F466286

General Info

Members Datasets Scaffolds Average Seq Length
583 238 1166 212

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10017861|Ga0265338_100178614
Length 234
Sequence LVVTVNCGDILKPMPRGLFITLEGLDGSGKTTQIKRLAAWLESRGLEPVITRQPGGTVIGDRIRAILLDSRSTGLGSMTEMALMFADRAQAIAEVIQPSLDAGRIVVCDRFTDSTEAYQGGGRQLGSEVVLDLHRVICGNLQPDITILLLPSLSASLGRARRRNTREEAQTGKDENRFELEQDGFHRRVWEKYHEIAKREPNRVVLIEGDLSIDEIHEQIVQVISGRLVSGVGS

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
164 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.26
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 18.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10017861 3300028800 Bacteria 7622
2 JGI24738J21930_10006916 3300002075 Bacteria 2635
3 JGI25406J46586_10033250 3300003203 Bacteria 1906
4 rootH2_10084729 3300003320 Unclassified 1351
5 rootH2_10197888 3300003320 Bacteria 2338
6 rootL2_10252766 3300003322 Bacteria 1449
7 Ga0070658_10004389 3300005327 Bacteria 11501
8 Ga0070658_10015432 3300005327 Bacteria 6112
9 Ga0070658_10299431 3300005327 Bacteria 1371
10 Ga0070676_10340322 3300005328 Unclassified 1028
11 Ga0070676_10512892 3300005328 Bacteria 853
12 Ga0070683_100024648 3300005329 Bacteria 5392
13 Ga0070683_100051518 3300005329 Bacteria 3812
14 Ga0070683_100070815 3300005329 Bacteria 3253
15 Ga0070683_100110676 3300005329 Bacteria 2591
16 Ga0070683_100145534 3300005329 Bacteria 2245
17 Ga0070670_100095694 3300005331 Bacteria 2555
18 Ga0070670_100301814 3300005331 Unclassified 1401
19 Ga0070670_100561346 3300005331 Bacteria 1019
20 Ga0068869_100000150 3300005334 Bacteria 34437
21 Ga0068869_100025480 3300005334 Unclassified 4107
22 Ga0070666_10076863 3300005335 Unclassified 2278
23 Ga0070680_100350317 3300005336 Bacteria 1256
24 Ga0070682_100006770 3300005337 Bacteria 6429
25 Ga0068868_100011365 3300005338 Bacteria 6483
26 Ga0068868_100023398 3300005338 Bacteria 4675
27 Ga0068868_100046123 3300005338 Bacteria 3411
28 Ga0070660_100051716 3300005339 Bacteria 3165
29 Ga0070660_100277556 3300005339 Unclassified 1371
30 Ga0070691_10005504 3300005341 Bacteria 5763
31 Ga0070661_100048234 3300005344 Bacteria 3117
32 Ga0070661_100049905 3300005344 Unclassified 3063
33 Ga0070661_100069938 3300005344 Bacteria 2581
34 Ga0070692_10007609 3300005345 Bacteria 4782
35 Ga0070668_100084541 3300005347 Unclassified 2492
36 Ga0070669_100884686 3300005353 Bacteria 762
37 Ga0070675_100066321 3300005354 Bacteria 2985
38 Ga0070675_100269717 3300005354 Unclassified 1493
39 Ga0070671_100190049 3300005355 Bacteria 1740
40 Ga0070671_100203872 3300005355 Unclassified 1677
41 Ga0070671_100252035 3300005355 Bacteria 1499
42 Ga0070674_100013758 3300005356 Bacteria 5008
43 Ga0070673_100009294 3300005364 Bacteria 6595
44 Ga0070673_100219038 3300005364 Unclassified 1647
45 Ga0070688_100353099 3300005365 Bacteria 1077
46 Ga0070659_100012742 3300005366 Bacteria 6241
47 Ga0070659_100339518 3300005366 Unclassified 1258
48 Ga0070667_100000615 3300005367 Bacteria 34719
49 Ga0070667_100021139 3300005367 Bacteria 5406
50 Ga0070714_100165890 3300005435 Bacteria 2002
51 Ga0070714_100773283 3300005435 Bacteria 929
52 Ga0070713_100356448 3300005436 Unclassified 1358
53 Ga0070713_100598591 3300005436 Bacteria 1047
54 Ga0070701_10098665 3300005438 Bacteria 1614
55 Ga0070711_100047352 3300005439 Unclassified 2935
56 Ga0070694_100057016 3300005444 Bacteria 2655
57 Ga0070694_100259513 3300005444 Bacteria 1318
58 Ga0070663_100005606 3300005455 Bacteria 7474
59 Ga0070663_100013862 3300005455 Bacteria 5157
60 Ga0070678_100386058 3300005456 Bacteria 1213
61 Ga0070662_100016136 3300005457 Bacteria 5011
62 Ga0070681_10137033 3300005458 Bacteria 2378
63 Ga0070681_10165308 3300005458 Bacteria 2135
64 Ga0070681_10453079 3300005458 Bacteria 1195
65 Ga0068867_100031327 3300005459 Bacteria 3838
66 Ga0070685_10155435 3300005466 Unclassified 1453
67 Ga0070679_100084112 3300005530 Bacteria 3170
68 Ga0070679_100724304 3300005530 Bacteria 937
69 Ga0070684_100010320 3300005535 Bacteria 7397
70 Ga0070684_100031318 3300005535 Unclassified 4527
71 Ga0070684_100048924 3300005535 Bacteria 3668
72 Ga0070684_100076121 3300005535 Unclassified 2961
73 Ga0070684_100093939 3300005535 Bacteria 2671
74 Ga0070684_100311156 3300005535 Bacteria 1446
75 Ga0068853_100000530 3300005539 Bacteria 25896
76 Ga0068853_100014928 3300005539 Bacteria 6380
77 Ga0068853_100274309 3300005539 Bacteria 1553
78 Ga0068853_100307105 3300005539 Unclassified 1468
79 Ga0068853_100542999 3300005539 Bacteria 1100
80 Ga0070672_100014075 3300005543 Bacteria 5660
81 Ga0070672_100066769 3300005543 Unclassified 2849
82 Ga0070686_100155016 3300005544 Bacteria 1607
83 Ga0070665_100132439 3300005548 Bacteria 2495
84 Ga0070665_100223444 3300005548 Unclassified 1884
85 Ga0070665_100346043 3300005548 Bacteria 1492
86 Ga0068855_100005975 3300005563 Bacteria 14851
87 Ga0068855_100012946 3300005563 Bacteria 10063
88 Ga0068855_100029327 3300005563 Bacteria 6579
89 Ga0068855_100588611 3300005563 Bacteria 1201
90 Ga0070664_100050189 3300005564 Bacteria 3530
91 Ga0070664_100407779 3300005564 Bacteria 1243
92 Ga0068857_100013990 3300005577 Bacteria 6981
93 Ga0068857_100103864 3300005577 Unclassified 2551
94 Ga0068854_100003705 3300005578 Bacteria 9564
95 Ga0068854_100128226 3300005578 Bacteria 1934
96 Ga0068854_100364250 3300005578 Unclassified 1187
97 Ga0068856_100006867 3300005614 Bacteria 11134
98 Ga0068856_100008208 3300005614 Bacteria 10180
99 Ga0068856_100035436 3300005614 Bacteria 4891
100 Ga0068856_100062054 3300005614 Unclassified 3692
