| 242 | 3300005843 | Ga0068860_101574587 | Ga0068860_1015745872 | 69 |
| 243 | 3300005844 | Ga0068862_100052949 | Ga0068862_1000529492 | 69 |
| 244 | 3300005937 | Ga0081455_10026211 | Ga0081455_100262111 | 69 |
| 245 | 3300005983 | Ga0081540_1299850 | Ga0081540_12998502 | 69 |
| 246 | 3300005985 | Ga0081539_10000152 | Ga0081539_100001525 | 69 |
| 247 | 3300005985 | Ga0081539_10176064 | Ga0081539_101760642 | 69 |
| 248 | 3300006028 | Ga0070717_10673073 | Ga0070717_106730732 | 69 |
| 249 | 3300006028 | Ga0070717_10895771 | Ga0070717_108957712 | 69 |
| 250 | 3300006028 | Ga0070717_11180009 | Ga0070717_111800091 | 69 |
| 251 | 3300006028 | Ga0070717_11380940 | Ga0070717_113809402 | 69 |
| 252 | 3300006038 | Ga0075365_10042359 | Ga0075365_100423592 | 69 |
| 253 | 3300006038 | Ga0075365_10863101 | Ga0075365_108631012 | 69 |
| 254 | 3300006042 | Ga0075368_10209608 | Ga0075368_102096082 | 69 |
| 255 | 3300006042 | Ga0075368_10373760 | Ga0075368_103737602 | 69 |
| 256 | 3300006048 | Ga0075363_100167314 | Ga0075363_1001673142 | 69 |
| 257 | 3300006051 | Ga0075364_10166860 | Ga0075364_101668602 | 69 |
| 258 | 3300006173 | Ga0070716_100326945 | Ga0070716_1003269451 | 69 |
| 259 | 3300006175 | Ga0070712_100519561 | Ga0070712_1005195612 | 69 |
| 260 | 3300006177 | Ga0075362_10372515 | Ga0075362_103725152 | 69 |
| 261 | 3300006178 | Ga0075367_10266434 | Ga0075367_102664342 | 69 |
| 262 | 3300006178 | Ga0075367_10547323 | Ga0075367_105473231 | 69 |
| 263 | 3300006178 | Ga0075367_10794230 | Ga0075367_107942302 | 69 |
| 264 | 3300006186 | Ga0075369_10018923 | Ga0075369_100189234 | 69 |
| 265 | 3300006195 | Ga0075366_10250057 | Ga0075366_102500572 | 69 |
| 266 | 3300006353 | Ga0075370_10158303 | Ga0075370_101583032 | 69 |
| 267 | 3300006881 | Ga0068865_100762691 | Ga0068865_1007626912 | 69 |
| 268 | 3300006931 | Ga0097620_100874782 | Ga0097620_1008747822 | 69 |
| 269 | 3300009011 | Ga0105251_10346225 | Ga0105251_103462251 | 69 |
| 270 | 3300009093 | Ga0105240_10137257 | Ga0105240_101372575 | 69 |
| 271 | 3300009093 | Ga0105240_10780411 | Ga0105240_107804112 | 69 |
| 272 | 3300009093 | Ga0105240_11971844 | Ga0105240_119718441 | 69 |
| 273 | 3300009101 | Ga0105247_10014736 | Ga0105247_100147363 | 69 |
| 274 | 3300009148 | Ga0105243_10217175 | Ga0105243_102171752 | 69 |
| 275 | 3300009177 | Ga0105248_10011911 | Ga0105248_100119114 | 69 |
| 276 | 3300009545 | Ga0105237_10207278 | Ga0105237_102072782 | 69 |
| 277 | 3300009545 | Ga0105237_10549275 | Ga0105237_105492752 | 69 |
| 278 | 3300009551 | Ga0105238_10030817 | Ga0105238_100308178 | 69 |
| 279 | 3300009551 | Ga0105238_10045500 | Ga0105238_100455002 | 69 |
| 280 | 3300009551 | Ga0105238_10114560 | Ga0105238_101145602 | 69 |
| 281 | 3300009551 | Ga0105238_11339466 | Ga0105238_113394662 | 69 |
| 282 | 3300009551 | Ga0105238_11640681 | Ga0105238_116406812 | 69 |
| 283 | 3300009553 | Ga0105249_10570341 | Ga0105249_105703412 | 69 |
| 284 | 3300009553 | Ga0105249_12497191 | Ga0105249_124971912 | 69 |
| 285 | 3300010375 | Ga0105239_10021516 | Ga0105239_100215167 | 69 |
| 286 | 3300010375 | Ga0105239_10061173 | Ga0105239_100611735 | 69 |
