F466283

General Info

Members Datasets Scaffolds Average Seq Length
583 369 1166 316

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10083188|Ga0207677_100831881
Length 345
Sequence LLRRFAPLRKRIAFVAGNDDEPSQATMTASLPAFTDYEPFRPFRADPSQWLPIALDIARSHGLACTEPQIFSTGTNLVVGLDEPLILKIFPPFLRGQFASERASLVQLRGRLAVPIPEIVLEGERDQWPYLVITRVYGQLGSVVWPRLPEDQKERVLFQIGETIADVQRVPLGDLSQIEPRWDQFIQGQIQGCRARHERLGLPQQFLAGLDDLLRDAATLTPLNVNAPPVILTGEFIPENFLLRRELEGWGVSGLIDFGDVMTGRGEYDLLGPSAFMTSGMPRRVQSLFGGFGYSAADITPDLKRRLMALMLLHRASDPVRSICIEGWQQKAADLRELQDLLWPI

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
294 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
298 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
299 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
300 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
301 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
316 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
317 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
318 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
321 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
322 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
323 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
324 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
325 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
326 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
327 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
328 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
329 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
330 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
331 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
332 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
333 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
334 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
335 2791355199
336 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
337 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
338 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
339 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
340 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
341 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
342 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
343 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
344 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
345 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
346 2904699407
347 2906610324
348 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
349 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
350 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
351 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
352 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
353 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
354 2922425934
355 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
356 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
357 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
358 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
359 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
360 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
361 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
362 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
363 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
364 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
365 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
366 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
367 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
368 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
369 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 0
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.32
Nodule 6.69
Rhizoplane 3.6
Rhizosphere 69.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10083188 3300026023 Bacteria 2303
2 JGI25406J46586_10005160 3300003203 Bacteria 6059
3 JGI25165J46597_1005485 3300003214 Bacteria 2433
4 JGI25153J46596_10006239 3300003215 Bacteria 6098
5 rootH2_10211234 3300003320 Bacteria 1214
6 Ga0055543_1002478 3300004625 Bacteria 6089
7 Ga0065165_1001304 3300005262 Bacteria 27869
8 Ga0070683_100013043 3300005329 Bacteria 7236
9 Ga0070683_100136917 3300005329 Bacteria 2319
10 Ga0070670_100492120 3300005331 Bacteria 1090
11 Ga0068869_100075431 3300005334 Bacteria 2505
12 Ga0070666_10241275 3300005335 Bacteria 1278
13 Ga0070680_100228694 3300005336 Bacteria 1570
14 Ga0070682_100013158 3300005337 Bacteria 4753
15 Ga0068868_100203215 3300005338 Bacteria 1652
16 Ga0068868_100244205 3300005338 Bacteria 1509
17 Ga0070660_100458038 3300005339 Bacteria 1059
18 Ga0070668_100025353 3300005347 Bacteria 4495
19 Ga0070669_100157071 3300005353 Bacteria 1765
20 Ga0070675_100100975 3300005354 Bacteria 2430
21 Ga0070674_100052706 3300005356 Bacteria 2807
22 Ga0070673_100108350 3300005364 Bacteria 2300
23 Ga0070673_100115687 3300005364 Bacteria 2230
24 Ga0070659_100392737 3300005366 Bacteria 1170
25 Ga0070713_100010942 3300005436 Bacteria 6579
26 Ga0070711_100047715 3300005439 Bacteria 2925
27 Ga0070663_100046798 3300005455 Bacteria 3062
28 Ga0070663_100329788 3300005455 Bacteria 1230
29 Ga0070678_100054525 3300005456 Bacteria 2914
30 Ga0070678_100080739 3300005456 Bacteria 2463
31 Ga0070678_100193576 3300005456 Bacteria 1673
32 Ga0070681_10044998 3300005458 Bacteria 4418
33 Ga0070681_10060331 3300005458 Bacteria 3770
34 Ga0070681_10071598 3300005458 Bacteria 3431
35 Ga0070681_10147501 3300005458 Bacteria 2281
36 Ga0070685_10120529 3300005466 Bacteria 1628
37 Ga0070698_100311443 3300005471 Bacteria 1505
38 Ga0070679_100166533 3300005530 Bacteria 2177
39 Ga0070684_100008609 3300005535 Bacteria 7991