101 Ga0068856_100070891 3300005614 Unclassified 3448
102 Ga0068852_100000015 3300005616 Bacteria 134085
103 Ga0068852_100000818 3300005616 Bacteria 20560
104 Ga0068852_100039859 3300005616 Bacteria 3958
105 Ga0068852_100181781 3300005616 Unclassified 1978
106 Ga0068852_100336456 3300005616 Bacteria 1470
107 Ga0068852_100370995 3300005616 Unclassified 1402
108 Ga0068859_100018768 3300005617 Bacteria 6950
109 Ga0068859_101141280 3300005617 Bacteria 858
110 Ga0068864_100000358 3300005618 Bacteria 40190
111 Ga0068864_100142180 3300005618 Unclassified 2166
112 Ga0068864_100554099 3300005618 Bacteria 1112
113 Ga0068866_10006436 3300005718 Bacteria 4891
114 Ga0068866_10098299 3300005718 Unclassified 1609
115 Ga0068861_100055769 3300005719 Bacteria 3014
116 Ga0068851_10008453 3300005834 Bacteria 4758
117 Ga0068851_10105111 3300005834 Bacteria 1502
118 Ga0068851_10279031 3300005834 Bacteria 955
119 Ga0068870_10222343 3300005840 Bacteria 1156
120 Ga0068863_100011647 3300005841 Bacteria 8507
121 Ga0068863_100137686 3300005841 Unclassified 2332
122 Ga0068858_100013624 3300005842 Bacteria 7674
123 Ga0068858_100161074 3300005842 Unclassified 2112
124 Ga0068860_100001581 3300005843 Bacteria 24522
125 Ga0068860_100229221 3300005843 Unclassified 1805
126 Ga0068862_100042776 3300005844 Unclassified 3860
127 Ga0068862_100082592 3300005844 Bacteria 2789
128 Ga0081539_10000957 3300005985 Bacteria 54155
129 Ga0070717_10024780 3300006028 Bacteria 4767
130 Ga0070717_10719633 3300006028 Unclassified 907
131 Ga0075432_10053263 3300006058 Bacteria 1431
132 Ga0070712_100064020 3300006175 Unclassified 2606
133 Ga0097621_100001213 3300006237 Bacteria 17844
134 Ga0097621_100024594 3300006237 Bacteria 4705
135 Ga0097621_100030755 3300006237 Bacteria 4254
136 Ga0097621_100084150 3300006237 Unclassified 2651
137 Ga0068871_100003512 3300006358 Bacteria 10789
138 Ga0068871_100020659 3300006358 Bacteria 5049
139 Ga0068871_100073717 3300006358 Bacteria 2815
140 Ga0068871_100095091 3300006358 Unclassified 2488
141 Ga0075430_100258943 3300006846 Bacteria 1441
142 Ga0068865_100024937 3300006881 Bacteria 3927
143 Ga0068865_100121832 3300006881 Unclassified 1941
144 Ga0068865_100372006 3300006881 Bacteria 1163
145 Ga0097620_100018768 3300006931 Bacteria 6950
146 Ga0097620_101141313 3300006931 Bacteria 858
147 Ga0105240_10000181 3300009093 Bacteria 128067
148 Ga0105240_10000284 3300009093 Bacteria 99440
149 Ga0105240_10000296 3300009093 Bacteria 96854
150 Ga0105240_10001725 3300009093 Bacteria 36900
151 Ga0105240_10005322 3300009093 Bacteria 19201
152 Ga0105240_10008237 3300009093 Bacteria 14934
153 Ga0105240_10009478 3300009093 Bacteria 13784
154 Ga0105240_10605900 3300009093 Bacteria 1205
155 Ga0111539_10008274 3300009094 Bacteria 13240
156 Ga0105245_10003458 3300009098 Bacteria 14151
157 Ga0105245_10008935 3300009098 Bacteria 8742
158 Ga0105245_10029759 3300009098 Unclassified 4827
159 Ga0105245_10102106 3300009098 Bacteria 2655
160 Ga0105245_10222976 3300009098 Bacteria 1820
161 Ga0105245_10424928 3300009098 Bacteria 1333
162 Ga0105245_10776725 3300009098 Bacteria 995
163 Ga0105245_10894197 3300009098 Bacteria 929
164 Ga0105247_10008004 3300009101 Bacteria 6459
165 Ga0105243_10006362 3300009148 Bacteria 9123
166 Ga0105243_10659693 3300009148 Unclassified 1015
167 Ga0105243_11214325 3300009148 Bacteria 768
168 Ga0105241_10000076 3300009174 Bacteria 74496
169 Ga0105241_10001468 3300009174 Bacteria 18078
170 Ga0105241_10005434 3300009174 Bacteria 9425
171 Ga0105241_10024306 3300009174 Unclassified 4500
172 Ga0105241_10027837 3300009174 Unclassified 4209
173 Ga0105241_10034554 3300009174 Unclassified 3799
174 Ga0105241_10050664 3300009174 Unclassified 3165
175 Ga0105242_10064075 3300009176 Bacteria 3028
176 Ga0105242_10151228 3300009176 Unclassified 2024
177 Ga0105248_10003308 3300009177 Bacteria 17887
178 Ga0105248_10005054 3300009177 Bacteria 14566
179 Ga0105248_10148850 3300009177 Bacteria 2641
180 Ga0105248_10231909 3300009177 Unclassified 2078
181 Ga0105248_10725092 3300009177 Bacteria 1122
182 Ga0105237_10003829 3300009545 Bacteria 17685
183 Ga0105237_10005020 3300009545 Bacteria 15062
184 Ga0105237_10033720 3300009545 Bacteria 5186
185 Ga0105237_10057390 3300009545 Unclassified 3896
186 Ga0105238_10000338 3300009551 Bacteria 51021
187 Ga0105238_10001760 3300009551 Bacteria 21726
188 Ga0105238_10007626 3300009551 Bacteria 10841
189 Ga0105238_10034782 3300009551 Bacteria 5124
190 Ga0105238_10066898 3300009551 Unclassified 3594
191 Ga0105238_10074187 3300009551 Bacteria 3395
192 Ga0105239_10002626 3300010375 Bacteria 22720
193 Ga0105239_10003936 3300010375 Bacteria 17989
194 Ga0105239_10020385 3300010375 Bacteria 7314
195 Ga0105239_10026372 3300010375 Bacteria 6395
196 Ga0105239_10060299 3300010375 Unclassified 4164
197 Ga0105239_11180267 3300010375 Bacteria 882
198 Ga0105246_10064944 3300011119 Unclassified 2551
199 Ga0105246_10078484 3300011119 Bacteria 2345
200 Ga0105246_10513803 3300011119 Bacteria 1019
201 Ga0157370_10000196 3300013104 Bacteria 75917
202 Ga0157370_10060302 3300013104 Bacteria 3602
203 Ga0157370_10375740 3300013104 Bacteria 1309
204 Ga0157369_10000400 3300013105 Bacteria 57821
205 Ga0157369_10002310 3300013105 Bacteria 22945
206 Ga0157369_10008267 3300013105 Bacteria 11926
207 Ga0157369_10018719 3300013105 Bacteria 7765
208 Ga0157369_10090017 3300013105 Unclassified 3276
209 Ga0157369_10103170 3300013105 Unclassified 3038
210 Ga0157369_10371220 3300013105 Unclassified 1485
211 Ga0157369_11284214 3300013105 Bacteria 746