| 287 | 3300010375 | Ga0105239_10129087 | Ga0105239_101290873 | 69 |
| 288 | 3300011119 | Ga0105246_10686128 | Ga0105246_106861282 | 69 |
| 289 | 3300013104 | Ga0157370_10055762 | Ga0157370_100557622 | 69 |
| 290 | 3300013104 | Ga0157370_11368820 | Ga0157370_113688202 | 69 |
| 291 | 3300013105 | Ga0157369_10004181 | Ga0157369_1000418112 | 69 |
| 292 | 3300013105 | Ga0157369_10018445 | Ga0157369_100184458 | 69 |
| 293 | 3300013105 | Ga0157369_11044759 | Ga0157369_110447592 | 69 |
| 294 | 3300013296 | Ga0157374_10657187 | Ga0157374_106571872 | 69 |
| 295 | 3300013306 | Ga0163162_10106039 | Ga0163162_101060392 | 69 |
| 296 | 3300013306 | Ga0163162_12543836 | Ga0163162_125438362 | 69 |
| 297 | 3300013307 | Ga0157372_10021185 | Ga0157372_100211855 | 69 |
| 298 | 3300013307 | Ga0157372_10479428 | Ga0157372_104794282 | 69 |
| 299 | 3300013307 | Ga0157372_11083868 | Ga0157372_110838682 | 69 |
| 300 | 3300013307 | Ga0157372_11547546 | Ga0157372_115475462 | 69 |
| 301 | 3300013308 | Ga0157375_10017407 | Ga0157375_100174072 | 69 |
| 302 | 3300013308 | Ga0157375_12004604 | Ga0157375_120046042 | 69 |
| 303 | 3300014325 | Ga0163163_10043019 | Ga0163163_100430192 | 69 |
| 304 | 3300014325 | Ga0163163_11141993 | Ga0163163_111419932 | 69 |
| 305 | 3300014325 | Ga0163163_11567454 | Ga0163163_115674542 | 69 |
| 306 | 3300014969 | Ga0157376_10795677 | Ga0157376_107956772 | 69 |
| 307 | 3300014969 | Ga0157376_12163952 | Ga0157376_121639521 | 69 |
| 308 | 3300017792 | Ga0163161_12020324 | Ga0163161_120203241 | 69 |
| 309 | 3300020069 | Ga0197907_10163776 | Ga0197907_101637762 | 69 |
| 310 | 3300020069 | Ga0197907_10472093 | Ga0197907_104720931 | 69 |
| 311 | 3300020070 | Ga0206356_10800525 | Ga0206356_108005252 | 69 |
| 312 | 3300020070 | Ga0206356_11700925 | Ga0206356_117009252 | 69 |
| 313 | 3300020075 | Ga0206349_1319226 | Ga0206349_13192262 | 69 |
| 314 | 3300020076 | Ga0206355_1376153 | Ga0206355_13761531 | 69 |
| 315 | 3300020078 | Ga0206352_10458138 | Ga0206352_104581382 | 69 |
| 316 | 3300020078 | Ga0206352_10698535 | Ga0206352_106985352 | 69 |
| 317 | 3300020080 | Ga0206350_11177457 | Ga0206350_111774572 | 69 |
| 318 | 3300020081 | Ga0206354_11212721 | Ga0206354_112127212 | 69 |
| 319 | 3300020082 | Ga0206353_10636173 | Ga0206353_106361733 | 69 |
| 320 | 3300022467 | Ga0224712_10000894 | Ga0224712_100008946 | 69 |
| 321 | 3300025273 | Ga0209673_1075328 | Ga0209673_10753282 | 69 |
| 322 | 3300025297 | Ga0209758_1000068 | Ga0209758_1000068251 | 69 |
| 323 | 3300025297 | Ga0209758_1040581 | Ga0209758_10405812 | 69 |
| 324 | 3300025302 | Ga0207426_1000225 | Ga0207426_1000225109 | 69 |
| 325 | 3300025302 | Ga0207426_1006770 | Ga0207426_10067702 | 69 |
| 326 | 3300025900 | Ga0207710_10007151 | Ga0207710_100071513 | 69 |
| 327 | 3300025903 | Ga0207680_11100461 | Ga0207680_111004612 | 69 |
| 328 | 3300025904 | Ga0207647_10068610 | Ga0207647_100686102 | 69 |
| 329 | 3300025905 | Ga0207685_10770592 | Ga0207685_107705922 | 69 |
| 330 | 3300025906 | Ga0207699_10581145 | Ga0207699_105811452 | 69 |
| 331 | 3300025910 | Ga0207684_10207310 | Ga0207684_102073103 | 69 |