40 Ga0070684_100134255 3300005535 Bacteria 2234
41 Ga0070672_100055714 3300005543 Bacteria 3098
42 Ga0070672_100100938 3300005543 Bacteria 2341
43 Ga0070672_100672694 3300005543 Bacteria 905
44 Ga0070686_100124414 3300005544 Bacteria 1775
45 Ga0070665_100036744 3300005548 Bacteria 4925
46 Ga0070665_100094054 3300005548 Bacteria 3002
47 Ga0070665_100128810 3300005548 Bacteria 2533
48 Ga0068855_100058819 3300005563 Bacteria 4499
49 Ga0068855_100170497 3300005563 Bacteria 2465
50 Ga0068855_100318993 3300005563 Bacteria 1718
51 Ga0068857_100296516 3300005577 Bacteria 1490
52 Ga0068854_100408815 3300005578 Bacteria 1125
53 Ga0068852_100133026 3300005616 Bacteria 2293
54 Ga0068859_100049556 3300005617 Bacteria 4217
55 Ga0068859_100142923 3300005617 Bacteria 2466
56 Ga0068859_100299379 3300005617 Bacteria 1702
57 Ga0068866_10092684 3300005718 Bacteria 1649
58 Ga0068861_100102320 3300005719 Bacteria 2280
59 Ga0068861_100388774 3300005719 Bacteria 1235
60 Ga0068851_10156803 3300005834 Bacteria 1248
61 Ga0068858_100130009 3300005842 Bacteria 2360
62 Ga0068858_100131853 3300005842 Bacteria 2344
63 Ga0068858_100149708 3300005842 Bacteria 2193
64 Ga0068858_100242242 3300005842 Bacteria 1711
65 Ga0068858_100255051 3300005842 Bacteria 1666
66 Ga0068860_100127031 3300005843 Bacteria 2444
67 Ga0068862_100137380 3300005844 Bacteria 2167
68 Ga0068862_100187288 3300005844 Bacteria 1860
69 Ga0068862_100244330 3300005844 Bacteria 1633
70 Ga0068862_100270199 3300005844 Bacteria 1555
71 Ga0081455_10009565 3300005937 Bacteria 9956
72 Ga0081455_10012089 3300005937 Bacteria 8629
73 Ga0081455_10029339 3300005937 Bacteria 5016
74 Ga0081455_10098580 3300005937 Bacteria 2352
75 Ga0081540_1008529 3300005983 Bacteria 7152
76 Ga0081540_1033224 3300005983 Bacteria 2805
77 Ga0081540_1035801 3300005983 Bacteria 2657
78 Ga0081540_1043625 3300005983 Bacteria 2298
79 Ga0081540_1048902 3300005983 Bacteria 2114
80 Ga0081540_1061582 3300005983 Bacteria 1788
81 Ga0081539_10000466 3300005985 Bacteria 85716
82 Ga0081539_10026236 3300005985 Bacteria 3724
83 Ga0070717_10024804 3300006028 Bacteria 4765
84 Ga0075365_10027308 3300006038 Bacteria 3631
85 Ga0075365_10326779 3300006038 Bacteria 1080
86 Ga0075364_10071250 3300006051 Bacteria 2289
87 Ga0075364_10142413 3300006051 Bacteria 1613
88 Ga0070712_100166135 3300006175 Bacteria 1708
89 Ga0075367_10074239 3300006178 Bacteria 2050
90 Ga0075369_10004356 3300006186 Bacteria 5221
91 Ga0075366_10153299 3300006195 Bacteria 1396
92 Ga0097621_100166720 3300006237 Bacteria 1896
93 Ga0097621_100239366 3300006237 Bacteria 1586
94 Ga0068871_100170998 3300006358 Bacteria 1863
95 Ga0075428_100075420 3300006844 Bacteria 3683
96 Ga0068865_100033411 3300006881 Bacteria 3445
97 Ga0068865_100317964 3300006881 Bacteria 1251
98 Ga0097620_100049556 3300006931 Bacteria 4217
99 Ga0097620_100142927 3300006931 Bacteria 2466
100 Ga0097620_100299394 3300006931 Bacteria 1702
101 Ga0099825_1039555 3300006941 Bacteria 1441
102 Ga0099824_1022782 3300006942 Bacteria 4041
103 Ga0099822_1000191 3300006943 Bacteria 46107
104 Ga0099794_10037604 3300007265 Bacteria 2292
105 Ga0099795_10024414 3300007788 Bacteria 2016
106 Ga0099795_10033740 3300007788 Bacteria 1779
107 Ga0105240_10033191 3300009093 Bacteria 6672
108 Ga0105240_10045940 3300009093 Bacteria 5537
109 Ga0105245_10081624 3300009098 Bacteria 2956
110 Ga0105245_10264772 3300009098 Bacteria 1674
111 Ga0105247_10083129 3300009101 Bacteria 2022
112 Ga0105247_10149989 3300009101 Bacteria 1535
113 Ga0114129_10539134 3300009147 Bacteria 1519
114 Ga0105243_10154464 3300009148 Bacteria 1972
115 Ga0105242_10237294 3300009176 Bacteria 1637
116 Ga0105242_10302228 3300009176 Bacteria 1461
117 Ga0105237_10061212 3300009545 Bacteria 3765
118 Ga0105237_10185795 3300009545 Bacteria 2078
119 Ga0105237_10293073 3300009545 Bacteria 1630
120 Ga0105238_10053408 3300009551 Bacteria 4061
121 Ga0105249_10058920 3300009553 Bacteria 3521
122 Ga0105239_10063442 3300010375 Bacteria 4057
123 Ga0105239_10084776 3300010375 Bacteria 3491
124 Ga0105239_10109735 3300010375 Bacteria 3058
125 Ga0105246_10011436 3300011119 Bacteria 5508
126 Ga0105246_10071182 3300011119 Bacteria 2448
127 Ga0105246_10079941 3300011119 Bacteria 2326
128 Ga0105246_10172349 3300011119 Bacteria 1658
129 Ga0105246_10297981 3300011119 Bacteria 1300
130 Ga0157370_10059659 3300013104 Bacteria 3625
131 Ga0157370_10217308 3300013104 Bacteria 1771
132 Ga0157369_10004320 3300013105 Bacteria 16785
133 Ga0157369_10047026 3300013105 Bacteria 4686
134 Ga0157374_10041150 3300013296 Bacteria 4257
135 Ga0157378_10153466 3300013297 Bacteria 2147
136 Ga0163162_10091495 3300013306 Bacteria 3125
137 Ga0163162_10243381 3300013306 Bacteria 1930
138 Ga0163162_10303167 3300013306 Bacteria 1730
139 Ga0163162_10433832 3300013306 Bacteria 1446
140 Ga0157372_10068595 3300013307 Bacteria 3987
141 Ga0157372_10108343 3300013307 Bacteria 3179
142 Ga0157375_10021897 3300013308 Bacteria 5874
143 Ga0157375_10032188 3300013308 Bacteria 4971
144 Ga0157375_10185864 3300013308 Bacteria 2231
145 Ga0157375_10393938 3300013308 Bacteria 1552
146 Ga0163163_10005029 3300014325 Bacteria 11395
147 Ga0163163_10273801 3300014325 Bacteria 1739
148 Ga0163163_10516576 3300014325 Bacteria 1257
149 Ga0157380_10273041 3300014326 Bacteria 1542
150 Ga0157379_10094307 3300014968 Bacteria 2685
151 Ga0157379_10192298 3300014968 Bacteria 1844
152 Ga0157376_10034273 3300014969 Bacteria 4098
153 Ga0157376_10086467 3300014969 Bacteria 2703
154 Ga0163161_10140385 3300017792 Bacteria 1829
155 Ga0213874_10018972 3300021377 Bacteria 1867
156 Ga0213876_10006031 3300021384 Bacteria 6623
157 Ga0213876_10062484 3300021384 Bacteria 1966
158 Ga0213875_10058191 3300021388 Bacteria 1809
159 Ga0209233_1006575 3300025261 Bacteria 3737
160 Ga0209758_1015431 3300025297 Bacteria 3955