212 Ga0157369_11286315 3300013105 Unclassified 746
213 Ga0157374_10002118 3300013296 Bacteria 16704
214 Ga0157374_10048831 3300013296 Bacteria 3928
215 Ga0157374_10084085 3300013296 Unclassified 3024
216 Ga0157374_10106892 3300013296 Bacteria 2689
217 Ga0157374_10575778 3300013296 Bacteria 1135
218 Ga0157378_10003633 3300013297 Bacteria 13652
219 Ga0157378_10026180 3300013297 Bacteria 5142
220 Ga0157378_10343053 3300013297 Bacteria 1457
221 Ga0163162_10055200 3300013306 Bacteria 3998
222 Ga0163162_10701841 3300013306 Bacteria 1133
223 Ga0157372_10000197 3300013307 Bacteria 66368
224 Ga0157372_10009082 3300013307 Bacteria 10564
225 Ga0157372_10046817 3300013307 Bacteria 4802
226 Ga0157372_10110076 3300013307 Unclassified 3155
227 Ga0157372_10128958 3300013307 Unclassified 2909
228 Ga0157372_10220622 3300013307 Bacteria 2198
229 Ga0157372_10359114 3300013307 Bacteria 1697
230 Ga0157372_10651782 3300013307 Bacteria 1226
231 Ga0157372_10745693 3300013307 Bacteria 1139
232 Ga0157375_10034136 3300013308 Bacteria 4843
233 Ga0157375_10038671 3300013308 Unclassified 4582
234 Ga0157375_10091583 3300013308 Unclassified 3102
235 Ga0163163_10001714 3300014325 Bacteria 18490
236 Ga0163163_10069345 3300014325 Unclassified 3510
237 Ga0163163_10745429 3300014325 Bacteria 1043
238 Ga0157380_10164499 3300014326 Bacteria 1932
239 Ga0157380_10206384 3300014326 Bacteria 1747
240 Ga0157380_10380386 3300014326 Bacteria 1332
241 Ga0157377_10031739 3300014745 Bacteria 2872
242 Ga0157377_10109673 3300014745 Unclassified 1657
243 Ga0157379_10000092 3300014968 Bacteria 60487
244 Ga0157379_10005905 3300014968 Bacteria 10538
245 Ga0157379_10032549 3300014968 Bacteria 4648
246 Ga0157379_10316945 3300014968 Unclassified 1423
247 Ga0157376_10004219 3300014969 Bacteria 9972
248 Ga0157376_10015353 3300014969 Bacteria 5784
249 Ga0157376_10321034 3300014969 Unclassified 1472
250 Ga0157376_10581743 3300014969 Bacteria 1112
251 Ga0213872_10054390 3300021361 Unclassified 1815
252 Ga0207656_10003700 3300025321 Bacteria 5293
253 Ga0207656_10003773 3300025321 Bacteria 5247
254 Ga0207656_10118420 3300025321 Unclassified 1231
255 Ga0207656_10186972 3300025321 Bacteria 996
256 Ga0207642_10058306 3300025899 Bacteria 1781
257 Ga0207710_10000400 3300025900 Bacteria 28981
258 Ga0207688_10077238 3300025901 Unclassified 1897
259 Ga0207688_10100824 3300025901 Bacteria 1667
260 Ga0207680_10113536 3300025903 Unclassified 1761
261 Ga0207645_10318219 3300025907 Unclassified 1038
262 Ga0207643_10280904 3300025908 Bacteria 1032
263 Ga0207705_10069152 3300025909 Unclassified 2557
264 Ga0207705_10161360 3300025909 Unclassified 1684
265 Ga0207654_10000025 3300025911 Bacteria 143807
266 Ga0207654_10000035 3300025911 Bacteria 112494
267 Ga0207654_10000242 3300025911 Bacteria 33063
268 Ga0207654_10001907 3300025911 Bacteria 10824
269 Ga0207654_10016753 3300025911 Bacteria 3819
270 Ga0207654_10045021 3300025911 Bacteria 2509
271 Ga0207654_10048073 3300025911 Unclassified 2440
272 Ga0207707_10143521 3300025912 Bacteria 2087
273 Ga0207707_10371156 3300025912 Bacteria 1231
274 Ga0207695_10000069 3300025913 Bacteria 319955
275 Ga0207695_10000098 3300025913 Bacteria 261213
276 Ga0207695_10000314 3300025913 Bacteria 116506
277 Ga0207695_10005123 3300025913 Bacteria 17549
278 Ga0207695_10013741 3300025913 Bacteria 9634
279 Ga0207695_10066107 3300025913 Bacteria 3715
280 Ga0207695_10067444 3300025913 Unclassified 3670
281 Ga0207671_10000246 3300025914 Bacteria 81042
282 Ga0207671_10000600 3300025914 Bacteria 47921
283 Ga0207671_10072528 3300025914 Unclassified 2570
284 Ga0207671_10074896 3300025914 Unclassified 2531
285 Ga0207663_10040627 3300025916 Unclassified 2829
286 Ga0207657_10017446 3300025919 Bacteria 6881
287 Ga0207657_10143825 3300025919 Bacteria 1947
288 Ga0207657_10329702 3300025919 Unclassified 1206
289 Ga0207649_10001308 3300025920 Bacteria 14860
290 Ga0207649_10045913 3300025920 Unclassified 2680
291 Ga0207649_10069164 3300025920 Bacteria 2247
292 Ga0207649_10086597 3300025920 Bacteria 2042
293 Ga0207694_10000105 3300025924 Bacteria 89920
294 Ga0207694_10000731 3300025924 Bacteria 29493
295 Ga0207694_10000906 3300025924 Bacteria 26217
296 Ga0207694_10030836 3300025924 Bacteria 4093
297 Ga0207694_10854970 3300025924 Bacteria 769
298 Ga0207650_10080679 3300025925 Bacteria 2467
299 Ga0207650_10564021 3300025925 Bacteria 955
300 Ga0207659_10061014 3300025926 Bacteria 2716
301 Ga0207687_10007385 3300025927 Bacteria 7238
302 Ga0207687_10189420 3300025927 Unclassified 1600
303 Ga0207687_10439764 3300025927 Bacteria 1080
304 Ga0207700_10700728 3300025928 Bacteria 904
305 Ga0207664_10412327 3300025929 Bacteria 1202
306 Ga0207644_10011256 3300025931 Bacteria 5914
307 Ga0207644_10068283 3300025931 Unclassified 2593
308 Ga0207644_10159675 3300025931 Bacteria 1751
309 Ga0207706_10019854 3300025933 Bacteria 6040
310 Ga0207706_10089850 3300025933 Bacteria 2701
311 Ga0207686_10810399 3300025934 Bacteria 751
312 Ga0207704_10079719 3300025938 Unclassified 2111
313 Ga0207704_10406132 3300025938 Bacteria 1076
314 Ga0207691_10035911 3300025940 Bacteria 4595
315 Ga0207691_10045314 3300025940 Unclassified 4043
316 Ga0207711_10001943 3300025941 Bacteria 18756
317 Ga0207711_10026843 3300025941 Bacteria 4833
318 Ga0207711_10325419 3300025941 Bacteria 1421
319 Ga0207711_10422976 3300025941 Unclassified 1239
320 Ga0207689_10000553 3300025942 Bacteria 35691
321 Ga0207689_10043383 3300025942 Bacteria 3718
322 Ga0207689_10081797 3300025942 Bacteria 2655
323 Ga0207661_10001411 3300025944 Bacteria 16200
324 Ga0207661_10119768 3300025944 Bacteria 2239
325 Ga0207661_10178115 3300025944 Unclassified 1855
326 Ga0207661_10293475 3300025944 Bacteria 1456
327 Ga0207679_10035833 3300025945 Bacteria 3514
328 Ga0207667_10008591 3300025949 Bacteria 12122
329 Ga0207667_10012909 3300025949 Bacteria 9596
330 Ga0207667_10040358 3300025949 Unclassified 4970
331 Ga0207667_10067691 3300025949 Bacteria 3719
332 Ga0207667_10091331 3300025949 Bacteria 3146
333 Ga0207667_10107145 3300025949 Bacteria 2883
334 Ga0207667_10422801 3300025949 Unclassified 1356
335 Ga0207667_10748255 3300025949 Bacteria 977
336 Ga0207640_10028027 3300025981 Bacteria 3438
337 Ga0207640_10129060 3300025981 Unclassified 1824
338 Ga0207640_10145210 3300025981 Unclassified 1735
339 Ga0207640_10224745 3300025981 Bacteria 1440
340 Ga0207658_10000386 3300025986 Bacteria 42878
341 Ga0207677_10000104 3300026023 Bacteria 70036
342 Ga0207677_10350350 3300026023 Bacteria 1237
343 Ga0207703_10009371 3300026035 Bacteria 7695
344 Ga0207639_10000229 3300026041 Bacteria 41820
345 Ga0207639_10012651 3300026041 Bacteria 5883
346 Ga0207639_10090629 3300026041 Unclassified 2446
347 Ga0207639_10101113 3300026041 Bacteria 2330
348 Ga0207678_10024779 3300026067 Bacteria 5238
349 Ga0207702_10000633 3300026078 Bacteria 38531
350 Ga0207702_10016523 3300026078 Bacteria 6108
351 Ga0207702_10043824 3300026078 Bacteria 3758
352 Ga0207702_10172920 3300026078 Bacteria 1982
353 Ga0207702_10296044 3300026078 Unclassified 1534
354 Ga0207702_10795123 3300026078 Bacteria 935
355 Ga0207641_10000609 3300026088 Bacteria 39264
356 Ga0207648_10039382 3300026089 Bacteria 4156
357 Ga0207648_10056284 3300026089 Bacteria 3433
358 Ga0207676_10004630 3300026095 Bacteria 9734
359 Ga0207676_10591050 3300026095 Bacteria 1065
360 Ga0207674_10004842 3300026116 Bacteria 16117
361 Ga0207674_10057073 3300026116 Unclassified 3959
362 Ga0207675_100094960 3300026118 Bacteria 2805
363 Ga0207683_10006339 3300026121 Bacteria 10133
364 Ga0207683_10427709 3300026121 Bacteria 1220
365 Ga0207698_10000006 3300026142 Bacteria 291847
366 Ga0207698_10000825 3300026142 Bacteria 17916
367 Ga0207698_10052035 3300026142 Unclassified 3135
368 Ga0207698_10120118 3300026142 Bacteria 2222
369 Ga0207698_10148346 3300026142 Unclassified 2032
370 Ga0207698_10189937 3300026142 Bacteria 1828
371 Ga0207698_10251809 3300026142 Bacteria 1617
372 Ga0207698_10302533 3300026142 Bacteria 1489
373 Ga0207698_10370632 3300026142 Unclassified 1359
374 Ga0207428_10080414 3300027907 Bacteria 2547
375 Ga0268266_10294911 3300028379 Bacteria 1511
376 Ga0268265_10097158 3300028380 Bacteria 2369
377 Ga0268264_10000877 3300028381 Bacteria 31797
378 Ga0265334_10047310 3300028573 Bacteria 1660
379 Ga0265318_10023502 3300028577 Bacteria 2456
380 Ga0265323_10031549 3300028653 Bacteria 1969
381 Ga0265336_10008530 3300028666 Bacteria 3591
382 Ga0265338_10000162 3300028800 Bacteria 121694
383 Ga0265338_10005396 3300028800 Bacteria 16702
384 Ga0265338_10141145 3300028800 Unclassified 1886
385 Ga0265324_10098292 3300029957 Bacteria 995
386 Ga0265330_10002017 3300031235 Bacteria 11274
387 Ga0265330_10009189 3300031235 Bacteria 4708
388 Ga0265330_10012566 3300031235 Unclassified 3959
389 Ga0265330_10061509 3300031235 Bacteria 1634
390 Ga0265332_10077493 3300031238 Bacteria 1412
391 Ga0265332_10189284 3300031238 Unclassified 856
392 Ga0265328_10017201 3300031239 Bacteria 2802
393 Ga0265328_10082459 3300031239 Bacteria 1185
394 Ga0265320_10086978 3300031240 Unclassified 1452
395 Ga0265320_10088195 3300031240 Bacteria 1439
396 Ga0265325_10000021 3300031241 Bacteria 124310
397 Ga0265325_10004377 3300031241 Bacteria 8936
398 Ga0265325_10024308 3300031241 Bacteria 3297
399 Ga0265325_10025072 3300031241 Bacteria 3240
400 Ga0265325_10036964 3300031241 Unclassified 2584
401 Ga0265325_10045807 3300031241 Unclassified 2271
402 Ga0265325_10051798 3300031241 Bacteria 2109
403 Ga0265325_10131550 3300031241 Bacteria 1197
404 Ga0265325_10156106 3300031241 Bacteria 1076
405 Ga0265329_10007377 3300031242 Bacteria 4264
406 Ga0265329_10038447 3300031242 Bacteria 1539
407 Ga0265340_10005916 3300031247 Bacteria 6762
408 Ga0265340_10019534 3300031247 Bacteria 3489
409 Ga0265340_10027108 3300031247 Bacteria 2890
410 Ga0265339_10000136 3300031249 Bacteria 60534
411 Ga0265339_10010265 3300031249 Bacteria 5827
412 Ga0265339_10024090 3300031249 Bacteria 3511
413 Ga0265339_10040867 3300031249 Bacteria 2576
414 Ga0265331_10084766 3300031250 Bacteria 1468
415 Ga0265331_10195603 3300031250 Bacteria 911
416 Ga0265327_10041802 3300031251 Bacteria 2466
417 Ga0265316_10005832 3300031344 Bacteria 11874
418 Ga0265316_10008198 3300031344 Bacteria 9724
419 Ga0265316_10008943 3300031344 Bacteria 9242
420 Ga0265316_10011985 3300031344 Bacteria 7793
421 Ga0265316_10012787 3300031344 Bacteria 7499
422 Ga0265316_10020472 3300031344 Bacteria 5630
423 Ga0265316_10036751 3300031344 Bacteria 3959
424 Ga0265316_10150825 3300031344 Bacteria 1741
425 Ga0265316_10218101 3300031344 Bacteria 1409
426 Ga0265316_10246964 3300031344 Bacteria 1311
427 Ga0265313_10000001 3300031595 Bacteria 313647
428 Ga0265313_10006832 3300031595 Bacteria 7963
429 Ga0265313_10008708 3300031595 Bacteria 6704
430 Ga0265313_10032025 3300031595 Bacteria 2689
431 Ga0265313_10152867 3300031595 Bacteria 985
432 Ga0265314_10000025 3300031711 Bacteria 292548
433 Ga0265314_10014112 3300031711 Bacteria 6414
434 Ga0265314_10078605 3300031711 Unclassified 2184
435 Ga0265314_10212173 3300031711 Bacteria 1136
436 Ga0265342_10001637 3300031712 Bacteria 20649
437 Ga0265342_10003974 3300031712 Bacteria 11842
438 Ga0265342_10006636 3300031712 Bacteria 8589
439 Ga0265342_10006650 3300031712 Bacteria 8577
440 Ga0265342_10007652 3300031712 Bacteria 7868
441 Ga0265342_10008308 3300031712 Bacteria 7466
442 Ga0265342_10013407 3300031712 Bacteria 5501
443 Ga0265342_10064715 3300031712 Unclassified 2145
444 Ga0316577_10081419 3300031733 Bacteria 1810
445 Ga0316214_1022653 3300033545 Bacteria 882
446 Ga0373954_0048793 3300035118 Bacteria 1984
447 Ga0373931_0355318 3300035691 Unclassified 918
448 Ga0373933_0071091 3300035724 Unclassified 2118
449 Ga0373937_0018887 3300036401 Bacteria 6162
450 Ga0373937_0157832 3300036401 Bacteria 2127
451 Ga0373937_0182886 3300036401 Bacteria 1969
452 Ga0436365_0734353 3300039437 Bacteria 2456
453 Ga0436361_1165009 3300039447 Unclassified 1888
454 Ga0451577_0000218 3300042876 Bacteria 118324
455 Ga0451577_0021057 3300042876 Bacteria 5975
456 Ga0466963_0661930 3300044694 Unclassified 737
457 Ga0453684_0000193 3300044712 Bacteria 266146
458 Ga0453684_0187421 3300044712 Bacteria 2423
459 Ga0466967_0036298 3300045976 Unclassified 4206
460 Ga0495603_0079300 3300046455 Bacteria 1925
461 Ga0495629_0076242 3300046459 Bacteria 2341
462 Ga0495580_0101475 3300046472 Bacteria 2001
463 Ga0495580_0209508 3300046472 Bacteria 1341
464 Ga0495605_0107266 3300046474 Bacteria 1278
465 Ga0495628_0540450 3300046516 Bacteria 838
466 Ga0495665_0229325 3300046531 Bacteria 959
467 Ga0495586_0486591 3300046535 Bacteria 712
468 Ga0495635_0162898 3300046663 Unclassified 1518
469 Ga0495588_0343746 3300046674 Bacteria 784
470 Ga0495657_0494022 3300046675 Bacteria 714
471 Ga0495623_0105701 3300046679 Bacteria 1711
472 Ga0495613_0081369 3300046689 Bacteria 2353
473 Ga0495676_0336808 3300047321 Bacteria 1011
474 Ga0495677_0161926 3300047445 Bacteria 864
475 Ga0495602_0088647 3300048088 Bacteria 2575
476 Ga0495602_0534970 3300048088 Bacteria 814
477 Ga0496100_0241569 3300048903 Unclassified 1333
478 Ga0496101_0014693 3300048904 Bacteria 5268
479 Ga0496101_0077694 3300048904 Bacteria 2447
480 Ga0496104_0102501 3300048907 Bacteria 2741
481 Ga0496104_1025395 3300048907 Bacteria 729
482 Ga0496105_0095076 3300048908 Bacteria 2461
483 Ga0496105_0161747 3300048908 Bacteria 1838
484 Ga0496105_0382811 3300048908 Bacteria 1119
485 Ga0496106_0030667 3300048909 Bacteria 4008
486 Ga0496106_0177953 3300048909 Bacteria 1688
487 Ga0496107_0382402 3300048910 Bacteria 1047
488 Ga0496107_0544255 3300048910 Bacteria 860
489 Ga0496108_0337979 3300048911 Bacteria 1314
490 Ga0496110_0320484 3300048913 Bacteria 1412
491 Ga0496113_0203345 3300048916 Bacteria 1575
492 Ga0496114_0563782 3300048917 Bacteria 1006
493 Ga0496115_0038512 3300048918 Bacteria 3794
494 Ga0496115_0103487 3300048918 Bacteria 2336
495 Ga0496115_0598934 3300048918 Bacteria 876
496 Ga0501031_0112065 3300049568 Bacteria 1781
497 Ga0501031_0441622 3300049568 Bacteria 841
498 Ga0501032_0223352 3300049569 Bacteria 1225
499 Ga0501033_0089185 3300049570 Bacteria 2256
500 Ga0501033_0107467 3300049570 Bacteria 2032
501 Ga0501033_0283676 3300049570 Bacteria 1169
502 Ga0501034_0117023 3300049571 Bacteria 2653
503 Ga0501034_0990963 3300049571 Bacteria 725
504 Ga0501036_0059447 3300049572 Bacteria 3238
505 Ga0501037_0035493 3300049573 Bacteria 3677
506 Ga0501037_0040189 3300049573 Bacteria 3442
507 Ga0501038_0078895 3300049574 Bacteria 2777
508 Ga0501038_0086960 3300049574 Bacteria 2625
509 Ga0501039_0002466 3300049575 Bacteria 13772
510 Ga0501039_0017482 3300049575 Bacteria 5501
511 Ga0501039_0019732 3300049575 Bacteria 5169
512 Ga0501040_0006838 3300049576 Bacteria 7393
513 Ga0501040_0030479 3300049576 Bacteria 3643
514 Ga0501041_0002270 3300049577 Bacteria 10872
515 Ga0501041_0014578 3300049577 Bacteria 4667
516 Ga0501041_0162775 3300049577 Bacteria 1395
517 Ga0501042_0008363 3300049578 Bacteria 6824
518 Ga0501042_0032508 3300049578 Bacteria 3695
519 Ga0501042_0059930 3300049578 Bacteria 2718
520 Ga0501043_0127723 3300049579 Bacteria 1993
521 Ga0501043_0218231 3300049579 Bacteria 1476
522 Ga0501046_0003994 3300049580 Bacteria 13467
523 Ga0501046_0025257 3300049580 Bacteria 4863
524 Ga0501048_0002970 3300049582 Bacteria 12941
525 Ga0501048_0058802 3300049582 Bacteria 2724
526 Ga0501067_0237489 3300049583 Bacteria 1014
527 Ga0501068_0046216 3300049584 Bacteria 2625
528 Ga0501068_0065994 3300049584 Bacteria 2204
529 Ga0501070_0016054 3300049586 Bacteria 6293
530 Ga0501070_0092493 3300049586 Bacteria 2503
531 Ga0501071_0002225 3300049587 Bacteria 11665
532 Ga0501071_0012387 3300049587 Bacteria 5784
533 Ga0501071_0144391 3300049587 Bacteria 1773
534 Ga0501071_0443754 3300049587 Bacteria 993
535 Ga0501072_0001495 3300049588 Bacteria 17508
536 Ga0501072_0109694 3300049588 Bacteria 2196
537 Ga0501072_0365741 3300049588 Bacteria 1145
538 Ga0501073_0031207 3300049589 Bacteria 3802
539 Ga0501073_0222711 3300049589 Bacteria 1303
540 Ga0501074_0007102 3300049590 Bacteria 8094
541 Ga0501074_0020818 3300049590 Bacteria 4765
542 Ga0501074_0087323 3300049590 Bacteria 2233
543 Ga0501075_0004886 3300049591 Bacteria 9133
544 Ga0501075_0319810 3300049591 Bacteria 1182
545 Ga0501076_0028951 3300049592 Bacteria 4304
546 Ga0501076_0033393 3300049592 Bacteria 4017
547 Ga0501076_0050902 3300049592 Bacteria 3277
548 Ga0501076_0533303 3300049592 Bacteria 968
549 Ga0501077_0000849 3300049593 Bacteria 18453
550 Ga0501077_0002849 3300049593 Bacteria 10370
551 Ga0501077_0110893 3300049593 Bacteria 1739
552 Ga0501079_0002376 3300049741 Bacteria 13672
553 Ga0501079_0002802 3300049741 Bacteria 12707
554 Ga0501079_0043810 3300049741 Bacteria 3454
555 Ga0501080_0004429 3300049742 Bacteria 12495
556 Ga0501080_0010361 3300049742 Bacteria 8524
557 Ga0501080_0472032 3300049742 Bacteria 1123
558 Ga0501081_0001603 3300049743 Bacteria 13977
559 Ga0501081_0019030 3300049743 Bacteria 4567
560 Ga0501081_0036827 3300049743 Bacteria 3336
561 Ga0501083_0064815 3300049744 Bacteria 2434
562 Ga0501083_0174413 3300049744 Bacteria 1405
563 Ga0501035_0048872 3300049822 Bacteria 3792
564 Ga0501035_0097178 3300049822 Bacteria 2587
565 Ga0501035_0498618 3300049822 Bacteria 1002
566 Ga0501035_0648839 3300049822 Bacteria 856
567 Ga0501044_0464267 3300049823 Bacteria 1171
568 Ga0501045_0002913 3300049824 Bacteria 11693
569 Ga0501045_0245916 3300049824 Bacteria 1331
570 nmdc:mga08y16_193063_c1 3300050511 Bacteria 2112
571 nmdc:mga0n895_196459_c1 3300050512 Bacteria 2048
572 Ga0495601_0122627 3300053077 Bacteria 1689
573 Ga0501084_0000979 3300054114 Bacteria 22169
574 Ga0501084_0005173 3300054114 Bacteria 10669
575 Ga0501084_0421321 3300054114 Bacteria 1128
576 Ga0501084_1011261 3300054114 Bacteria 698
577 Ga0501082_0008181 3300060353 Bacteria 9026
578 Ga0501082_0113838 3300060353 Bacteria 2342
579 Ga0501082_0128161 3300060353 Bacteria 2201
580 Ga0501082_0446285 3300060353 Bacteria 1130
581 Ga0466962_0277806 3300061719 Bacteria 826
582 Ga0530510_0070031 3300061734 Bacteria 2545
583 Ga0530510_0237061 3300061734 Bacteria 1358
584 Ga0265338_10017861
585 JGI24738J21930_10006916
586 JGI25406J46586_10033250
587 rootH2_10084729
588 rootH2_10197888
589 rootL2_10252766
590 Ga0070658_10004389
591 Ga0070658_10015432
592 Ga0070658_10299431
593 Ga0070676_10340322
594 Ga0070676_10512892
595 Ga0070683_100024648
596 Ga0070683_100051518
597 Ga0070683_100070815
598 Ga0070683_100110676
599 Ga0070683_100145534
600 Ga0070670_100095694
601 Ga0070670_100301814
602 Ga0070670_100561346
603 Ga0068869_100000150
604 Ga0068869_100025480
605 Ga0070666_10076863
606 Ga0070680_100350317
607 Ga0070682_100006770
608 Ga0068868_100011365
609 Ga0068868_100023398
610 Ga0068868_100046123
611 Ga0070660_100051716
612 Ga0070660_100277556
613 Ga0070691_10005504
614 Ga0070661_100048234
615 Ga0070661_100049905
616 Ga0070661_100069938
617 Ga0070692_10007609
618 Ga0070668_100084541
619 Ga0070669_100884686
620 Ga0070675_100066321
621 Ga0070675_100269717
622 Ga0070671_100190049
623 Ga0070671_100203872
624 Ga0070671_100252035
625 Ga0070674_100013758
626 Ga0070673_100009294
627 Ga0070673_100219038
628 Ga0070688_100353099
629 Ga0070659_100012742
630 Ga0070659_100339518
631 Ga0070667_100000615
632 Ga0070667_100021139
633 Ga0070714_100165890
634 Ga0070714_100773283
635 Ga0070713_100356448
636 Ga0070713_100598591
637 Ga0070701_10098665
638 Ga0070711_100047352
639 Ga0070694_100057016
640 Ga0070694_100259513
641 Ga0070663_100005606
642 Ga0070663_100013862
643 Ga0070678_100386058
644 Ga0070662_100016136
645 Ga0070681_10137033
646 Ga0070681_10165308
647 Ga0070681_10453079
648 Ga0068867_100031327
649 Ga0070685_10155435
650 Ga0070679_100084112
651 Ga0070679_100724304
652 Ga0070684_100010320
653 Ga0070684_100031318
654 Ga0070684_100048924
655 Ga0070684_100076121
656 Ga0070684_100093939
657 Ga0070684_100311156
658 Ga0068853_100000530
659 Ga0068853_100014928
660 Ga0068853_100274309
661 Ga0068853_100307105
662 Ga0068853_100542999
663 Ga0070672_100014075
664 Ga0070672_100066769
665 Ga0070686_100155016
666 Ga0070665_100132439
667 Ga0070665_100223444
668 Ga0070665_100346043
669 Ga0068855_100005975
670 Ga0068855_100012946
671 Ga0068855_100029327
672 Ga0068855_100588611
673 Ga0070664_100050189
674 Ga0070664_100407779
675 Ga0068857_100013990
676 Ga0068857_100103864
677 Ga0068854_100003705
678 Ga0068854_100128226
679 Ga0068854_100364250
680 Ga0068856_100006867
681 Ga0068856_100008208
682 Ga0068856_100035436
683 Ga0068856_100062054
684 Ga0068856_100070891
685 Ga0068852_100000015
686 Ga0068852_100000818
687 Ga0068852_100039859
688 Ga0068852_100181781
689 Ga0068852_100336456
690 Ga0068852_100370995
691 Ga0068859_100018768
692 Ga0068859_101141280
693 Ga0068864_100000358
694 Ga0068864_100142180
695 Ga0068864_100554099
696 Ga0068866_10006436
697 Ga0068866_10098299
698 Ga0068861_100055769
699 Ga0068851_10008453
700 Ga0068851_10105111
701 Ga0068851_10279031
702 Ga0068870_10222343
703 Ga0068863_100011647
704 Ga0068863_100137686
705 Ga0068858_100013624
706 Ga0068858_100161074
707 Ga0068860_100001581
708 Ga0068860_100229221
709 Ga0068862_100042776
710 Ga0068862_100082592
711 Ga0081539_10000957
712 Ga0070717_10024780
713 Ga0070717_10719633
714 Ga0075432_10053263
715 Ga0070712_100064020
716 Ga0097621_100001213
717 Ga0097621_100024594
718 Ga0097621_100030755
719 Ga0097621_100084150
720 Ga0068871_100003512
721 Ga0068871_100020659
722 Ga0068871_100073717
723 Ga0068871_100095091
724 Ga0075430_100258943
725 Ga0068865_100024937
726 Ga0068865_100121832
727 Ga0068865_100372006
728 Ga0097620_100018768
729 Ga0097620_101141313
730 Ga0105240_10000181
731 Ga0105240_10000284
732 Ga0105240_10000296
733 Ga0105240_10001725
734 Ga0105240_10005322
735 Ga0105240_10008237
736 Ga0105240_10009478
737 Ga0105240_10605900
738 Ga0111539_10008274
739 Ga0105245_10003458
740 Ga0105245_10008935
741 Ga0105245_10029759
742 Ga0105245_10102106
743 Ga0105245_10222976
744 Ga0105245_10424928
745 Ga0105245_10776725
746 Ga0105245_10894197
747 Ga0105247_10008004
748 Ga0105243_10006362
749 Ga0105243_10659693
750 Ga0105243_11214325
751 Ga0105241_10000076
752 Ga0105241_10001468
753 Ga0105241_10005434
754 Ga0105241_10024306
755 Ga0105241_10027837
756 Ga0105241_10034554
757 Ga0105241_10050664
758 Ga0105242_10064075
759 Ga0105242_10151228
760 Ga0105248_10003308
761 Ga0105248_10005054
762 Ga0105248_10148850
763 Ga0105248_10231909
764 Ga0105248_10725092
765 Ga0105237_10003829
766 Ga0105237_10005020
767 Ga0105237_10033720
768 Ga0105237_10057390
769 Ga0105238_10000338
770 Ga0105238_10001760
771 Ga0105238_10007626
772 Ga0105238_10034782
773 Ga0105238_10066898
774 Ga0105238_10074187
775 Ga0105239_10002626
776 Ga0105239_10003936
777 Ga0105239_10020385
778 Ga0105239_10026372
779 Ga0105239_10060299
780 Ga0105239_11180267
781 Ga0105246_10064944
782 Ga0105246_10078484
783 Ga0105246_10513803
784 Ga0157370_10000196
785 Ga0157370_10060302
786 Ga0157370_10375740
787 Ga0157369_10000400
788 Ga0157369_10002310
789 Ga0157369_10008267
790 Ga0157369_10018719
791 Ga0157369_10090017
792 Ga0157369_10103170
793 Ga0157369_10371220
794 Ga0157369_11284214
795 Ga0157369_11286315
796 Ga0157374_10002118
797 Ga0157374_10048831
798 Ga0157374_10084085
799 Ga0157374_10106892
800 Ga0157374_10575778
801 Ga0157378_10003633
802 Ga0157378_10026180
803 Ga0157378_10343053
804 Ga0163162_10055200
805 Ga0163162_10701841
806 Ga0157372_10000197
807 Ga0157372_10009082
808 Ga0157372_10046817
809 Ga0157372_10110076
810 Ga0157372_10128958
811 Ga0157372_10220622
812 Ga0157372_10359114
813 Ga0157372_10651782
814 Ga0157372_10745693
815 Ga0157375_10034136
816 Ga0157375_10038671
817 Ga0157375_10091583
818 Ga0163163_10001714
819 Ga0163163_10069345
820 Ga0163163_10745429
821 Ga0157380_10164499
822 Ga0157380_10206384
823 Ga0157380_10380386
824 Ga0157377_10031739
825 Ga0157377_10109673
826 Ga0157379_10000092
827 Ga0157379_10005905
828 Ga0157379_10032549
829 Ga0157379_10316945
830 Ga0157376_10004219
831 Ga0157376_10015353
832 Ga0157376_10321034
833 Ga0157376_10581743
834 Ga0213872_10054390
835 Ga0207656_10003700
836 Ga0207656_10003773
837 Ga0207656_10118420
838 Ga0207656_10186972
839 Ga0207642_10058306
840 Ga0207710_10000400
841 Ga0207688_10077238
842 Ga0207688_10100824
843 Ga0207680_10113536
844 Ga0207645_10318219
845 Ga0207643_10280904
846 Ga0207705_10069152
847 Ga0207705_10161360
848 Ga0207654_10000025
849 Ga0207654_10000035
850 Ga0207654_10000242
851 Ga0207654_10001907
852 Ga0207654_10016753
853 Ga0207654_10045021
854 Ga0207654_10048073
855 Ga0207707_10143521
856 Ga0207707_10371156
857 Ga0207695_10000069
858 Ga0207695_10000098
859 Ga0207695_10000314
860 Ga0207695_10005123
861 Ga0207695_10013741
862 Ga0207695_10066107
863 Ga0207695_10067444
864 Ga0207671_10000246
865 Ga0207671_10000600
866 Ga0207671_10072528
867 Ga0207671_10074896
868 Ga0207663_10040627
869 Ga0207657_10017446
870 Ga0207657_10143825
871 Ga0207657_10329702
872 Ga0207649_10001308
873 Ga0207649_10045913
874 Ga0207649_10069164
875 Ga0207649_10086597
876 Ga0207694_10000105
877 Ga0207694_10000731
878 Ga0207694_10000906
879 Ga0207694_10030836
880 Ga0207694_10854970
881 Ga0207650_10080679
882 Ga0207650_10564021
883 Ga0207659_10061014
884 Ga0207687_10007385
885 Ga0207687_10189420
886 Ga0207687_10439764
887 Ga0207700_10700728
888 Ga0207664_10412327
889 Ga0207644_10011256
890 Ga0207644_10068283
891 Ga0207644_10159675
892 Ga0207706_10019854
893 Ga0207706_10089850
894 Ga0207686_10810399
895 Ga0207704_10079719
896 Ga0207704_10406132
897 Ga0207691_10035911
898 Ga0207691_10045314
899 Ga0207711_10001943
900 Ga0207711_10026843
901 Ga0207711_10325419
902 Ga0207711_10422976
903 Ga0207689_10000553
904 Ga0207689_10043383
905 Ga0207689_10081797
906 Ga0207661_10001411
907 Ga0207661_10119768
908 Ga0207661_10178115
909 Ga0207661_10293475
910 Ga0207679_10035833
911 Ga0207667_10008591
912 Ga0207667_10012909
913 Ga0207667_10040358
914 Ga0207667_10067691
915 Ga0207667_10091331
916 Ga0207667_10107145
917 Ga0207667_10422801
918 Ga0207667_10748255
919 Ga0207640_10028027
920 Ga0207640_10129060
921 Ga0207640_10145210
922 Ga0207640_10224745
923 Ga0207658_10000386
924 Ga0207677_10000104
925 Ga0207677_10350350
926 Ga0207703_10009371
927 Ga0207639_10000229
928 Ga0207639_10012651
929 Ga0207639_10090629
930 Ga0207639_10101113
931 Ga0207678_10024779
932 Ga0207702_10000633
933 Ga0207702_10016523
934 Ga0207702_10043824
935 Ga0207702_10172920
936 Ga0207702_10296044
937 Ga0207702_10795123
938 Ga0207641_10000609
939 Ga0207648_10039382
940 Ga0207648_10056284
941 Ga0207676_10004630
942 Ga0207676_10591050
943 Ga0207674_10004842
944 Ga0207674_10057073
945 Ga0207675_100094960
946 Ga0207683_10006339
947 Ga0207683_10427709
948 Ga0207698_10000006
949 Ga0207698_10000825
950 Ga0207698_10052035
951 Ga0207698_10120118
952 Ga0207698_10148346
953 Ga0207698_10189937
954 Ga0207698_10251809
955 Ga0207698_10302533
956 Ga0207698_10370632
957 Ga0207428_10080414
958 Ga0268266_10294911
959 Ga0268265_10097158
960 Ga0268264_10000877
961 Ga0265334_10047310
962 Ga0265318_10023502
963 Ga0265323_10031549
964 Ga0265336_10008530
965 Ga0265338_10000162
966 Ga0265338_10005396
967 Ga0265338_10141145
968 Ga0265324_10098292
969 Ga0265330_10002017
970 Ga0265330_10009189
971 Ga0265330_10012566
972 Ga0265330_10061509
973 Ga0265332_10077493
974 Ga0265332_10189284
975 Ga0265328_10017201
976 Ga0265328_10082459
977 Ga0265320_10086978
978 Ga0265320_10088195
979 Ga0265325_10000021
980 Ga0265325_10004377
981 Ga0265325_10024308
982 Ga0265325_10025072
983 Ga0265325_10036964
984 Ga0265325_10045807
985 Ga0265325_10051798
986 Ga0265325_10131550
987 Ga0265325_10156106
988 Ga0265329_10007377
989 Ga0265329_10038447
990 Ga0265340_10005916
991 Ga0265340_10019534
992 Ga0265340_10027108
993 Ga0265339_10000136
994 Ga0265339_10010265
995 Ga0265339_10024090
996 Ga0265339_10040867
997 Ga0265331_10084766
998 Ga0265331_10195603
999 Ga0265327_10041802
1000 Ga0265316_10005832
1001 Ga0265316_10008198
1002 Ga0265316_10008943
1003 Ga0265316_10011985
1004 Ga0265316_10012787
1005 Ga0265316_10020472
1006 Ga0265316_10036751
1007 Ga0265316_10150825
1008 Ga0265316_10218101
1009 Ga0265316_10246964
1010 Ga0265313_10000001
1011 Ga0265313_10006832
1012 Ga0265313_10008708
1013 Ga0265313_10032025
1014 Ga0265313_10152867
1015 Ga0265314_10000025
1016 Ga0265314_10014112
1017 Ga0265314_10078605
1018 Ga0265314_10212173
1019 Ga0265342_10001637
1020 Ga0265342_10003974
1021 Ga0265342_10006636
1022 Ga0265342_10006650
1023 Ga0265342_10007652
1024 Ga0265342_10008308
1025 Ga0265342_10013407
1026 Ga0265342_10064715
1027 Ga0316577_10081419
1028 Ga0316214_1022653
1029 Ga0373954_0048793
1030 Ga0373931_0355318
1031 Ga0373933_0071091
1032 Ga0373937_0018887
1033 Ga0373937_0157832
1034 Ga0373937_0182886
1035 Ga0436365_0734353
1036 Ga0436361_1165009
1037 Ga0451577_0000218
1038 Ga0451577_0021057
1039 Ga0466963_0661930
1040 Ga0453684_0000193
1041 Ga0453684_0187421
1042 Ga0466967_0036298
1043 Ga0495603_0079300
1044 Ga0495629_0076242
1045 Ga0495580_0101475
1046 Ga0495580_0209508
1047 Ga0495605_0107266
1048 Ga0495628_0540450
1049 Ga0495665_0229325
1050 Ga0495586_0486591
1051 Ga0495635_0162898
1052 Ga0495588_0343746
1053 Ga0495657_0494022
1054 Ga0495623_0105701
1055 Ga0495613_0081369
1056 Ga0495676_0336808
1057 Ga0495677_0161926
1058 Ga0495602_0088647
1059 Ga0495602_0534970
1060 Ga0496100_0241569
1061 Ga0496101_0014693
1062 Ga0496101_0077694
1063 Ga0496104_0102501
1064 Ga0496104_1025395
1065 Ga0496105_0095076
1066 Ga0496105_0161747
1067 Ga0496105_0382811
1068 Ga0496106_0030667
1069 Ga0496106_0177953
1070 Ga0496107_0382402
1071 Ga0496107_0544255
1072 Ga0496108_0337979
1073 Ga0496110_0320484
1074 Ga0496113_0203345
1075 Ga0496114_0563782
1076 Ga0496115_0038512
1077 Ga0496115_0103487
1078 Ga0496115_0598934
1079 Ga0501031_0112065
1080 Ga0501031_0441622
1081 Ga0501032_0223352
1082 Ga0501033_0089185
1083 Ga0501033_0107467
1084 Ga0501033_0283676
1085 Ga0501034_0117023
1086 Ga0501034_0990963
1087 Ga0501036_0059447
1088 Ga0501037_0035493
1089 Ga0501037_0040189
1090 Ga0501038_0078895
1091 Ga0501038_0086960
1092 Ga0501039_0002466
1093 Ga0501039_0017482
1094 Ga0501039_0019732
1095 Ga0501040_0006838
1096 Ga0501040_0030479
1097 Ga0501041_0002270
1098 Ga0501041_0014578
1099 Ga0501041_0162775
1100 Ga0501042_0008363
1101 Ga0501042_0032508
1102 Ga0501042_0059930
1103 Ga0501043_0127723
1104 Ga0501043_0218231
1105 Ga0501046_0003994
1106 Ga0501046_0025257
1107 Ga0501048_0002970
1108 Ga0501048_0058802
1109 Ga0501067_0237489
1110 Ga0501068_0046216
1111 Ga0501068_0065994
1112 Ga0501070_0016054
1113 Ga0501070_0092493
1114 Ga0501071_0002225
1115 Ga0501071_0012387
1116 Ga0501071_0144391
1117 Ga0501071_0443754
1118 Ga0501072_0001495
1119 Ga0501072_0109694
1120 Ga0501072_0365741
1121 Ga0501073_0031207
1122 Ga0501073_0222711
1123 Ga0501074_0007102
1124 Ga0501074_0020818
1125 Ga0501074_0087323
1126 Ga0501075_0004886
1127 Ga0501075_0319810
1128 Ga0501076_0028951
1129 Ga0501076_0033393
1130 Ga0501076_0050902
1131 Ga0501076_0533303
1132 Ga0501077_0000849
1133 Ga0501077_0002849
1134 Ga0501077_0110893
1135 Ga0501079_0002376
1136 Ga0501079_0002802
1137 Ga0501079_0043810
1138 Ga0501080_0004429
1139 Ga0501080_0010361
1140 Ga0501080_0472032
1141 Ga0501081_0001603
1142 Ga0501081_0019030
1143 Ga0501081_0036827
1144 Ga0501083_0064815
1145 Ga0501083_0174413
1146 Ga0501035_0048872
1147 Ga0501035_0097178
1148 Ga0501035_0498618
1149 Ga0501035_0648839
1150 Ga0501044_0464267
1151 Ga0501045_0002913
1152 Ga0501045_0245916
1153 nmdc:mga08y16_193063_c1
1154 nmdc:mga0n895_196459_c1
1155 Ga0495601_0122627
1156 Ga0501084_0000979
1157 Ga0501084_0005173
1158 Ga0501084_0421321
1159 Ga0501084_1011261
1160 Ga0501082_0008181
1161 Ga0501082_0113838
1162 Ga0501082_0128161
1163 Ga0501082_0446285
1164 Ga0466962_0277806
1165 Ga0530510_0070031
1166 Ga0530510_0237061

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

22

220

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjn-assembly1.cif.gz_A crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9807 1 194
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9794 1 192
5x7j-assembly1.cif.gz_A crystal structure of thymidylate kinase from thermus thermophilus hb8 0.9723 1 195
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9689 1 192
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.9673 1 195
ID Description Score Start End Superfamily
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9654 1 195 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9628 2 192 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9521 2 192 3.40.50.300
3ld9C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9473 1 195 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9413 1 195 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538G2L1-F1-model_v4 dTMP kinase (EC 2.7.4.9) 0.9995 1 131 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A538G2L1-F1-model_v4 dTMP kinase (EC 2.7.4.9) 0.9919 1 131 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-D7BL55-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9892 1 194 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A1H2LCR9-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9875 1 194 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A345NQ44-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9866 1 194 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map