| 332 | 3300025910 | Ga0207684_10239614 | Ga0207684_102396142 | 69 |
| 333 | 3300025910 | Ga0207684_11273478 | Ga0207684_112734782 | 69 |
| 334 | 3300025912 | Ga0207707_10000134 | Ga0207707_1000013451 | 69 |
| 335 | 3300025914 | Ga0207671_10191725 | Ga0207671_101917252 | 69 |
| 336 | 3300025914 | Ga0207671_10347202 | Ga0207671_103472022 | 69 |
| 337 | 3300025915 | Ga0207693_10013599 | Ga0207693_100135998 | 69 |
| 338 | 3300025915 | Ga0207693_10071494 | Ga0207693_100714942 | 69 |
| 339 | 3300025915 | Ga0207693_10652410 | Ga0207693_106524102 | 69 |
| 340 | 3300025917 | Ga0207660_10166460 | Ga0207660_101664602 | 69 |
| 341 | 3300025917 | Ga0207660_11557892 | Ga0207660_115578921 | 69 |
| 342 | 3300025919 | Ga0207657_10105699 | Ga0207657_101056992 | 69 |
| 343 | 3300025919 | Ga0207657_10309769 | Ga0207657_103097692 | 69 |
| 344 | 3300025920 | Ga0207649_10414366 | Ga0207649_104143662 | 69 |
| 345 | 3300025921 | Ga0207652_10022055 | Ga0207652_100220554 | 69 |
| 346 | 3300025921 | Ga0207652_11129822 | Ga0207652_111298222 | 69 |
| 347 | 3300025922 | Ga0207646_10580805 | Ga0207646_105808052 | 69 |
| 348 | 3300025923 | Ga0207681_10804257 | Ga0207681_108042572 | 69 |
| 349 | 3300025924 | Ga0207694_10031190 | Ga0207694_100311902 | 69 |
| 350 | 3300025924 | Ga0207694_10067266 | Ga0207694_100672662 | 69 |
| 351 | 3300025924 | Ga0207694_10648471 | Ga0207694_106484712 | 69 |
| 352 | 3300025924 | Ga0207694_11221237 | Ga0207694_112212372 | 69 |
| 353 | 3300025925 | Ga0207650_11589894 | Ga0207650_115898941 | 69 |
| 354 | 3300025928 | Ga0207700_10048624 | Ga0207700_100486241 | 69 |
| 355 | 3300025929 | Ga0207664_10852454 | Ga0207664_108524542 | 69 |
| 356 | 3300025931 | Ga0207644_10444586 | Ga0207644_104445862 | 69 |
| 357 | 3300025931 | Ga0207644_10508964 | Ga0207644_105089642 | 69 |
| 358 | 3300025932 | Ga0207690_10182546 | Ga0207690_101825461 | 69 |
| 359 | 3300025932 | Ga0207690_10669450 | Ga0207690_106694502 | 69 |
| 360 | 3300025933 | Ga0207706_10182464 | Ga0207706_101824642 | 69 |
| 361 | 3300025935 | Ga0207709_10032165 | Ga0207709_100321652 | 69 |
| 362 | 3300025935 | Ga0207709_10326953 | Ga0207709_103269532 | 69 |
| 363 | 3300025939 | Ga0207665_10121850 | Ga0207665_101218502 | 69 |
| 364 | 3300025939 | Ga0207665_10712310 | Ga0207665_107123102 | 69 |
| 365 | 3300025941 | Ga0207711_10075068 | Ga0207711_100750682 | 69 |
| 366 | 3300025941 | Ga0207711_10350808 | Ga0207711_103508082 | 69 |
| 367 | 3300025945 | Ga0207679_10888331 | Ga0207679_108883311 | 69 |
| 368 | 3300025949 | Ga0207667_10033358 | Ga0207667_100333585 | 69 |
| 369 | 3300025949 | Ga0207667_10141176 | Ga0207667_101411762 | 69 |
| 370 | 3300025949 | Ga0207667_10283726 | Ga0207667_102837262 | 69 |
| 371 | 3300025949 | Ga0207667_10437219 | Ga0207667_104372191 | 69 |
| 372 | 3300025972 | Ga0207668_10085255 | Ga0207668_100852552 | 69 |
| 373 | 3300025981 | Ga0207640_10260203 | Ga0207640_102602032 | 69 |
| 374 | 3300026023 | Ga0207677_10017946 | Ga0207677_100179462 | 69 |
| 375 | 3300026035 | Ga0207703_10082195 | Ga0207703_100821952 | 69 |
| 376 | 3300026041 | Ga0207639_11750764 | Ga0207639_117507642 | 69 |