161 Ga0209758_1020677 3300025297 Bacteria 3101
162 Ga0207697_10070847 3300025315 Bacteria 1461
163 Ga0207692_10000547 3300025898 Bacteria 13349
164 Ga0207688_10153378 3300025901 Bacteria 1362
165 Ga0207647_10235185 3300025904 Bacteria 1053
166 Ga0207699_10000386 3300025906 Bacteria 23177
167 Ga0207699_10068446 3300025906 Bacteria 2162
168 Ga0207645_10077204 3300025907 Bacteria 2134
169 Ga0207654_10107316 3300025911 Bacteria 1731
170 Ga0207707_10000816 3300025912 Bacteria 30547
171 Ga0207707_10016028 3300025912 Bacteria 6536
172 Ga0207707_10153825 3300025912 Bacteria 2011
173 Ga0207695_10006231 3300025913 Bacteria 15536
174 Ga0207671_10094023 3300025914 Bacteria 2262
175 Ga0207671_10187330 3300025914 Bacteria 1612
176 Ga0207660_10160335 3300025917 Bacteria 1735
177 Ga0207662_10066293 3300025918 Bacteria 2175
178 Ga0207657_10076677 3300025919 Bacteria 2819
179 Ga0207652_10010669 3300025921 Bacteria 7399
180 Ga0207652_10060900 3300025921 Bacteria 3258
181 Ga0207652_10262764 3300025921 Bacteria 1557
182 Ga0207694_10202133 3300025924 Bacteria 1617
183 Ga0207687_10011663 3300025927 Bacteria 5746
184 Ga0207700_10080287 3300025928 Bacteria 2543
185 Ga0207709_10052935 3300025935 Bacteria 2496
186 Ga0207704_10158833 3300025938 Bacteria 1606
187 Ga0207665_10001425 3300025939 Bacteria 16086
188 Ga0207691_10043846 3300025940 Bacteria 4120
189 Ga0207691_10056812 3300025940 Bacteria 3564
190 Ga0207689_10132535 3300025942 Bacteria 2051
191 Ga0207689_10232134 3300025942 Bacteria 1525
192 Ga0207661_10015027 3300025944 Bacteria 5686
193 Ga0207661_10241050 3300025944 Bacteria 1604
194 Ga0207679_10384057 3300025945 Bacteria 1232
195 Ga0207667_10054494 3300025949 Bacteria 4206
196 Ga0207667_10177915 3300025949 Bacteria 2185
197 Ga0207667_10506228 3300025949 Bacteria 1224
198 Ga0207668_10010779 3300025972 Bacteria 5535
199 Ga0207668_10017444 3300025972 Bacteria 4498
200 Ga0207668_10211583 3300025972 Bacteria 1551
201 Ga0207668_10356067 3300025972 Bacteria 1225
202 Ga0207640_10164248 3300025981 Bacteria 1647
203 Ga0207639_10058388 3300026041 Bacteria 2968
204 Ga0207639_10111932 3300026041 Bacteria 2226
205 Ga0207678_10027066 3300026067 Bacteria 5001
206 Ga0207678_10194728 3300026067 Bacteria 1732
207 Ga0207708_10346341 3300026075 Bacteria 1218
208 Ga0207702_10043472 3300026078 Bacteria 3772
209 Ga0207648_10018779 3300026089 Bacteria 6251
210 Ga0207674_10311608 3300026116 Bacteria 1523
211 Ga0207675_100071021 3300026118 Bacteria 3255
212 Ga0207675_100108650 3300026118 Bacteria 2616
213 Ga0207675_100125592 3300026118 Bacteria 2430
214 Ga0207675_100289114 3300026118 Bacteria 1594
215 Ga0207683_10028790 3300026121 Bacteria 4806
216 Ga0207683_10037875 3300026121 Bacteria 4201
217 Ga0207683_10061169 3300026121 Bacteria 3314
218 Ga0207683_10101869 3300026121 Bacteria 2564
219 Ga0207683_10107730 3300026121 Bacteria 2493
220 Ga0207683_10121783 3300026121 Bacteria 2343
221 Ga0207683_10163379 3300026121 Bacteria 2014
222 Ga0207698_10280814 3300026142 Bacteria 1540
223 Ga0209589_1000055 3300027357 Bacteria 111890
224 Ga0209489_100128 3300027361 Bacteria 111890
225 Ga0209700_100137 3300027363 Bacteria 111890
226 Ga0209179_1005696 3300027512 Bacteria 1966
227 Ga0209179_1009592 3300027512 Bacteria 1665
228 Ga0209588_1028322 3300027671 Bacteria 1783
229 Ga0268266_10042528 3300028379 Bacteria 3881
230 Ga0268266_10179348 3300028379 Bacteria 1927
231 Ga0268265_10105795 3300028380 Bacteria 2284
232 Ga0268265_10112000 3300028380 Bacteria 2230
233 Ga0268265_10199029 3300028380 Bacteria 1736
234 Ga0268265_10300959 3300028380 Bacteria 1444
235 Ga0265337_1013180 3300028556 Bacteria 2785
236 Ga0265319_1013300 3300028563 Bacteria 3281
237 Ga0265334_10001581 3300028573 Bacteria 10962
238 Ga0265318_10019887 3300028577 Bacteria 2718
239 Ga0265336_10001044 3300028666 Bacteria 13533
240 Ga0265338_10000024 3300028800 Bacteria 297778
241 Ga0265324_10003580 3300029957 Bacteria 7322
242 Ga0265332_10042052 3300031238 Bacteria 1976
243 Ga0265328_10034325 3300031239 Bacteria 1879
244 Ga0265325_10025938 3300031241 Bacteria 3179
245 Ga0265339_10072118 3300031249 Bacteria 1838
246 Ga0265331_10041322 3300031250 Bacteria 2241
247 Ga0307509_10237597 3300031507 Bacteria 1618
248 Ga0307509_10305253 3300031507 Bacteria 1337
249 Ga0307509_10402687 3300031507 Bacteria 1074
250 Ga0265313_10040983 3300031595 Bacteria 2285
251 Ga0307508_10039969 3300031616 Bacteria 4213
252 Ga0265314_10181694 3300031711 Bacteria 1260
253 Ga0307516_10096712 3300031730 Bacteria 2773
254 Ga0307406_10144211 3300031901 Bacteria 1690
255 Ga0307409_100094838 3300031995 Bacteria 2456
256 Ga0307409_100305476 3300031995 Bacteria 1482
257 Ga0307416_100193344 3300032002 Bacteria 1922
258 Ga0307416_100432717 3300032002 Bacteria 1363
259 Ga0307411_10318663 3300032005 Bacteria 1254
260 Ga0307415_100239642 3300032126 Bacteria 1466
261 Ga0307507_10094791 3300033179 Bacteria 2535
262 Ga0307510_10007534 3300033180 Bacteria 12965
263 Ga0307510_10053110 3300033180 Bacteria 4264
264 Ga0315911_1000024 3300033442 Bacteria 97712
265 Ga0373934_0001199 3300035086 Bacteria 9393
266 Ga0373923_0000022 3300035111 Bacteria 23262
267 Ga0373923_0007505 3300035111 Bacteria 3837
268 Ga0373936_0016695 3300035113 Bacteria 2825
269 Ga0373945_0005833 3300035116 Bacteria 3953
270 Ga0373945_0035171 3300035116 Bacteria 1789
271 Ga0373953_0000468 3300035117 Bacteria 11120
272 Ga0373954_0000519 3300035118 Bacteria 14460
273 Ga0373954_0134691 3300035118 Bacteria 1204
274 Ga0373956_0002504 3300035119 Bacteria 7478
275 Ga0373956_0111959 3300035119 Bacteria 1271
276 Ga0373957_0000581 3300035120 Bacteria 9243
277 Ga0373943_0001466 3300035170 Bacteria 10672
278 Ga0373943_0026917 3300035170 Bacteria 2698
279 Ga0373943_0044897 3300035170 Bacteria 2151