| 377 | 3300026067 | Ga0207678_10002844 | Ga0207678_1000284410 | 69 |
| 378 | 3300026067 | Ga0207678_10271544 | Ga0207678_102715442 | 69 |
| 379 | 3300026078 | Ga0207702_10079278 | Ga0207702_100792785 | 69 |
| 380 | 3300026078 | Ga0207702_10459032 | Ga0207702_104590322 | 69 |
| 381 | 3300026078 | Ga0207702_11221814 | Ga0207702_112218142 | 69 |
| 382 | 3300026088 | Ga0207641_10053726 | Ga0207641_100537262 | 69 |
| 383 | 3300026089 | Ga0207648_10070850 | Ga0207648_100708504 | 69 |
| 384 | 3300026095 | Ga0207676_10087430 | Ga0207676_100874302 | 69 |
| 385 | 3300026095 | Ga0207676_10526661 | Ga0207676_105266612 | 69 |
| 386 | 3300026116 | Ga0207674_10227399 | Ga0207674_102273992 | 69 |
| 387 | 3300026116 | Ga0207674_10633954 | Ga0207674_106339541 | 69 |
| 388 | 3300026116 | Ga0207674_10813840 | Ga0207674_108138402 | 69 |
| 389 | 3300026118 | Ga0207675_101895644 | Ga0207675_1018956441 | 69 |
| 390 | 3300026121 | Ga0207683_10620132 | Ga0207683_106201321 | 69 |
| 391 | 3300026121 | Ga0207683_10623826 | Ga0207683_106238262 | 69 |
| 392 | 3300026142 | Ga0207698_10052519 | Ga0207698_100525192 | 69 |
| 393 | 3300026142 | Ga0207698_10195571 | Ga0207698_101955712 | 69 |
| 394 | 3300026142 | Ga0207698_10285834 | Ga0207698_102858342 | 69 |
| 395 | 3300027866 | Ga0209813_10050884 | Ga0209813_100508842 | 69 |
| 396 | 3300028379 | Ga0268266_10223372 | Ga0268266_102233722 | 69 |
| 397 | 3300028380 | Ga0268265_10078479 | Ga0268265_100784792 | 69 |
| 398 | 3300028381 | Ga0268264_10806750 | Ga0268264_108067502 | 69 |
| 399 | 3300028786 | Ga0307517_10149689 | Ga0307517_101496892 | 69 |
| 400 | 3300031507 | Ga0307509_10017608 | Ga0307509_100176089 | 69 |
| 401 | 3300031730 | Ga0307516_10003424 | Ga0307516_1000342412 | 69 |
| 402 | 3300031730 | Ga0307516_10016618 | Ga0307516_100166186 | 69 |
| 403 | 3300031901 | Ga0307406_10613612 | Ga0307406_106136122 | 69 |
| 404 | 3300031911 | Ga0307412_11766687 | Ga0307412_117666872 | 69 |
| 405 | 3300035112 | Ga0373932_0453784 | Ga0373932_0453784_26_235 | 69 |
| 406 | 3300035118 | Ga0373954_0086410 | Ga0373954_0086410_965_1174 | 69 |
| 407 | 3300035170 | Ga0373943_0060355 | Ga0373943_0060355_140_349 | 69 |
| 408 | 3300035171 | Ga0373946_0055274 | Ga0373946_0055274_327_536 | 69 |
| 409 | 3300035172 | Ga0373955_0273129 | Ga0373955_0273129_780_989 | 69 |
| 410 | 3300035691 | Ga0373931_0710470 | Ga0373931_0710470_41_250 | 69 |
| 411 | 3300035695 | Ga0373927_0021587 | Ga0373927_0021587_636_845 | 69 |
| 412 | 3300035695 | Ga0373927_0127956 | Ga0373927_0127956_772_981 | 69 |
| 413 | 3300035695 | Ga0373927_0144220 | Ga0373927_0144220_1308_1517 | 69 |
| 414 | 3300035724 | Ga0373933_0034068 | Ga0373933_0034068_386_595 | 69 |
| 415 | 3300035725 | Ga0373947_0048103 | Ga0373947_0048103_686_895 | 69 |
| 416 | 3300037312 | Ga0395899_0252448 | Ga0395899_0252448_63_272 | 69 |
| 417 | 3300037418 | Ga0395900_0321615 | Ga0395900_0321615_141_350 | 69 |
| 418 | 3300037418 | Ga0395900_0815938 | Ga0395900_0815938_314_523 | 69 |
| 419 | 3300037418 | Ga0395900_1248050 | Ga0395900_1248050_218_427 | 69 |
| 420 | 3300037418 | Ga0395900_1483805 | Ga0395900_1483805_50_259 | 69 |
| 421 | 3300037466 | Ga0395898_1116905 | Ga0395898_1116905_449_658 | 69 |
| 422 | 3300037466 | Ga0395898_1301696 | Ga0395898_1301696_86_295 | 69 |
| 423 | 3300037471 | Ga0395905_0002655 | Ga0395905_0002655_19382_19600 | 69 |
| 424 | 3300037471 | Ga0395905_0050668 | Ga0395905_0050668_3017_3226 | 69 |
| 425 | 3300037471 | Ga0395905_0780402 | Ga0395905_0780402_584_793 | 69 |
| 426 | 3300038443 | Ga0395901_0010810 | Ga0395901_0010810_6396_6605 | 69 |
| 427 | 3300038443 | Ga0395901_0092561 | Ga0395901_0092561_683_892 | 69 |
| 428 | 3300038443 | Ga0395901_0127726 | Ga0395901_0127726_112_321 | 69 |
| 429 | 3300038443 | Ga0395901_0254431 | Ga0395901_0254431_64_282 | 69 |
| 430 | 3300039450 | Ga0436363_0946225 | Ga0436363_0946225_13244_13453 | 69 |
| 431 | 3300042012 | Ga0439455_0154048 | Ga0439455_0154048_45_254 | 69 |
| 432 | 3300044658 | Ga0466972_0000284 | Ga0466972_0000284_24469_24678 | 69 |
| 433 | 3300044683 | Ga0466965_0006730 | Ga0466965_0006730_4855_5064 | 69 |
| 434 | 3300044683 | Ga0466965_0198664 | Ga0466965_0198664_799_1008 | 69 |
| 435 | 3300044684 | Ga0466966_0441832 | Ga0466966_0441832_354_563 | 69 |
| 436 | 3300044693 | Ga0466961_0571994 | Ga0466961_0571994_359_568 | 69 |
| 437 | 3300044694 | Ga0466963_0037578 | Ga0466963_0037578_1164_1373 | 69 |
| 438 | 3300044706 | Ga0466964_0404675 | Ga0466964_0404675_59_268 | 69 |
| 439 | 3300044765 | Ga0466970_0025353 | Ga0466970_0025353_551_760 | 69 |
| 440 | 3300044765 | Ga0466970_0336669 | Ga0466970_0336669_426_635 | 69 |
| 441 | 3300044901 | Ga0466960_0126982 | Ga0466960_0126982_599_808 | 69 |
| 442 | 3300044901 | Ga0466960_0239766 | Ga0466960_0239766_623_832 | 69 |
| 443 | 3300044901 | Ga0466960_0655024 | Ga0466960_0655024_23_232 | 69 |
| 444 | 3300045976 | Ga0466967_0262810 | Ga0466967_0262810_777_986 | 69 |
| 445 | 3300046455 | Ga0495603_0040775 | Ga0495603_0040775_349_558 | 69 |
| 446 | 3300046455 | Ga0495603_0046034 | Ga0495603_0046034_2000_2209 | 69 |
| 447 | 3300046455 | Ga0495603_0051083 | Ga0495603_0051083_802_1011 | 69 |
| 448 | 3300046457 | Ga0495590_0028100 | Ga0495590_0028100_479_688 | 69 |
| 449 | 3300046457 | Ga0495590_0135195 | Ga0495590_0135195_167_376 | 69 |
| 450 | 3300046461 | Ga0495641_0333147 | Ga0495641_0333147_298_507 | 69 |
| 451 | 3300046473 | Ga0495582_0136293 | Ga0495582_0136293_257_466 | 69 |
| 452 | 3300046474 | Ga0495605_0003890 | Ga0495605_0003890_5000_5209 | 69 |
| 453 | 3300046475 | Ga0495639_0315894 | Ga0495639_0315894_244_453 | 69 |
| 454 | 3300046475 | Ga0495639_0380682 | Ga0495639_0380682_105_314 | 69 |
| 455 | 3300046491 | Ga0495584_0165974 | Ga0495584_0165974_769_978 | 69 |
| 456 | 3300046492 | Ga0495585_0111386 | Ga0495585_0111386_178_387 | 69 |
| 457 | 3300046499 | Ga0495594_0100741 | Ga0495594_0100741_766_975 | 69 |
| 458 | 3300046506 | Ga0495583_0150969 | Ga0495583_0150969_652_861 | 69 |
| 459 | 3300046507 | Ga0495606_0394503 | Ga0495606_0394503_214_423 | 69 |
| 460 | 3300046507 | Ga0495606_0498586 | Ga0495606_0498586_387_596 | 69 |
| 461 | 3300046507 | Ga0495606_0611914 | Ga0495606_0611914_107_316 | 69 |