280 Ga0373946_0025124 3300035171 Bacteria 2341
281 Ga0373955_0000402 3300035172 Bacteria 18349
282 Ga0373924_0003157 3300035410 Bacteria 5631
283 Ga0373924_0006169 3300035410 Bacteria 4284
284 Ga0373935_0000244 3300035692 Bacteria 26819
285 Ga0373935_0045315 3300035692 Bacteria 2775
286 Ga0373935_0081433 3300035692 Bacteria 2104
287 Ga0373927_0025022 3300035695 Bacteria 3903
288 Ga0373927_0097055 3300035695 Bacteria 1915
289 Ga0373933_0000114 3300035724 Bacteria 52016
290 Ga0373933_0000374 3300035724 Bacteria 28691
291 Ga0373933_0098258 3300035724 Bacteria 1814
292 Ga0373947_0004892 3300035725 Bacteria 7840
293 Ga0373937_0003416 3300036401 Bacteria 13330
294 Ga0373925_0012695 3300037068 Bacteria 6101
295 Ga0373925_0062792 3300037068 Bacteria 2793
296 Ga0395900_0026692 3300037418 Bacteria 5912
297 Ga0395898_0004631 3300037466 Bacteria 15002
298 Ga0395898_0073042 3300037466 Bacteria 3313
299 Ga0436364_0777503 3300037853 Bacteria 3747
300 Ga0395901_0059735 3300038443 Bacteria 3967
301 Ga0436365_1115617 3300039437 Bacteria 2530
302 Ga0436365_1293604 3300039437 Bacteria 3359
303 Ga0436363_1082211 3300039450 Bacteria 2150
304 Ga0436362_0749727 3300039453 Bacteria 2643
305 Ga0466957_0042736 3300044842 Bacteria 2743
306 Ga0466957_0087966 3300044842 Bacteria 1943
307 Ga0466960_0045989 3300044901 Bacteria 2087
308 Ga0466958_0275431 3300045836 Bacteria 1078
309 Ga0495592_0002074 3300046454 Bacteria 14129
310 Ga0495592_0142504 3300046454 Bacteria 1665
311 Ga0495603_0000370 3300046455 Bacteria 24383
312 Ga0495603_0025895 3300046455 Bacteria 3546
313 Ga0495590_0047989 3300046457 Bacteria 1489
314 Ga0495629_0000081 3300046459 Bacteria 85305
315 Ga0495629_0000380 3300046459 Bacteria 37205
316 Ga0495629_0210465 3300046459 Bacteria 1343
317 Ga0495638_0011951 3300046460 Bacteria 5968
318 Ga0495638_0053069 3300046460 Bacteria 2523
319 Ga0495638_0164057 3300046460 Bacteria 1279
320 Ga0495641_0010022 3300046461 Bacteria 5556
321 Ga0495651_0014993 3300046462 Bacteria 5989
322 Ga0495580_0003868 3300046472 Bacteria 12674
323 Ga0495582_0000051 3300046473 Bacteria 59010
324 Ga0495605_0047519 3300046474 Bacteria 2105
325 Ga0495639_0000010 3300046475 Bacteria 93685
326 Ga0495639_0018281 3300046475 Bacteria 3050
327 Ga0495639_0031626 3300046475 Bacteria 2357
328 Ga0495664_0009894 3300046477 Bacteria 5349
329 Ga0495664_0041991 3300046477 Bacteria 2707
330 Ga0495664_0093780 3300046477 Bacteria 1806
331 Ga0495664_0254464 3300046477 Bacteria 1062
332 Ga0495584_0067523 3300046491 Bacteria 1797
333 Ga0495584_0107481 3300046491 Bacteria 1411
334 Ga0495584_0116425 3300046491 Bacteria 1353
335 Ga0495584_0167027 3300046491 Bacteria 1118
336 Ga0495585_0028557 3300046492 Bacteria 3181
337 Ga0495594_0001074 3300046499 Bacteria 14256
338 Ga0495594_0045416 3300046499 Bacteria 2411
339 Ga0495594_0156642 3300046499 Bacteria 1294
340 Ga0495608_0008172 3300046511 Bacteria 7348
341 Ga0495610_0022155 3300046512 Bacteria 3480
342 Ga0495616_0038018 3300046513 Bacteria 2473
343 Ga0495616_0057832 3300046513 Bacteria 1911
344 Ga0495618_0084248 3300046514 Bacteria 2031
345 Ga0495628_0006360 3300046516 Bacteria 10325
346 Ga0495628_0058702 3300046516 Bacteria 3022
347 Ga0495628_0073947 3300046516 Bacteria 2655
348 Ga0495630_0005257 3300046517 Bacteria 9131
349 Ga0495630_0027348 3300046517 Bacteria 4230
350 Ga0495631_0084020 3300046518 Bacteria 1372
351 Ga0495631_0139210 3300046518 Bacteria 1042
352 Ga0495632_0045554 3300046519 Bacteria 2184
353 Ga0495643_0010324 3300046522 Bacteria 5750
354 Ga0495644_0059195 3300046523 Bacteria 1440
355 Ga0495663_0018464 3300046525 Bacteria 1986
356 Ga0495652_0007397 3300046529 Bacteria 10125
357 Ga0495652_0028959 3300046529 Bacteria 4866
358 Ga0495652_0066013 3300046529 Bacteria 3039
359 Ga0495665_0000005 3300046531 Bacteria 86491
360 Ga0495640_0000301 3300046533 Bacteria 33996
361 Ga0495640_0029278 3300046533 Bacteria 3956
362 Ga0495640_0038921 3300046533 Bacteria 3341
363 Ga0495586_0074156 3300046535 Bacteria 1862
364 Ga0495587_0002764 3300046536 Bacteria 11712
365 Ga0495598_0001714 3300046537 Bacteria 4394
366 Ga0495598_0014228 3300046537 Bacteria 1986
367 Ga0495645_0011053 3300046543 Bacteria 6344
368 Ga0495622_0001809 3300046557 Bacteria 10530
369 Ga0495622_0051134 3300046557 Bacteria 1917
370 Ga0495633_0028798 3300046558 Bacteria 2704
371 Ga0495633_0091097 3300046558 Bacteria 1417
372 Ga0495667_0002956 3300046559 Bacteria 11399
373 Ga0495656_0004197 3300046615 Bacteria 4920
374 Ga0495656_0010666 3300046615 Bacteria 3347
375 Ga0495668_0089959 3300046616 Bacteria 1682
376 Ga0495668_0100025 3300046616 Bacteria 1586
377 Ga0495634_0000764 3300046642 Bacteria 31101
378 Ga0495634_0010702 3300046642 Bacteria 6713
379 Ga0495611_0046609 3300046648 Bacteria 1944
380 Ga0495611_0132196 3300046648 Bacteria 1164
381 Ga0495625_0060007 3300046660 Bacteria 2696
382 Ga0495625_0062924 3300046660 Bacteria 2621
383 Ga0495625_0100848 3300046660 Bacteria 1984
384 Ga0495635_0000213 3300046663 Bacteria 36809
385 Ga0495635_0011036 3300046663 Bacteria 6334
386 Ga0495635_0274639 3300046663 Bacteria 1133
387 Ga0495659_0001624 3300046664 Bacteria 7546
388 Ga0495659_0002657 3300046664 Bacteria 5753
389 Ga0495588_0008118 3300046674 Bacteria 4800
390 Ga0495588_0016706 3300046674 Bacteria 3550
391 Ga0495588_0079805 3300046674 Bacteria 1708
392 Ga0495657_0015790 3300046675 Bacteria 5516
393 Ga0495599_0043648 3300046678 Bacteria 2814
394 Ga0495599_0059778 3300046678 Bacteria 2384
395 Ga0495646_0009214 3300046680 Bacteria 6264
396 Ga0495646_0012040 3300046680 Bacteria 5503
397 Ga0495646_0017126 3300046680 Bacteria 4600
398 Ga0495647_0019117 3300046681 Bacteria 2447
399 Ga0495647_0021128 3300046681 Bacteria 2342
400 Ga0495658_0008495 3300046683 Bacteria 5090
401 Ga0495658_0011732 3300046683 Bacteria 4416
402 Ga0495658_0149931 3300046683 Bacteria 1432
403 Ga0495669_0025017 3300046684 Bacteria 2602
404 Ga0495669_0069057 3300046684 Bacteria 1608
405 Ga0495613_0007909 3300046689 Bacteria 7909
406 Ga0495613_0041536 3300046689 Bacteria 3406
407 Ga0495624_0000094 3300046690 Bacteria 59911
408 Ga0495649_0031715 3300046694 Bacteria 2913
409 Ga0495589_0087310 3300046794 Bacteria 1515
410 Ga0495589_0099858 3300046794 Bacteria 1405
411 Ga0495600_0001029 3300046809 Bacteria 15081
412 Ga0495660_0041199 3300046810 Bacteria 2559
413 Ga0495581_0001146 3300047315 Bacteria 14489
414 Ga0495581_0227254 3300047315 Bacteria 1092
415 Ga0495604_0005951 3300047317 Bacteria 9677
416 Ga0495604_0181886 3300047317 Bacteria 1470
417 Ga0495636_0034558 3300047318 Bacteria 2081
418 Ga0495674_0000134 3300047319 Bacteria 56618
419 Ga0495674_0013244 3300047319 Bacteria 7754
420 Ga0495672_0016185 3300047320 Bacteria 5039
421 Ga0495672_0041142 3300047320 Bacteria 2797
422 Ga0495672_0099378 3300047320 Bacteria 1582
423 Ga0495676_0111796 3300047321 Bacteria 2003
424 Ga0495680_0002637 3300047322 Bacteria 18206
425 Ga0495683_0086940 3300047323 Bacteria 1519
426 Ga0495675_0000756 3300047444 Bacteria 20233
427 Ga0495677_0039017 3300047445 Bacteria 1736
428 Ga0495677_0052584 3300047445 Bacteria 1501
429 Ga0495684_0000052 3300047471 Bacteria 85125
430 Ga0495684_0005982 3300047471 Bacteria 9452
431 Ga0495684_0007719 3300047471 Bacteria 8329
432 Ga0495593_0000084 3300047673 Bacteria 41155
433 Ga0495593_0000518 3300047673 Bacteria 21864
434 Ga0495593_0030563 3300047673 Bacteria 2947
435 Ga0495614_0056293 3300048089 Bacteria 1688
436 Ga0495615_0013052 3300048090 Bacteria 1728
437 Ga0495626_0039608 3300048091 Bacteria 2230
438 Ga0496100_0013812 3300048903 Bacteria 4671
439 Ga0496102_0005804 3300048905 Bacteria 10496
440 Ga0496103_0023140 3300048906 Bacteria 3746
441 Ga0496104_0039927 3300048907 Bacteria 4396
442 Ga0496106_0247514 3300048909 Bacteria 1425
443 Ga0496106_0347380 3300048909 Bacteria 1192
444 Ga0496107_0016390 3300048910 Bacteria 5202
445 Ga0496107_0208845 3300048910 Bacteria 1452
446 Ga0496108_0012856 3300048911 Bacteria 6818
447 Ga0496109_0016364 3300048912 Bacteria 6482
448 Ga0496110_0100507 3300048913 Bacteria 2592
449 Ga0496111_0025250 3300048914 Bacteria 4192
450 Ga0496112_0069765 3300048915 Bacteria 3471
451 Ga0496112_0413543 3300048915 Bacteria 1288
452 Ga0496113_0020850 3300048916 Bacteria 4615
453 Ga0496113_0416570 3300048916 Bacteria 1079
454 Ga0496114_0016833 3300048917 Bacteria 5896
455 Ga0496114_0178261 3300048917 Bacteria 1855
456 Ga0496115_0001776 3300048918 Bacteria 15451
457 Ga0496115_0391744 3300048918 Bacteria 1128
458 Ga0496117_0010024 3300048920 Bacteria 8707
459 Ga0496118_0012015 3300048921 Bacteria 8367
460 Ga0496118_0124129 3300048921 Bacteria 1676
461 Ga0496118_0135871 3300048921 Bacteria 1569
462 Ga0496120_0052513 3300048923 Bacteria 2321
463 Ga0496121_0002340 3300048924 Bacteria 29257
464 Ga0496121_0004993 3300048924 Bacteria 17367
465 Ga0496121_0060700 3300048924 Bacteria 3108
466 Ga0496121_0101832 3300048924 Bacteria 2214
467 Ga0496121_0184619 3300048924 Bacteria 1501
468 Ga0496121_0230402 3300048924 Bacteria 1298
469 Ga0496121_0248698 3300048924 Bacteria 1234
470 Ga0496124_0223048 3300048927 Bacteria 1416
471 Ga0496125_0157408 3300048928 Bacteria 1549
472 Ga0496126_0089405 3300048929 Bacteria 2711
473 Ga0496126_0119677 3300048929 Bacteria 2285
474 Ga0496126_0199212 3300048929 Bacteria 1692
475 Ga0496126_0284739 3300048929 Bacteria 1368
476 Ga0496126_0286454 3300048929 Bacteria 1363
477 Ga0496126_0373232 3300048929 Bacteria 1163
478 Ga0501047_0046968 3300049581 Bacteria 4172
479 Ga0501067_0066626 3300049583 Bacteria 1993
480 Ga0501070_0064188 3300049586 Bacteria 3041
481 nmdc:mga00v17_121556_c1 3300050491 Bacteria 1663
482 nmdc:mga0yw44_246584_c1 3300050492 Bacteria 1188
483 nmdc:mga0yw44_77243_c1 3300050492 Bacteria 2080
484 nmdc:mga0k408_196813_c1 3300050493 Bacteria 1203
485 nmdc:mga0sz30_13283_c1 3300050516 Bacteria 3222
486 Ga0495601_0032539 3300053077 Bacteria 3247
487 Ga0495601_0215782 3300053077 Bacteria 1253
488 Ga0495612_0147994 3300053078 Bacteria 1021
489 Ga0500635_0013807 3300053080 Bacteria 2354
490 Ga0500635_0018312 3300053080 Bacteria 2111
491 Ga0500635_0024833 3300053080 Bacteria 1884
492 Ga0495595_0000279 3300053084 Bacteria 20119
493 Ga0495619_0091211 3300053085 Bacteria 2063
494 Ga0500578_0140548 3300053086 Bacteria 1510
495 Ga0500643_000091 3300053087 Bacteria 93825
496 Ga0500651_0001238 3300053093 Bacteria 12692
497 Ga0500566_0000762 3300053094 Bacteria 18172
498 Ga0500640_104185 3300053095 Bacteria 1167
499 Ga0500641_0028991 3300053096 Bacteria 2166
500 Ga0500641_0032707 3300053096 Bacteria 2059
501 Ga0500554_002407 3300053102 Bacteria 3676
502 Ga0500554_006683 3300053102 Bacteria 2605
503 Ga0500555_001359 3300053103 Bacteria 7623
504 Ga0500556_0010118 3300053104 Bacteria 2759
505 Ga0500562_005656 3300053108 Bacteria 3145
506 Ga0500562_029053 3300053108 Bacteria 1454
507 Ga0500595_000199 3300053119 Bacteria 40993
508 Ga0500595_002625 3300053119 Bacteria 8752
509 Ga0500595_009809 3300053119 Bacteria 3846
510 Ga0500595_028833 3300053119 Bacteria 1889
511 Ga0500595_039188 3300053119 Bacteria 1535
512 Ga0500614_044558 3300053123 Bacteria 1141
513 Ga0500618_000261 3300053125 Bacteria 41070
514 Ga0500642_0001930 3300053130 Bacteria 6007
515 Ga0500642_0031781 3300053130 Bacteria 2209
516 Ga0500658_0003734 3300053134 Bacteria 5735
517 Ga0500561_0051472 3300053137 Bacteria 1125
518 Ga0500568_0080002 3300053139 Bacteria 1241
519 Ga0500568_0095530 3300053139 Bacteria 1118
520 Ga0500588_0037424 3300053146 Bacteria 1441
521 Ga0500590_014489 3300053148 Bacteria 4066
522 Ga0500603_007126 3300053150 Bacteria 2449
523 Ga0500622_0025248 3300053156 Bacteria 3140
524 Ga0500622_0035703 3300053156 Bacteria 2601
525 Ga0500630_055180 3300053159 Bacteria 1910
526 Ga0500633_0044065 3300053160 Bacteria 1513
527 Ga0500634_0131051 3300053161 Bacteria 1204
528 Ga0500638_017623 3300053162 Bacteria 3318
529 Ga0500639_002046 3300053163 Bacteria 10075
530 Ga0500636_0095356 3300053177 Bacteria 1698
531 Ga0500636_0099606 3300053177 Bacteria 1654
532 Ga0500637_0000155 3300053178 Bacteria 25033
533 Ga0500637_0000757 3300053178 Bacteria 12952
534 Ga0500637_0078433 3300053178 Bacteria 1906
535 Ga0500596_001525 3300053735 Bacteria 4691
536 Ga0500599_000697 3300053736 Bacteria 3628
537 Ga0500661_000885 3300055283 Bacteria 5610
538 2511400233 2511231028 Bacteria 8046582
539 2513656478 2513237096 Bacteria 8722461
540 2513673004 2513237098 Bacteria 9902361
541 2513694895 2513237101 Bacteria 7952346
542 2513858948 2513237137 Bacteria 9558895
543 2513917343 2513237145 Bacteria 8979722
544 2517889566 2517572143 Bacteria 9484767
545 2524539558 2524023228 Bacteria 10118060
546 2671121244 2667528175 Bacteria 7532676
547 2723842052 2721755755 Bacteria 8322773
548 2793073653 2791355197 Bacteria 8420563
549 2793077398
550 2841913566 2841911363 Bacteria 6173697
551 2841919313 2841917233 Bacteria 6173500
552 2874610330 2874604998 Bacteria 7834745
553 2876812807 2876808645 Bacteria 8824342
554 2879111651 2879110137 Bacteria 8907982
555 2885375072 2885374607 Bacteria 8927485
556 2889035042 2889033259 Bacteria 9099371
557 2903754119 2903748898 Bacteria 9972761
558 2903772297 2903768456 Bacteria 9749579
559 2904692132 2904690495 Bacteria 9412302
560 2904709388
561 2906613054
562 2906641159 2906635258 Bacteria 8601019
563 2906665715 2906660503 Bacteria 8595048
564 2908748066 2908739725 Bacteria 8628932
565 2908757414 2908756301 Bacteria 8864324
566 2922363302 2922361189 Bacteria 7436256
567 2922388585 2922386360 Bacteria 7017218
568 2922433526
569 2935635065 2935630451 Bacteria 8169952
570 2941511656 2941507105 Bacteria 8166816
571 2941519361 2941515067 Bacteria 8166720
572 2941527515 2941523033 Bacteria 8169134
573 3005483203 3005474847 Bacteria 9259049
574 8006935577 8006933436 Bacteria 10410654
575 8006968343 8006964411 Bacteria 8966052
576 8006985902 8006984368 Bacteria 9651211
577 8007000276 8006994254 Bacteria 8309700
578 8019563233 8019555841 Bacteria 9642137
579 8019573312 8019565922 Bacteria 9639779
580 8019667412 8019659431 Bacteria 8577854
581 8056677757 8056673599 Bacteria 7871253
582 8056688434 8056681323 Bacteria 8472857
583 8056692778 8056689827 Bacteria 6712655
584 Ga0207677_10083188
585 JGI25406J46586_10005160
586 JGI25165J46597_1005485
587 JGI25153J46596_10006239
588 rootH2_10211234
589 Ga0055543_1002478
590 Ga0065165_1001304
591 Ga0070683_100013043
592 Ga0070683_100136917
593 Ga0070670_100492120
594 Ga0068869_100075431
595 Ga0070666_10241275
596 Ga0070680_100228694
597 Ga0070682_100013158
598 Ga0068868_100203215
599 Ga0068868_100244205
600 Ga0070660_100458038
601 Ga0070668_100025353
602 Ga0070669_100157071
603 Ga0070675_100100975
604 Ga0070674_100052706
605 Ga0070673_100108350
606 Ga0070673_100115687
607 Ga0070659_100392737
608 Ga0070713_100010942
609 Ga0070711_100047715
610 Ga0070663_100046798
611 Ga0070663_100329788
612 Ga0070678_100054525
613 Ga0070678_100080739
614 Ga0070678_100193576
615 Ga0070681_10044998
616 Ga0070681_10060331
617 Ga0070681_10071598
618 Ga0070681_10147501
619 Ga0070685_10120529
620 Ga0070698_100311443
621 Ga0070679_100166533
622 Ga0070684_100008609
623 Ga0070684_100134255
624 Ga0070672_100055714
625 Ga0070672_100100938
626 Ga0070672_100672694
627 Ga0070686_100124414
628 Ga0070665_100036744
629 Ga0070665_100094054
630 Ga0070665_100128810
631 Ga0068855_100058819
632 Ga0068855_100170497
633 Ga0068855_100318993
634 Ga0068857_100296516
635 Ga0068854_100408815
636 Ga0068852_100133026
637 Ga0068859_100049556
638 Ga0068859_100142923
639 Ga0068859_100299379
640 Ga0068866_10092684
641 Ga0068861_100102320
642 Ga0068861_100388774
643 Ga0068851_10156803
644 Ga0068858_100130009
645 Ga0068858_100131853
646 Ga0068858_100149708
647 Ga0068858_100242242
648 Ga0068858_100255051
649 Ga0068860_100127031
650 Ga0068862_100137380
651 Ga0068862_100187288
652 Ga0068862_100244330
653 Ga0068862_100270199
654 Ga0081455_10009565
655 Ga0081455_10012089
656 Ga0081455_10029339
657 Ga0081455_10098580
658 Ga0081540_1008529
659 Ga0081540_1033224
660 Ga0081540_1035801
661 Ga0081540_1043625
662 Ga0081540_1048902
663 Ga0081540_1061582
664 Ga0081539_10000466
665 Ga0081539_10026236
666 Ga0070717_10024804
667 Ga0075365_10027308
668 Ga0075365_10326779
669 Ga0075364_10071250
670 Ga0075364_10142413
671 Ga0070712_100166135
672 Ga0075367_10074239
673 Ga0075369_10004356
674 Ga0075366_10153299
675 Ga0097621_100166720
676 Ga0097621_100239366
677 Ga0068871_100170998
678 Ga0075428_100075420
679 Ga0068865_100033411
680 Ga0068865_100317964
681 Ga0097620_100049556
682 Ga0097620_100142927
683 Ga0097620_100299394
684 Ga0099825_1039555
685 Ga0099824_1022782
686 Ga0099822_1000191
687 Ga0099794_10037604
688 Ga0099795_10024414
689 Ga0099795_10033740
690 Ga0105240_10033191
691 Ga0105240_10045940
692 Ga0105245_10081624
693 Ga0105245_10264772
694 Ga0105247_10083129
695 Ga0105247_10149989
696 Ga0114129_10539134
697 Ga0105243_10154464
698 Ga0105242_10237294
699 Ga0105242_10302228
700 Ga0105237_10061212
701 Ga0105237_10185795
702 Ga0105237_10293073
703 Ga0105238_10053408
704 Ga0105249_10058920
705 Ga0105239_10063442
706 Ga0105239_10084776
707 Ga0105239_10109735
708 Ga0105246_10011436
709 Ga0105246_10071182
710 Ga0105246_10079941
711 Ga0105246_10172349
712 Ga0105246_10297981
713 Ga0157370_10059659
714 Ga0157370_10217308
715 Ga0157369_10004320
716 Ga0157369_10047026
717 Ga0157374_10041150
718 Ga0157378_10153466
719 Ga0163162_10091495
720 Ga0163162_10243381
721 Ga0163162_10303167
722 Ga0163162_10433832
723 Ga0157372_10068595
724 Ga0157372_10108343
725 Ga0157375_10021897
726 Ga0157375_10032188
727 Ga0157375_10185864
728 Ga0157375_10393938
729 Ga0163163_10005029
730 Ga0163163_10273801
731 Ga0163163_10516576
732 Ga0157380_10273041
733 Ga0157379_10094307
734 Ga0157379_10192298
735 Ga0157376_10034273
736 Ga0157376_10086467
737 Ga0163161_10140385
738 Ga0213874_10018972
739 Ga0213876_10006031
740 Ga0213876_10062484
741 Ga0213875_10058191
742 Ga0209233_1006575
743 Ga0209758_1015431
744 Ga0209758_1020677
745 Ga0207697_10070847
746 Ga0207692_10000547
747 Ga0207688_10153378
748 Ga0207647_10235185
749 Ga0207699_10000386
750 Ga0207699_10068446
751 Ga0207645_10077204
752 Ga0207654_10107316
753 Ga0207707_10000816
754 Ga0207707_10016028
755 Ga0207707_10153825
756 Ga0207695_10006231
757 Ga0207671_10094023
758 Ga0207671_10187330
759 Ga0207660_10160335
760 Ga0207662_10066293
761 Ga0207657_10076677
762 Ga0207652_10010669
763 Ga0207652_10060900
764 Ga0207652_10262764
765 Ga0207694_10202133
766 Ga0207687_10011663
767 Ga0207700_10080287
768 Ga0207709_10052935
769 Ga0207704_10158833
770 Ga0207665_10001425
771 Ga0207691_10043846
772 Ga0207691_10056812
773 Ga0207689_10132535
774 Ga0207689_10232134
775 Ga0207661_10015027
776 Ga0207661_10241050
777 Ga0207679_10384057
778 Ga0207667_10054494
779 Ga0207667_10177915
780 Ga0207667_10506228
781 Ga0207668_10010779
782 Ga0207668_10017444
783 Ga0207668_10211583
784 Ga0207668_10356067
785 Ga0207640_10164248
786 Ga0207639_10058388
787 Ga0207639_10111932
788 Ga0207678_10027066
789 Ga0207678_10194728
790 Ga0207708_10346341
791 Ga0207702_10043472
792 Ga0207648_10018779
793 Ga0207674_10311608
794 Ga0207675_100071021
795 Ga0207675_100108650
796 Ga0207675_100125592
797 Ga0207675_100289114
798 Ga0207683_10028790
799 Ga0207683_10037875
800 Ga0207683_10061169
801 Ga0207683_10101869
802 Ga0207683_10107730
803 Ga0207683_10121783
804 Ga0207683_10163379
805 Ga0207698_10280814
806 Ga0209589_1000055
807 Ga0209489_100128
808 Ga0209700_100137
809 Ga0209179_1005696
810 Ga0209179_1009592
811 Ga0209588_1028322
812 Ga0268266_10042528
813 Ga0268266_10179348
814 Ga0268265_10105795
815 Ga0268265_10112000
816 Ga0268265_10199029
817 Ga0268265_10300959
818 Ga0265337_1013180
819 Ga0265319_1013300
820 Ga0265334_10001581
821 Ga0265318_10019887
822 Ga0265336_10001044
823 Ga0265338_10000024
824 Ga0265324_10003580
825 Ga0265332_10042052
826 Ga0265328_10034325
827 Ga0265325_10025938
828 Ga0265339_10072118
829 Ga0265331_10041322
830 Ga0307509_10237597
831 Ga0307509_10305253
832 Ga0307509_10402687
833 Ga0265313_10040983
834 Ga0307508_10039969
835 Ga0265314_10181694
836 Ga0307516_10096712
837 Ga0307406_10144211
838 Ga0307409_100094838
839 Ga0307409_100305476
840 Ga0307416_100193344
841 Ga0307416_100432717
842 Ga0307411_10318663
843 Ga0307415_100239642
844 Ga0307507_10094791
845 Ga0307510_10007534
846 Ga0307510_10053110
847 Ga0315911_1000024
848 Ga0373934_0001199
849 Ga0373923_0000022
850 Ga0373923_0007505
851 Ga0373936_0016695
852 Ga0373945_0005833
853 Ga0373945_0035171
854 Ga0373953_0000468
855 Ga0373954_0000519
856 Ga0373954_0134691
857 Ga0373956_0002504
858 Ga0373956_0111959
859 Ga0373957_0000581
860 Ga0373943_0001466
861 Ga0373943_0026917
862 Ga0373943_0044897
863 Ga0373946_0025124
864 Ga0373955_0000402
865 Ga0373924_0003157
866 Ga0373924_0006169
867 Ga0373935_0000244
868 Ga0373935_0045315
869 Ga0373935_0081433
870 Ga0373927_0025022
871 Ga0373927_0097055
872 Ga0373933_0000114
873 Ga0373933_0000374
874 Ga0373933_0098258
875 Ga0373947_0004892
876 Ga0373937_0003416
877 Ga0373925_0012695
878 Ga0373925_0062792
879 Ga0395900_0026692
880 Ga0395898_0004631
881 Ga0395898_0073042
882 Ga0436364_0777503
883 Ga0395901_0059735
884 Ga0436365_1115617
885 Ga0436365_1293604
886 Ga0436363_1082211
887 Ga0436362_0749727
888 Ga0466957_0042736
889 Ga0466957_0087966
890 Ga0466960_0045989
891 Ga0466958_0275431
892 Ga0495592_0002074
893 Ga0495592_0142504
894 Ga0495603_0000370
895 Ga0495603_0025895
896 Ga0495590_0047989
897 Ga0495629_0000081
898 Ga0495629_0000380
899 Ga0495629_0210465
900 Ga0495638_0011951
901 Ga0495638_0053069
902 Ga0495638_0164057
903 Ga0495641_0010022
904 Ga0495651_0014993
905 Ga0495580_0003868
906 Ga0495582_0000051
907 Ga0495605_0047519
908 Ga0495639_0000010
909 Ga0495639_0018281
910 Ga0495639_0031626
911 Ga0495664_0009894
912 Ga0495664_0041991
913 Ga0495664_0093780
914 Ga0495664_0254464
915 Ga0495584_0067523
916 Ga0495584_0107481
917 Ga0495584_0116425
918 Ga0495584_0167027
919 Ga0495585_0028557
920 Ga0495594_0001074
921 Ga0495594_0045416
922 Ga0495594_0156642
923 Ga0495608_0008172
924 Ga0495610_0022155
925 Ga0495616_0038018
926 Ga0495616_0057832
927 Ga0495618_0084248
928 Ga0495628_0006360
929 Ga0495628_0058702
930 Ga0495628_0073947
931 Ga0495630_0005257
932 Ga0495630_0027348
933 Ga0495631_0084020
934 Ga0495631_0139210
935 Ga0495632_0045554
936 Ga0495643_0010324
937 Ga0495644_0059195
938 Ga0495663_0018464
939 Ga0495652_0007397
940 Ga0495652_0028959
941 Ga0495652_0066013
942 Ga0495665_0000005
943 Ga0495640_0000301
944 Ga0495640_0029278
945 Ga0495640_0038921
946 Ga0495586_0074156
947 Ga0495587_0002764
948 Ga0495598_0001714
949 Ga0495598_0014228
950 Ga0495645_0011053
951 Ga0495622_0001809
952 Ga0495622_0051134
953 Ga0495633_0028798
954 Ga0495633_0091097
955 Ga0495667_0002956
956 Ga0495656_0004197
957 Ga0495656_0010666
958 Ga0495668_0089959
959 Ga0495668_0100025
960 Ga0495634_0000764
961 Ga0495634_0010702
962 Ga0495611_0046609
963 Ga0495611_0132196
964 Ga0495625_0060007
965 Ga0495625_0062924
966 Ga0495625_0100848
967 Ga0495635_0000213
968 Ga0495635_0011036
969 Ga0495635_0274639
970 Ga0495659_0001624
971 Ga0495659_0002657
972 Ga0495588_0008118
973 Ga0495588_0016706
974 Ga0495588_0079805
975 Ga0495657_0015790
976 Ga0495599_0043648
977 Ga0495599_0059778
978 Ga0495646_0009214
979 Ga0495646_0012040
980 Ga0495646_0017126
981 Ga0495647_0019117
982 Ga0495647_0021128
983 Ga0495658_0008495
984 Ga0495658_0011732
985 Ga0495658_0149931
986 Ga0495669_0025017
987 Ga0495669_0069057
988 Ga0495613_0007909
989 Ga0495613_0041536
990 Ga0495624_0000094
991 Ga0495649_0031715
992 Ga0495589_0087310
993 Ga0495589_0099858
994 Ga0495600_0001029
995 Ga0495660_0041199
996 Ga0495581_0001146
997 Ga0495581_0227254
998 Ga0495604_0005951
999 Ga0495604_0181886
1000 Ga0495636_0034558
1001 Ga0495674_0000134
1002 Ga0495674_0013244
1003 Ga0495672_0016185
1004 Ga0495672_0041142
1005 Ga0495672_0099378
1006 Ga0495676_0111796
1007 Ga0495680_0002637
1008 Ga0495683_0086940
1009 Ga0495675_0000756
1010 Ga0495677_0039017
1011 Ga0495677_0052584
1012 Ga0495684_0000052
1013 Ga0495684_0005982
1014 Ga0495684_0007719
1015 Ga0495593_0000084
1016 Ga0495593_0000518
1017 Ga0495593_0030563
1018 Ga0495614_0056293
1019 Ga0495615_0013052
1020 Ga0495626_0039608
1021 Ga0496100_0013812
1022 Ga0496102_0005804
1023 Ga0496103_0023140
1024 Ga0496104_0039927
1025 Ga0496106_0247514
1026 Ga0496106_0347380
1027 Ga0496107_0016390
1028 Ga0496107_0208845
1029 Ga0496108_0012856
1030 Ga0496109_0016364
1031 Ga0496110_0100507
1032 Ga0496111_0025250
1033 Ga0496112_0069765
1034 Ga0496112_0413543
1035 Ga0496113_0020850
1036 Ga0496113_0416570
1037 Ga0496114_0016833
1038 Ga0496114_0178261
1039 Ga0496115_0001776
1040 Ga0496115_0391744
1041 Ga0496117_0010024
1042 Ga0496118_0012015
1043 Ga0496118_0124129
1044 Ga0496118_0135871
1045 Ga0496120_0052513
1046 Ga0496121_0002340
1047 Ga0496121_0004993
1048 Ga0496121_0060700
1049 Ga0496121_0101832
1050 Ga0496121_0184619
1051 Ga0496121_0230402
1052 Ga0496121_0248698
1053 Ga0496124_0223048
1054 Ga0496125_0157408
1055 Ga0496126_0089405
1056 Ga0496126_0119677
1057 Ga0496126_0199212
1058 Ga0496126_0284739
1059 Ga0496126_0286454
1060 Ga0496126_0373232
1061 Ga0501047_0046968
1062 Ga0501067_0066626
1063 Ga0501070_0064188
1064 nmdc:mga00v17_121556_c1
1065 nmdc:mga0yw44_246584_c1
1066 nmdc:mga0yw44_77243_c1
1067 nmdc:mga0k408_196813_c1
1068 nmdc:mga0sz30_13283_c1
1069 Ga0495601_0032539
1070 Ga0495601_0215782
1071 Ga0495612_0147994
1072 Ga0500635_0013807
1073 Ga0500635_0018312
1074 Ga0500635_0024833
1075 Ga0495595_0000279
1076 Ga0495619_0091211
1077 Ga0500578_0140548
1078 Ga0500643_000091
1079 Ga0500651_0001238
1080 Ga0500566_0000762
1081 Ga0500640_104185
1082 Ga0500641_0028991
1083 Ga0500641_0032707
1084 Ga0500554_002407
1085 Ga0500554_006683
1086 Ga0500555_001359
1087 Ga0500556_0010118
1088 Ga0500562_005656
1089 Ga0500562_029053
1090 Ga0500595_000199
1091 Ga0500595_002625
1092 Ga0500595_009809
1093 Ga0500595_028833
1094 Ga0500595_039188
1095 Ga0500614_044558
1096 Ga0500618_000261
1097 Ga0500642_0001930
1098 Ga0500642_0031781
1099 Ga0500658_0003734
1100 Ga0500561_0051472
1101 Ga0500568_0080002
1102 Ga0500568_0095530
1103 Ga0500588_0037424
1104 Ga0500590_014489
1105 Ga0500603_007126
1106 Ga0500622_0025248
1107 Ga0500622_0035703
1108 Ga0500630_055180
1109 Ga0500633_0044065
1110 Ga0500634_0131051
1111 Ga0500638_017623
1112 Ga0500639_002046
1113 Ga0500636_0095356
1114 Ga0500636_0099606
1115 Ga0500637_0000155
1116 Ga0500637_0000757
1117 Ga0500637_0078433
1118 Ga0500596_001525
1119 Ga0500599_000697
1120 Ga0500661_000885
1121 2511400233
1122 2513656478
1123 2513673004
1124 2513694895
1125 2513858948
1126 2513917343
1127 2517889566
1128 2524539558
1129 2671121244
1130 2723842052
1131 2793073653
1132 2793077398
1133 2841913566
1134 2841919313
1135 2874610330
1136 2876812807
1137 2879111651
1138 2885375072
1139 2889035042
1140 2903754119
1141 2903772297
1142 2904692132
1143 2904709388
1144 2906613054
1145 2906641159
1146 2906665715
1147 2908748066
1148 2908757414
1149 2922363302
1150 2922388585
1151 2922433526
1152 2935635065
1153 2941511656
1154 2941519361
1155 2941527515
1156 3005483203
1157 8006935577
1158 8006968343
1159 8006985902
1160 8007000276
1161 8019563233
1162 8019573312
1163 8019667412
1164 8056677757
1165 8056688434
1166 8056692778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

71

295

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.8056 6 313
6iy9-assembly2.cif.gz_B "crystal structure of aminoglycoside 7""-phoshotransferase-ia (aph(7"")-ia/hyg) from streptomyces hygroscopicus complexed with hygromycin b" 0.7846 6 313
6ctz-assembly1.cif.gz_A "structure of the gdp and kanamycin complex of aph(2"")-iiia" 0.7571 22 282
4ork-assembly4.cif.gz_D crystal structure of the phosphotransferase domain of the bifunctional aminoglycoside resistance enzyme aac(6')-ie-aph(2'')-ia 0.7489 23 282
5iqb-assembly1.cif.gz_A aminoglycoside phosphotransferase (2'')-ia (ctd of aac(6')-ie/aph(2'')-ia) in complex with gmppnp, magnesium, and kanamycin a 0.7464 23 282
ID Description Score Start End Superfamily
af_Q5RI03_13_83_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7987 57 105 3.30.200.20
af_A0A1D6H649_61_130_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7405 57 108 3.30.200.20
af_A0A1D6ERY2_751_840_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.74 42 107 3.30.200.20
af_Q9FHG4_349_441_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.734 57 105 3.30.200.20
af_A0A0N7KJP7_1_60_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7326 57 108 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1Q5RY61-F1-model_v4 Phosphotransferase 0.9957 2 314 GO:0016301
AF-A0A5P6P4M9-F1-model_v4 Phosphotransferase 0.9941 1 314 GO:0016301
AF-A0A4U6RVR8-F1-model_v4 Phosphotransferase 0.9907 1 314 GO:0016301
AF-A0A0E4BP05-F1-model_v4 Putative phosphotransferase 0.9906 86 314 GO:0016301
AF-A4Z2P8-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.9888 41 314 GO:0016301

Map