| 462 | 3300046515 | Ga0495620_0064204 | Ga0495620_0064204_277_486 | 69 |
| 463 | 3300046522 | Ga0495643_0111418 | Ga0495643_0111418_453_662 | 69 |
| 464 | 3300046524 | Ga0495648_0031288 | Ga0495648_0031288_3002_3211 | 69 |
| 465 | 3300046524 | Ga0495648_0260543 | Ga0495648_0260543_232_450 | 69 |
| 466 | 3300046531 | Ga0495665_0135727 | Ga0495665_0135727_319_528 | 69 |
| 467 | 3300046538 | Ga0495609_0021812 | Ga0495609_0021812_1147_1356 | 69 |
| 468 | 3300046557 | Ga0495622_0006990 | Ga0495622_0006990_3611_3820 | 69 |
| 469 | 3300046557 | Ga0495622_0335033 | Ga0495622_0335033_13_222 | 69 |
| 470 | 3300046616 | Ga0495668_0107581 | Ga0495668_0107581_330_539 | 69 |
| 471 | 3300046648 | Ga0495611_0026689 | Ga0495611_0026689_123_332 | 69 |
| 472 | 3300046660 | Ga0495625_0014732 | Ga0495625_0014732_5440_5649 | 69 |
| 473 | 3300046665 | Ga0495661_0012845 | Ga0495661_0012845_2354_2563 | 69 |
| 474 | 3300046665 | Ga0495661_0022442 | Ga0495661_0022442_967_1176 | 69 |
| 475 | 3300046674 | Ga0495588_0000946 | Ga0495588_0000946_5189_5398 | 69 |
| 476 | 3300046674 | Ga0495588_0163778 | Ga0495588_0163778_517_726 | 69 |
| 477 | 3300046674 | Ga0495588_0274617 | Ga0495588_0274617_107_316 | 69 |
| 478 | 3300046683 | Ga0495658_0097286 | Ga0495658_0097286_222_431 | 69 |
| 479 | 3300046684 | Ga0495669_0099801 | Ga0495669_0099801_445_654 | 69 |
| 480 | 3300046690 | Ga0495624_0070519 | Ga0495624_0070519_744_953 | 69 |
| 481 | 3300046690 | Ga0495624_0073905 | Ga0495624_0073905_1786_1995 | 69 |
| 482 | 3300046692 | Ga0495671_0028293 | Ga0495671_0028293_2423_2632 | 69 |
| 483 | 3300046694 | Ga0495649_0067463 | Ga0495649_0067463_179_388 | 69 |
| 484 | 3300046694 | Ga0495649_0490983 | Ga0495649_0490983_249_467 | 69 |
| 485 | 3300046794 | Ga0495589_0026240 | Ga0495589_0026240_2205_2414 | 69 |
| 486 | 3300047315 | Ga0495581_0278652 | Ga0495581_0278652_282_491 | 69 |
| 487 | 3300047320 | Ga0495672_0057823 | Ga0495672_0057823_1815_2024 | 69 |
| 488 | 3300047321 | Ga0495676_0083376 | Ga0495676_0083376_220_429 | 69 |
| 489 | 3300047321 | Ga0495676_0666296 | Ga0495676_0666296_299_508 | 69 |
| 490 | 3300047321 | Ga0495676_0860059 | Ga0495676_0860059_63_272 | 69 |
| 491 | 3300047443 | Ga0495687_056250 | Ga0495687_056250_357_575 | 69 |
| 492 | 3300047469 | Ga0495673_0097410 | Ga0495673_0097410_396_614 | 69 |
| 493 | 3300047469 | Ga0495673_0117455 | Ga0495673_0117455_235_444 | 69 |
| 494 | 3300048903 | Ga0496100_0010861 | Ga0496100_0010861_1173_1382 | 69 |
| 495 | 3300048903 | Ga0496100_0256656 | Ga0496100_0256656_690_899 | 69 |
| 496 | 3300048904 | Ga0496101_0045045 | Ga0496101_0045045_675_884 | 69 |
| 497 | 3300048904 | Ga0496101_0965365 | Ga0496101_0965365_338_553 | 69 |
| 498 | 3300048905 | Ga0496102_0012305 | Ga0496102_0012305_2207_2416 | 69 |
| 499 | 3300048905 | Ga0496102_0226680 | Ga0496102_0226680_50_259 | 69 |
| 500 | 3300048905 | Ga0496102_1872494 | Ga0496102_1872494_91_300 | 69 |
| 501 | 3300048906 | Ga0496103_0468481 | Ga0496103_0468481_488_697 | 69 |
| 502 | 3300048906 | Ga0496103_0646459 | Ga0496103_0646459_185_394 | 69 |
| 503 | 3300048906 | Ga0496103_0895351 | Ga0496103_0895351_289_498 | 69 |
| 504 | 3300048907 | Ga0496104_0063170 | Ga0496104_0063170_1361_1570 | 69 |
| 505 | 3300048907 | Ga0496104_0091388 | Ga0496104_0091388_1446_1655 | 69 |
| 506 | 3300048907 | Ga0496104_0231971 | Ga0496104_0231971_1308_1517 | 69 |
| 507 | 3300048908 | Ga0496105_0001482 | Ga0496105_0001482_8136_8345 | 69 |
| 508 | 3300048909 | Ga0496106_0017502 | Ga0496106_0017502_668_877 | 69 |
| 509 | 3300048909 | Ga0496106_0444368 | Ga0496106_0444368_767_976 | 69 |
| 510 | 3300048909 | Ga0496106_0754828 | Ga0496106_0754828_38_256 | 69 |
| 511 | 3300048910 | Ga0496107_0004674 | Ga0496107_0004674_3313_3522 | 69 |
| 512 | 3300048910 | Ga0496107_0332245 | Ga0496107_0332245_292_501 | 69 |
| 513 | 3300048911 | Ga0496108_0287964 | Ga0496108_0287964_974_1183 | 69 |
| 514 | 3300048912 | Ga0496109_0219983 | Ga0496109_0219983_1140_1349 | 69 |
| 515 | 3300048912 | Ga0496109_0610766 | Ga0496109_0610766_492_701 | 69 |
| 516 | 3300048912 | Ga0496109_0874594 | Ga0496109_0874594_506_715 | 69 |
| 517 | 3300048912 | Ga0496109_1131070 | Ga0496109_1131070_171_380 | 69 |
| 518 | 3300048913 | Ga0496110_0396961 | Ga0496110_0396961_455_664 | 69 |
| 519 | 3300048913 | Ga0496110_0435919 | Ga0496110_0435919_756_965 | 69 |
| 520 | 3300048913 | Ga0496110_0610078 | Ga0496110_0610078_494_703 | 69 |
| 521 | 3300048913 | Ga0496110_0639741 | Ga0496110_0639741_336_545 | 69 |
| 522 | 3300048913 | Ga0496110_1025010 | Ga0496110_1025010_188_397 | 69 |
| 523 | 3300048914 | Ga0496111_0070727 | Ga0496111_0070727_1746_1955 | 69 |
| 524 | 3300048914 | Ga0496111_0287431 | Ga0496111_0287431_848_1057 | 69 |
| 525 | 3300048915 | Ga0496112_0019781 | Ga0496112_0019781_1160_1369 | 69 |
| 526 | 3300048915 | Ga0496112_0460945 | Ga0496112_0460945_927_1136 | 69 |
| 527 | 3300048915 | Ga0496112_0747059 | Ga0496112_0747059_577_786 | 69 |
| 528 | 3300048915 | Ga0496112_0831677 | Ga0496112_0831677_420_629 | 69 |
| 529 | 3300048916 | Ga0496113_0042305 | Ga0496113_0042305_727_936 | 69 |
| 530 | 3300048916 | Ga0496113_0058544 | Ga0496113_0058544_2560_2769 | 69 |
| 531 | 3300048917 | Ga0496114_0002836 | Ga0496114_0002836_9326_9535 | 69 |
| 532 | 3300048918 | Ga0496115_0035664 | Ga0496115_0035664_3183_3392 | 69 |
| 533 | 3300048918 | Ga0496115_0044775 | Ga0496115_0044775_437_646 | 69 |
| 534 | 3300048919 | Ga0496116_0022742 | Ga0496116_0022742_3351_3560 | 69 |
| 535 | 3300048920 | Ga0496117_0395645 | Ga0496117_0395645_471_680 | 69 |
| 536 | 3300048921 | Ga0496118_0014217 | Ga0496118_0014217_1120_1329 | 69 |
| 537 | 3300048922 | Ga0496119_0016691 | Ga0496119_0016691_4895_5104 | 69 |
| 538 | 3300048923 | Ga0496120_0137579 | Ga0496120_0137579_773_982 | 69 |
| 539 | 3300048924 | Ga0496121_0004922 | Ga0496121_0004922_6374_6589 | 69 |
| 540 | 3300048924 | Ga0496121_0019396 | Ga0496121_0019396_3039_3248 | 69 |
| 541 | 3300048927 | Ga0496124_0346342 | Ga0496124_0346342_20_229 | 69 |
| 542 | 3300048928 | Ga0496125_0006229 | Ga0496125_0006229_9870_10088 | 69 |
| 543 | 3300048929 | Ga0496126_0024788 | Ga0496126_0024788_466_675 | 69 |
| 544 | 3300049460 | Ga0495682_0132003 | Ga0495682_0132003_330_539 | 69 |
| 545 | 3300049583 | Ga0501067_0092243 | Ga0501067_0092243_420_629 | 69 |
| 546 | 3300050489 | nmdc:mga03683_544730_c1 | nmdc:mga03683_544730_c1_282_491 | 69 |
| 547 | 3300050490 | nmdc:mga03n38_37300_c1 | nmdc:mga03n38_37300_c1_98_316 | 69 |
| 548 | 3300050490 | nmdc:mga03n38_411173_c1 | nmdc:mga03n38_411173_c1_50_259 | 69 |
| 549 | 3300050491 | nmdc:mga00v17_74820_c1 | nmdc:mga00v17_74820_c1_1112_1330 | 69 |
| 550 | 3300050492 | nmdc:mga0yw44_17344_c1 | nmdc:mga0yw44_17344_c1_2876_3094 | 69 |
| 551 | 3300050493 | nmdc:mga0k408_93730_c1 | nmdc:mga0k408_93730_c1_746_964 | 69 |
| 552 | 3300050494 | nmdc:mga06z11_364901_c1 | nmdc:mga06z11_364901_c1_352_570 | 69 |
| 553 | 3300050494 | nmdc:mga06z11_540163_c1 | nmdc:mga06z11_540163_c1_277_486 | 69 |
| 554 | 3300050495 | nmdc:mga04h51_194524_c1 | nmdc:mga04h51_194524_c1_346_555 | 69 |
| 555 | 3300050495 | nmdc:mga04h51_50730_c1 | nmdc:mga04h51_50730_c1_898_1116 | 69 |
| 556 | 3300050496 | nmdc:mga07m45_73760_c1 | nmdc:mga07m45_73760_c1_917_1135 | 69 |
| 557 | 3300050496 | nmdc:mga07m45_808641_c1 | nmdc:mga07m45_808641_c1_63_272 | 69 |
| 558 | 3300050511 | nmdc:mga08y16_2019711_c1 | nmdc:mga08y16_2019711_c1_232_447 | 69 |
| 559 | 3300050516 | nmdc:mga0sz30_22563_c1 | nmdc:mga0sz30_22563_c1_19_237 | 69 |
| 560 | 3300050516 | nmdc:mga0sz30_485543_c1 | nmdc:mga0sz30_485543_c1_161_370 | 69 |
| 561 | 3300053079 | Ga0500610_0021997 | Ga0500610_0021997_135_344 | 69 |
| 562 | 3300053083 | Ga0495655_0025657 | Ga0495655_0025657_418_627 | 69 |
| 563 | 3300053086 | Ga0500578_0099457 | Ga0500578_0099457_1590_1799 | 69 |
| 564 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_115442_115657 | 69 |
| 565 | 3300053087 | Ga0500643_128325 | Ga0500643_128325_18_227 | 69 |
| 566 | 3300053092 | Ga0500583_0037379 | Ga0500583_0037379_92_301 | 69 |
| 567 | 3300053092 | Ga0500583_0135540 | Ga0500583_0135540_801_1016 | 69 |
| 568 | 3300053093 | Ga0500651_0005130 | Ga0500651_0005130_2712_2921 | 69 |
| 569 | 3300053096 | Ga0500641_0306351 | Ga0500641_0306351_367_582 | 69 |
| 570 | 3300053103 | Ga0500555_029069 | Ga0500555_029069_165_374 | 69 |
| 571 | 3300053109 | Ga0500569_000535 | Ga0500569_000535_2840_3049 | 69 |
| 572 | 3300053129 | Ga0500628_113493 | Ga0500628_113493_163_372 | 69 |
| 573 | 3300053130 | Ga0500642_0000547 | Ga0500642_0000547_8020_8229 | 69 |
| 574 | 3300053133 | Ga0500655_006251 | Ga0500655_006251_215_424 | 69 |
| 575 | 3300053139 | Ga0500568_0017118 | Ga0500568_0017118_1657_1866 | 69 |
| 576 | 3300053140 | Ga0500573_0249290 | Ga0500573_0249290_117_326 | 69 |
| 577 | 3300053142 | Ga0500577_0159355 | Ga0500577_0159355_92_301 | 69 |
| 578 | 3300053142 | Ga0500577_0318578 | Ga0500577_0318578_135_344 | 69 |
| 579 | 3300053146 | Ga0500588_0009573 | Ga0500588_0009573_923_1132 | 69 |
| 580 | 3300053147 | Ga0500589_114597 | Ga0500589_114597_594_803 | 69 |
| 581 | 3300053158 | Ga0500627_0062807 | Ga0500627_0062807_739_948 | 69 |
| 582 | 3300053177 | Ga0500636_0163906 | Ga0500636_0163906_352_561 | 69 |
| 583 | 3300053731 | Ga0500609_002160 | Ga0500609_002160_2477_2686 | 69 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar