F466286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 238 | 1166 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10017861|Ga0265338_100178614 |
| Length | 234 |
| Sequence | LVVTVNCGDILKPMPRGLFITLEGLDGSGKTTQIKRLAAWLESRGLEPVITRQPGGTVIGDRIRAILLDSRSTGLGSMTEMALMFADRAQAIAEVIQPSLDAGRIVVCDRFTDSTEAYQGGGRQLGSEVVLDLHRVICGNLQPDITILLLPSLSASLGRARRRNTREEAQTGKDENRFELEQDGFHRRVWEKYHEIAKREPNRVVLIEGDLSIDEIHEQIVQVISGRLVSGVGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 201 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 238 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.26 |
| Rhizosphere | 95.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10017861 | 3300028800 | Bacteria | 7622 |
| 2 | JGI24738J21930_10006916 | 3300002075 | Bacteria | 2635 |
| 3 | JGI25406J46586_10033250 | 3300003203 | Bacteria | 1906 |
| 4 | rootH2_10084729 | 3300003320 | Unclassified | 1351 |
| 5 | rootH2_10197888 | 3300003320 | Bacteria | 2338 |
| 6 | rootL2_10252766 | 3300003322 | Bacteria | 1449 |
| 7 | Ga0070658_10004389 | 3300005327 | Bacteria | 11501 |
| 8 | Ga0070658_10015432 | 3300005327 | Bacteria | 6112 |
| 9 | Ga0070658_10299431 | 3300005327 | Bacteria | 1371 |
| 10 | Ga0070676_10340322 | 3300005328 | Unclassified | 1028 |
| 11 | Ga0070676_10512892 | 3300005328 | Bacteria | 853 |
| 12 | Ga0070683_100024648 | 3300005329 | Bacteria | 5392 |
| 13 | Ga0070683_100051518 | 3300005329 | Bacteria | 3812 |
| 14 | Ga0070683_100070815 | 3300005329 | Bacteria | 3253 |
| 15 | Ga0070683_100110676 | 3300005329 | Bacteria | 2591 |
| 16 | Ga0070683_100145534 | 3300005329 | Bacteria | 2245 |
| 17 | Ga0070670_100095694 | 3300005331 | Bacteria | 2555 |
| 18 | Ga0070670_100301814 | 3300005331 | Unclassified | 1401 |
| 19 | Ga0070670_100561346 | 3300005331 | Bacteria | 1019 |
| 20 | Ga0068869_100000150 | 3300005334 | Bacteria | 34437 |
| 21 | Ga0068869_100025480 | 3300005334 | Unclassified | 4107 |
| 22 | Ga0070666_10076863 | 3300005335 | Unclassified | 2278 |
| 23 | Ga0070680_100350317 | 3300005336 | Bacteria | 1256 |
| 24 | Ga0070682_100006770 | 3300005337 | Bacteria | 6429 |
| 25 | Ga0068868_100011365 | 3300005338 | Bacteria | 6483 |
| 26 | Ga0068868_100023398 | 3300005338 | Bacteria | 4675 |
| 27 | Ga0068868_100046123 | 3300005338 | Bacteria | 3411 |
| 28 | Ga0070660_100051716 | 3300005339 | Bacteria | 3165 |
| 29 | Ga0070660_100277556 | 3300005339 | Unclassified | 1371 |
| 30 | Ga0070691_10005504 | 3300005341 | Bacteria | 5763 |
| 31 | Ga0070661_100048234 | 3300005344 | Bacteria | 3117 |
| 32 | Ga0070661_100049905 | 3300005344 | Unclassified | 3063 |
| 33 | Ga0070661_100069938 | 3300005344 | Bacteria | 2581 |
| 34 | Ga0070692_10007609 | 3300005345 | Bacteria | 4782 |
| 35 | Ga0070668_100084541 | 3300005347 | Unclassified | 2492 |
| 36 | Ga0070669_100884686 | 3300005353 | Bacteria | 762 |
| 37 | Ga0070675_100066321 | 3300005354 | Bacteria | 2985 |
| 38 | Ga0070675_100269717 | 3300005354 | Unclassified | 1493 |
| 39 | Ga0070671_100190049 | 3300005355 | Bacteria | 1740 |
| 40 | Ga0070671_100203872 | 3300005355 | Unclassified | 1677 |
| 41 | Ga0070671_100252035 | 3300005355 | Bacteria | 1499 |
| 42 | Ga0070674_100013758 | 3300005356 | Bacteria | 5008 |
| 43 | Ga0070673_100009294 | 3300005364 | Bacteria | 6595 |
| 44 | Ga0070673_100219038 | 3300005364 | Unclassified | 1647 |
| 45 | Ga0070688_100353099 | 3300005365 | Bacteria | 1077 |
| 46 | Ga0070659_100012742 | 3300005366 | Bacteria | 6241 |
| 47 | Ga0070659_100339518 | 3300005366 | Unclassified | 1258 |
| 48 | Ga0070667_100000615 | 3300005367 | Bacteria | 34719 |
| 49 | Ga0070667_100021139 | 3300005367 | Bacteria | 5406 |
| 50 | Ga0070714_100165890 | 3300005435 | Bacteria | 2002 |
| 51 | Ga0070714_100773283 | 3300005435 | Bacteria | 929 |
| 52 | Ga0070713_100356448 | 3300005436 | Unclassified | 1358 |
| 53 | Ga0070713_100598591 | 3300005436 | Bacteria | 1047 |
| 54 | Ga0070701_10098665 | 3300005438 | Bacteria | 1614 |
| 55 | Ga0070711_100047352 | 3300005439 | Unclassified | 2935 |
| 56 | Ga0070694_100057016 | 3300005444 | Bacteria | 2655 |
| 57 | Ga0070694_100259513 | 3300005444 | Bacteria | 1318 |
| 58 | Ga0070663_100005606 | 3300005455 | Bacteria | 7474 |
| 59 | Ga0070663_100013862 | 3300005455 | Bacteria | 5157 |
| 60 | Ga0070678_100386058 | 3300005456 | Bacteria | 1213 |
| 61 | Ga0070662_100016136 | 3300005457 | Bacteria | 5011 |
| 62 | Ga0070681_10137033 | 3300005458 | Bacteria | 2378 |
| 63 | Ga0070681_10165308 | 3300005458 | Bacteria | 2135 |
| 64 | Ga0070681_10453079 | 3300005458 | Bacteria | 1195 |
| 65 | Ga0068867_100031327 | 3300005459 | Bacteria | 3838 |
| 66 | Ga0070685_10155435 | 3300005466 | Unclassified | 1453 |
| 67 | Ga0070679_100084112 | 3300005530 | Bacteria | 3170 |
| 68 | Ga0070679_100724304 | 3300005530 | Bacteria | 937 |
| 69 | Ga0070684_100010320 | 3300005535 | Bacteria | 7397 |
| 70 | Ga0070684_100031318 | 3300005535 | Unclassified | 4527 |
| 71 | Ga0070684_100048924 | 3300005535 | Bacteria | 3668 |
| 72 | Ga0070684_100076121 | 3300005535 | Unclassified | 2961 |
| 73 | Ga0070684_100093939 | 3300005535 | Bacteria | 2671 |
| 74 | Ga0070684_100311156 | 3300005535 | Bacteria | 1446 |
| 75 | Ga0068853_100000530 | 3300005539 | Bacteria | 25896 |
| 76 | Ga0068853_100014928 | 3300005539 | Bacteria | 6380 |
| 77 | Ga0068853_100274309 | 3300005539 | Bacteria | 1553 |
| 78 | Ga0068853_100307105 | 3300005539 | Unclassified | 1468 |
| 79 | Ga0068853_100542999 | 3300005539 | Bacteria | 1100 |
| 80 | Ga0070672_100014075 | 3300005543 | Bacteria | 5660 |
| 81 | Ga0070672_100066769 | 3300005543 | Unclassified | 2849 |
| 82 | Ga0070686_100155016 | 3300005544 | Bacteria | 1607 |
| 83 | Ga0070665_100132439 | 3300005548 | Bacteria | 2495 |
| 84 | Ga0070665_100223444 | 3300005548 | Unclassified | 1884 |
| 85 | Ga0070665_100346043 | 3300005548 | Bacteria | 1492 |
| 86 | Ga0068855_100005975 | 3300005563 | Bacteria | 14851 |
| 87 | Ga0068855_100012946 | 3300005563 | Bacteria | 10063 |
| 88 | Ga0068855_100029327 | 3300005563 | Bacteria | 6579 |
| 89 | Ga0068855_100588611 | 3300005563 | Bacteria | 1201 |
| 90 | Ga0070664_100050189 | 3300005564 | Bacteria | 3530 |
| 91 | Ga0070664_100407779 | 3300005564 | Bacteria | 1243 |
| 92 | Ga0068857_100013990 | 3300005577 | Bacteria | 6981 |
| 93 | Ga0068857_100103864 | 3300005577 | Unclassified | 2551 |
| 94 | Ga0068854_100003705 | 3300005578 | Bacteria | 9564 |
| 95 | Ga0068854_100128226 | 3300005578 | Bacteria | 1934 |
| 96 | Ga0068854_100364250 | 3300005578 | Unclassified | 1187 |
| 97 | Ga0068856_100006867 | 3300005614 | Bacteria | 11134 |
| 98 | Ga0068856_100008208 | 3300005614 | Bacteria | 10180 |
| 99 | Ga0068856_100035436 | 3300005614 | Bacteria | 4891 |
| 100 | Ga0068856_100062054 | 3300005614 | Unclassified | 3692 |
| 101 | Ga0068856_100070891 | 3300005614 | Unclassified | 3448 |
| 102 | Ga0068852_100000015 | 3300005616 | Bacteria | 134085 |
| 103 | Ga0068852_100000818 | 3300005616 | Bacteria | 20560 |
| 104 | Ga0068852_100039859 | 3300005616 | Bacteria | 3958 |
| 105 | Ga0068852_100181781 | 3300005616 | Unclassified | 1978 |
| 106 | Ga0068852_100336456 | 3300005616 | Bacteria | 1470 |
| 107 | Ga0068852_100370995 | 3300005616 | Unclassified | 1402 |
| 108 | Ga0068859_100018768 | 3300005617 | Bacteria | 6950 |
| 109 | Ga0068859_101141280 | 3300005617 | Bacteria | 858 |
| 110 | Ga0068864_100000358 | 3300005618 | Bacteria | 40190 |
| 111 | Ga0068864_100142180 | 3300005618 | Unclassified | 2166 |
| 112 | Ga0068864_100554099 | 3300005618 | Bacteria | 1112 |
| 113 | Ga0068866_10006436 | 3300005718 | Bacteria | 4891 |
| 114 | Ga0068866_10098299 | 3300005718 | Unclassified | 1609 |
| 115 | Ga0068861_100055769 | 3300005719 | Bacteria | 3014 |
| 116 | Ga0068851_10008453 | 3300005834 | Bacteria | 4758 |
| 117 | Ga0068851_10105111 | 3300005834 | Bacteria | 1502 |
| 118 | Ga0068851_10279031 | 3300005834 | Bacteria | 955 |
| 119 | Ga0068870_10222343 | 3300005840 | Bacteria | 1156 |
| 120 | Ga0068863_100011647 | 3300005841 | Bacteria | 8507 |
| 121 | Ga0068863_100137686 | 3300005841 | Unclassified | 2332 |
| 122 | Ga0068858_100013624 | 3300005842 | Bacteria | 7674 |
| 123 | Ga0068858_100161074 | 3300005842 | Unclassified | 2112 |
| 124 | Ga0068860_100001581 | 3300005843 | Bacteria | 24522 |
| 125 | Ga0068860_100229221 | 3300005843 | Unclassified | 1805 |
| 126 | Ga0068862_100042776 | 3300005844 | Unclassified | 3860 |
| 127 | Ga0068862_100082592 | 3300005844 | Bacteria | 2789 |
| 128 | Ga0081539_10000957 | 3300005985 | Bacteria | 54155 |
| 129 | Ga0070717_10024780 | 3300006028 | Bacteria | 4767 |
| 130 | Ga0070717_10719633 | 3300006028 | Unclassified | 907 |
| 131 | Ga0075432_10053263 | 3300006058 | Bacteria | 1431 |
| 132 | Ga0070712_100064020 | 3300006175 | Unclassified | 2606 |
| 133 | Ga0097621_100001213 | 3300006237 | Bacteria | 17844 |
| 134 | Ga0097621_100024594 | 3300006237 | Bacteria | 4705 |
| 135 | Ga0097621_100030755 | 3300006237 | Bacteria | 4254 |
| 136 | Ga0097621_100084150 | 3300006237 | Unclassified | 2651 |
| 137 | Ga0068871_100003512 | 3300006358 | Bacteria | 10789 |
| 138 | Ga0068871_100020659 | 3300006358 | Bacteria | 5049 |
| 139 | Ga0068871_100073717 | 3300006358 | Bacteria | 2815 |
| 140 | Ga0068871_100095091 | 3300006358 | Unclassified | 2488 |
| 141 | Ga0075430_100258943 | 3300006846 | Bacteria | 1441 |
| 142 | Ga0068865_100024937 | 3300006881 | Bacteria | 3927 |
| 143 | Ga0068865_100121832 | 3300006881 | Unclassified | 1941 |
| 144 | Ga0068865_100372006 | 3300006881 | Bacteria | 1163 |
| 145 | Ga0097620_100018768 | 3300006931 | Bacteria | 6950 |
| 146 | Ga0097620_101141313 | 3300006931 | Bacteria | 858 |
| 147 | Ga0105240_10000181 | 3300009093 | Bacteria | 128067 |
| 148 | Ga0105240_10000284 | 3300009093 | Bacteria | 99440 |
| 149 | Ga0105240_10000296 | 3300009093 | Bacteria | 96854 |
| 150 | Ga0105240_10001725 | 3300009093 | Bacteria | 36900 |
| 151 | Ga0105240_10005322 | 3300009093 | Bacteria | 19201 |
| 152 | Ga0105240_10008237 | 3300009093 | Bacteria | 14934 |
| 153 | Ga0105240_10009478 | 3300009093 | Bacteria | 13784 |
| 154 | Ga0105240_10605900 | 3300009093 | Bacteria | 1205 |
| 155 | Ga0111539_10008274 | 3300009094 | Bacteria | 13240 |
| 156 | Ga0105245_10003458 | 3300009098 | Bacteria | 14151 |
| 157 | Ga0105245_10008935 | 3300009098 | Bacteria | 8742 |
| 158 | Ga0105245_10029759 | 3300009098 | Unclassified | 4827 |
| 159 | Ga0105245_10102106 | 3300009098 | Bacteria | 2655 |
| 160 | Ga0105245_10222976 | 3300009098 | Bacteria | 1820 |
| 161 | Ga0105245_10424928 | 3300009098 | Bacteria | 1333 |
| 162 | Ga0105245_10776725 | 3300009098 | Bacteria | 995 |
| 163 | Ga0105245_10894197 | 3300009098 | Bacteria | 929 |
| 164 | Ga0105247_10008004 | 3300009101 | Bacteria | 6459 |
| 165 | Ga0105243_10006362 | 3300009148 | Bacteria | 9123 |
| 166 | Ga0105243_10659693 | 3300009148 | Unclassified | 1015 |
| 167 | Ga0105243_11214325 | 3300009148 | Bacteria | 768 |
| 168 | Ga0105241_10000076 | 3300009174 | Bacteria | 74496 |
| 169 | Ga0105241_10001468 | 3300009174 | Bacteria | 18078 |
| 170 | Ga0105241_10005434 | 3300009174 | Bacteria | 9425 |
| 171 | Ga0105241_10024306 | 3300009174 | Unclassified | 4500 |
| 172 | Ga0105241_10027837 | 3300009174 | Unclassified | 4209 |
| 173 | Ga0105241_10034554 | 3300009174 | Unclassified | 3799 |
| 174 | Ga0105241_10050664 | 3300009174 | Unclassified | 3165 |
| 175 | Ga0105242_10064075 | 3300009176 | Bacteria | 3028 |
| 176 | Ga0105242_10151228 | 3300009176 | Unclassified | 2024 |
| 177 | Ga0105248_10003308 | 3300009177 | Bacteria | 17887 |
| 178 | Ga0105248_10005054 | 3300009177 | Bacteria | 14566 |
| 179 | Ga0105248_10148850 | 3300009177 | Bacteria | 2641 |
| 180 | Ga0105248_10231909 | 3300009177 | Unclassified | 2078 |
| 181 | Ga0105248_10725092 | 3300009177 | Bacteria | 1122 |
| 182 | Ga0105237_10003829 | 3300009545 | Bacteria | 17685 |
| 183 | Ga0105237_10005020 | 3300009545 | Bacteria | 15062 |
| 184 | Ga0105237_10033720 | 3300009545 | Bacteria | 5186 |
| 185 | Ga0105237_10057390 | 3300009545 | Unclassified | 3896 |
| 186 | Ga0105238_10000338 | 3300009551 | Bacteria | 51021 |
| 187 | Ga0105238_10001760 | 3300009551 | Bacteria | 21726 |
| 188 | Ga0105238_10007626 | 3300009551 | Bacteria | 10841 |
| 189 | Ga0105238_10034782 | 3300009551 | Bacteria | 5124 |
| 190 | Ga0105238_10066898 | 3300009551 | Unclassified | 3594 |
| 191 | Ga0105238_10074187 | 3300009551 | Bacteria | 3395 |
| 192 | Ga0105239_10002626 | 3300010375 | Bacteria | 22720 |
| 193 | Ga0105239_10003936 | 3300010375 | Bacteria | 17989 |
| 194 | Ga0105239_10020385 | 3300010375 | Bacteria | 7314 |
| 195 | Ga0105239_10026372 | 3300010375 | Bacteria | 6395 |
| 196 | Ga0105239_10060299 | 3300010375 | Unclassified | 4164 |
| 197 | Ga0105239_11180267 | 3300010375 | Bacteria | 882 |
| 198 | Ga0105246_10064944 | 3300011119 | Unclassified | 2551 |
| 199 | Ga0105246_10078484 | 3300011119 | Bacteria | 2345 |
| 200 | Ga0105246_10513803 | 3300011119 | Bacteria | 1019 |
| 201 | Ga0157370_10000196 | 3300013104 | Bacteria | 75917 |
| 202 | Ga0157370_10060302 | 3300013104 | Bacteria | 3602 |
| 203 | Ga0157370_10375740 | 3300013104 | Bacteria | 1309 |
| 204 | Ga0157369_10000400 | 3300013105 | Bacteria | 57821 |
| 205 | Ga0157369_10002310 | 3300013105 | Bacteria | 22945 |
| 206 | Ga0157369_10008267 | 3300013105 | Bacteria | 11926 |
| 207 | Ga0157369_10018719 | 3300013105 | Bacteria | 7765 |
| 208 | Ga0157369_10090017 | 3300013105 | Unclassified | 3276 |
| 209 | Ga0157369_10103170 | 3300013105 | Unclassified | 3038 |
| 210 | Ga0157369_10371220 | 3300013105 | Unclassified | 1485 |
| 211 | Ga0157369_11284214 | 3300013105 | Bacteria | 746 |
| 212 | Ga0157369_11286315 | 3300013105 | Unclassified | 746 |
| 213 | Ga0157374_10002118 | 3300013296 | Bacteria | 16704 |
| 214 | Ga0157374_10048831 | 3300013296 | Bacteria | 3928 |
| 215 | Ga0157374_10084085 | 3300013296 | Unclassified | 3024 |
| 216 | Ga0157374_10106892 | 3300013296 | Bacteria | 2689 |
| 217 | Ga0157374_10575778 | 3300013296 | Bacteria | 1135 |
| 218 | Ga0157378_10003633 | 3300013297 | Bacteria | 13652 |
| 219 | Ga0157378_10026180 | 3300013297 | Bacteria | 5142 |
| 220 | Ga0157378_10343053 | 3300013297 | Bacteria | 1457 |
| 221 | Ga0163162_10055200 | 3300013306 | Bacteria | 3998 |
| 222 | Ga0163162_10701841 | 3300013306 | Bacteria | 1133 |
| 223 | Ga0157372_10000197 | 3300013307 | Bacteria | 66368 |
| 224 | Ga0157372_10009082 | 3300013307 | Bacteria | 10564 |
| 225 | Ga0157372_10046817 | 3300013307 | Bacteria | 4802 |
| 226 | Ga0157372_10110076 | 3300013307 | Unclassified | 3155 |
| 227 | Ga0157372_10128958 | 3300013307 | Unclassified | 2909 |
| 228 | Ga0157372_10220622 | 3300013307 | Bacteria | 2198 |
| 229 | Ga0157372_10359114 | 3300013307 | Bacteria | 1697 |
| 230 | Ga0157372_10651782 | 3300013307 | Bacteria | 1226 |
| 231 | Ga0157372_10745693 | 3300013307 | Bacteria | 1139 |
| 232 | Ga0157375_10034136 | 3300013308 | Bacteria | 4843 |
| 233 | Ga0157375_10038671 | 3300013308 | Unclassified | 4582 |
| 234 | Ga0157375_10091583 | 3300013308 | Unclassified | 3102 |
| 235 | Ga0163163_10001714 | 3300014325 | Bacteria | 18490 |
| 236 | Ga0163163_10069345 | 3300014325 | Unclassified | 3510 |
| 237 | Ga0163163_10745429 | 3300014325 | Bacteria | 1043 |
| 238 | Ga0157380_10164499 | 3300014326 | Bacteria | 1932 |
| 239 | Ga0157380_10206384 | 3300014326 | Bacteria | 1747 |
| 240 | Ga0157380_10380386 | 3300014326 | Bacteria | 1332 |
| 241 | Ga0157377_10031739 | 3300014745 | Bacteria | 2872 |
| 242 | Ga0157377_10109673 | 3300014745 | Unclassified | 1657 |
| 243 | Ga0157379_10000092 | 3300014968 | Bacteria | 60487 |
| 244 | Ga0157379_10005905 | 3300014968 | Bacteria | 10538 |
| 245 | Ga0157379_10032549 | 3300014968 | Bacteria | 4648 |
| 246 | Ga0157379_10316945 | 3300014968 | Unclassified | 1423 |
| 247 | Ga0157376_10004219 | 3300014969 | Bacteria | 9972 |
| 248 | Ga0157376_10015353 | 3300014969 | Bacteria | 5784 |
| 249 | Ga0157376_10321034 | 3300014969 | Unclassified | 1472 |
| 250 | Ga0157376_10581743 | 3300014969 | Bacteria | 1112 |
| 251 | Ga0213872_10054390 | 3300021361 | Unclassified | 1815 |
| 252 | Ga0207656_10003700 | 3300025321 | Bacteria | 5293 |
| 253 | Ga0207656_10003773 | 3300025321 | Bacteria | 5247 |
| 254 | Ga0207656_10118420 | 3300025321 | Unclassified | 1231 |
| 255 | Ga0207656_10186972 | 3300025321 | Bacteria | 996 |
| 256 | Ga0207642_10058306 | 3300025899 | Bacteria | 1781 |
| 257 | Ga0207710_10000400 | 3300025900 | Bacteria | 28981 |
| 258 | Ga0207688_10077238 | 3300025901 | Unclassified | 1897 |
| 259 | Ga0207688_10100824 | 3300025901 | Bacteria | 1667 |
| 260 | Ga0207680_10113536 | 3300025903 | Unclassified | 1761 |
| 261 | Ga0207645_10318219 | 3300025907 | Unclassified | 1038 |
| 262 | Ga0207643_10280904 | 3300025908 | Bacteria | 1032 |
| 263 | Ga0207705_10069152 | 3300025909 | Unclassified | 2557 |
| 264 | Ga0207705_10161360 | 3300025909 | Unclassified | 1684 |
| 265 | Ga0207654_10000025 | 3300025911 | Bacteria | 143807 |
| 266 | Ga0207654_10000035 | 3300025911 | Bacteria | 112494 |
| 267 | Ga0207654_10000242 | 3300025911 | Bacteria | 33063 |
| 268 | Ga0207654_10001907 | 3300025911 | Bacteria | 10824 |
| 269 | Ga0207654_10016753 | 3300025911 | Bacteria | 3819 |
| 270 | Ga0207654_10045021 | 3300025911 | Bacteria | 2509 |
| 271 | Ga0207654_10048073 | 3300025911 | Unclassified | 2440 |
| 272 | Ga0207707_10143521 | 3300025912 | Bacteria | 2087 |
| 273 | Ga0207707_10371156 | 3300025912 | Bacteria | 1231 |
| 274 | Ga0207695_10000069 | 3300025913 | Bacteria | 319955 |
| 275 | Ga0207695_10000098 | 3300025913 | Bacteria | 261213 |
| 276 | Ga0207695_10000314 | 3300025913 | Bacteria | 116506 |
| 277 | Ga0207695_10005123 | 3300025913 | Bacteria | 17549 |
| 278 | Ga0207695_10013741 | 3300025913 | Bacteria | 9634 |
| 279 | Ga0207695_10066107 | 3300025913 | Bacteria | 3715 |
| 280 | Ga0207695_10067444 | 3300025913 | Unclassified | 3670 |
| 281 | Ga0207671_10000246 | 3300025914 | Bacteria | 81042 |
| 282 | Ga0207671_10000600 | 3300025914 | Bacteria | 47921 |
| 283 | Ga0207671_10072528 | 3300025914 | Unclassified | 2570 |
| 284 | Ga0207671_10074896 | 3300025914 | Unclassified | 2531 |
| 285 | Ga0207663_10040627 | 3300025916 | Unclassified | 2829 |
| 286 | Ga0207657_10017446 | 3300025919 | Bacteria | 6881 |
| 287 | Ga0207657_10143825 | 3300025919 | Bacteria | 1947 |
| 288 | Ga0207657_10329702 | 3300025919 | Unclassified | 1206 |
| 289 | Ga0207649_10001308 | 3300025920 | Bacteria | 14860 |
| 290 | Ga0207649_10045913 | 3300025920 | Unclassified | 2680 |
| 291 | Ga0207649_10069164 | 3300025920 | Bacteria | 2247 |
| 292 | Ga0207649_10086597 | 3300025920 | Bacteria | 2042 |
| 293 | Ga0207694_10000105 | 3300025924 | Bacteria | 89920 |
| 294 | Ga0207694_10000731 | 3300025924 | Bacteria | 29493 |
| 295 | Ga0207694_10000906 | 3300025924 | Bacteria | 26217 |
| 296 | Ga0207694_10030836 | 3300025924 | Bacteria | 4093 |
| 297 | Ga0207694_10854970 | 3300025924 | Bacteria | 769 |
| 298 | Ga0207650_10080679 | 3300025925 | Bacteria | 2467 |
| 299 | Ga0207650_10564021 | 3300025925 | Bacteria | 955 |
| 300 | Ga0207659_10061014 | 3300025926 | Bacteria | 2716 |
| 301 | Ga0207687_10007385 | 3300025927 | Bacteria | 7238 |
| 302 | Ga0207687_10189420 | 3300025927 | Unclassified | 1600 |
| 303 | Ga0207687_10439764 | 3300025927 | Bacteria | 1080 |
| 304 | Ga0207700_10700728 | 3300025928 | Bacteria | 904 |
| 305 | Ga0207664_10412327 | 3300025929 | Bacteria | 1202 |
| 306 | Ga0207644_10011256 | 3300025931 | Bacteria | 5914 |
| 307 | Ga0207644_10068283 | 3300025931 | Unclassified | 2593 |
| 308 | Ga0207644_10159675 | 3300025931 | Bacteria | 1751 |
| 309 | Ga0207706_10019854 | 3300025933 | Bacteria | 6040 |
| 310 | Ga0207706_10089850 | 3300025933 | Bacteria | 2701 |
| 311 | Ga0207686_10810399 | 3300025934 | Bacteria | 751 |
| 312 | Ga0207704_10079719 | 3300025938 | Unclassified | 2111 |
| 313 | Ga0207704_10406132 | 3300025938 | Bacteria | 1076 |
| 314 | Ga0207691_10035911 | 3300025940 | Bacteria | 4595 |
| 315 | Ga0207691_10045314 | 3300025940 | Unclassified | 4043 |
| 316 | Ga0207711_10001943 | 3300025941 | Bacteria | 18756 |
| 317 | Ga0207711_10026843 | 3300025941 | Bacteria | 4833 |
| 318 | Ga0207711_10325419 | 3300025941 | Bacteria | 1421 |
| 319 | Ga0207711_10422976 | 3300025941 | Unclassified | 1239 |
| 320 | Ga0207689_10000553 | 3300025942 | Bacteria | 35691 |
| 321 | Ga0207689_10043383 | 3300025942 | Bacteria | 3718 |
| 322 | Ga0207689_10081797 | 3300025942 | Bacteria | 2655 |
| 323 | Ga0207661_10001411 | 3300025944 | Bacteria | 16200 |
| 324 | Ga0207661_10119768 | 3300025944 | Bacteria | 2239 |
| 325 | Ga0207661_10178115 | 3300025944 | Unclassified | 1855 |
| 326 | Ga0207661_10293475 | 3300025944 | Bacteria | 1456 |
| 327 | Ga0207679_10035833 | 3300025945 | Bacteria | 3514 |
| 328 | Ga0207667_10008591 | 3300025949 | Bacteria | 12122 |
| 329 | Ga0207667_10012909 | 3300025949 | Bacteria | 9596 |
| 330 | Ga0207667_10040358 | 3300025949 | Unclassified | 4970 |
| 331 | Ga0207667_10067691 | 3300025949 | Bacteria | 3719 |
| 332 | Ga0207667_10091331 | 3300025949 | Bacteria | 3146 |
| 333 | Ga0207667_10107145 | 3300025949 | Bacteria | 2883 |
| 334 | Ga0207667_10422801 | 3300025949 | Unclassified | 1356 |
| 335 | Ga0207667_10748255 | 3300025949 | Bacteria | 977 |
| 336 | Ga0207640_10028027 | 3300025981 | Bacteria | 3438 |
| 337 | Ga0207640_10129060 | 3300025981 | Unclassified | 1824 |
| 338 | Ga0207640_10145210 | 3300025981 | Unclassified | 1735 |
| 339 | Ga0207640_10224745 | 3300025981 | Bacteria | 1440 |
| 340 | Ga0207658_10000386 | 3300025986 | Bacteria | 42878 |
| 341 | Ga0207677_10000104 | 3300026023 | Bacteria | 70036 |
| 342 | Ga0207677_10350350 | 3300026023 | Bacteria | 1237 |
| 343 | Ga0207703_10009371 | 3300026035 | Bacteria | 7695 |
| 344 | Ga0207639_10000229 | 3300026041 | Bacteria | 41820 |
| 345 | Ga0207639_10012651 | 3300026041 | Bacteria | 5883 |
| 346 | Ga0207639_10090629 | 3300026041 | Unclassified | 2446 |
| 347 | Ga0207639_10101113 | 3300026041 | Bacteria | 2330 |
| 348 | Ga0207678_10024779 | 3300026067 | Bacteria | 5238 |
| 349 | Ga0207702_10000633 | 3300026078 | Bacteria | 38531 |
| 350 | Ga0207702_10016523 | 3300026078 | Bacteria | 6108 |
| 351 | Ga0207702_10043824 | 3300026078 | Bacteria | 3758 |
| 352 | Ga0207702_10172920 | 3300026078 | Bacteria | 1982 |
| 353 | Ga0207702_10296044 | 3300026078 | Unclassified | 1534 |
| 354 | Ga0207702_10795123 | 3300026078 | Bacteria | 935 |
| 355 | Ga0207641_10000609 | 3300026088 | Bacteria | 39264 |
| 356 | Ga0207648_10039382 | 3300026089 | Bacteria | 4156 |
| 357 | Ga0207648_10056284 | 3300026089 | Bacteria | 3433 |
| 358 | Ga0207676_10004630 | 3300026095 | Bacteria | 9734 |
| 359 | Ga0207676_10591050 | 3300026095 | Bacteria | 1065 |
| 360 | Ga0207674_10004842 | 3300026116 | Bacteria | 16117 |
| 361 | Ga0207674_10057073 | 3300026116 | Unclassified | 3959 |
| 362 | Ga0207675_100094960 | 3300026118 | Bacteria | 2805 |
| 363 | Ga0207683_10006339 | 3300026121 | Bacteria | 10133 |
| 364 | Ga0207683_10427709 | 3300026121 | Bacteria | 1220 |
| 365 | Ga0207698_10000006 | 3300026142 | Bacteria | 291847 |
| 366 | Ga0207698_10000825 | 3300026142 | Bacteria | 17916 |
| 367 | Ga0207698_10052035 | 3300026142 | Unclassified | 3135 |
| 368 | Ga0207698_10120118 | 3300026142 | Bacteria | 2222 |
| 369 | Ga0207698_10148346 | 3300026142 | Unclassified | 2032 |
| 370 | Ga0207698_10189937 | 3300026142 | Bacteria | 1828 |
| 371 | Ga0207698_10251809 | 3300026142 | Bacteria | 1617 |
| 372 | Ga0207698_10302533 | 3300026142 | Bacteria | 1489 |
| 373 | Ga0207698_10370632 | 3300026142 | Unclassified | 1359 |
| 374 | Ga0207428_10080414 | 3300027907 | Bacteria | 2547 |
| 375 | Ga0268266_10294911 | 3300028379 | Bacteria | 1511 |
| 376 | Ga0268265_10097158 | 3300028380 | Bacteria | 2369 |
| 377 | Ga0268264_10000877 | 3300028381 | Bacteria | 31797 |
| 378 | Ga0265334_10047310 | 3300028573 | Bacteria | 1660 |
| 379 | Ga0265318_10023502 | 3300028577 | Bacteria | 2456 |
| 380 | Ga0265323_10031549 | 3300028653 | Bacteria | 1969 |
| 381 | Ga0265336_10008530 | 3300028666 | Bacteria | 3591 |
| 382 | Ga0265338_10000162 | 3300028800 | Bacteria | 121694 |
| 383 | Ga0265338_10005396 | 3300028800 | Bacteria | 16702 |
| 384 | Ga0265338_10141145 | 3300028800 | Unclassified | 1886 |
| 385 | Ga0265324_10098292 | 3300029957 | Bacteria | 995 |
| 386 | Ga0265330_10002017 | 3300031235 | Bacteria | 11274 |
| 387 | Ga0265330_10009189 | 3300031235 | Bacteria | 4708 |
| 388 | Ga0265330_10012566 | 3300031235 | Unclassified | 3959 |
| 389 | Ga0265330_10061509 | 3300031235 | Bacteria | 1634 |
| 390 | Ga0265332_10077493 | 3300031238 | Bacteria | 1412 |
| 391 | Ga0265332_10189284 | 3300031238 | Unclassified | 856 |
| 392 | Ga0265328_10017201 | 3300031239 | Bacteria | 2802 |
| 393 | Ga0265328_10082459 | 3300031239 | Bacteria | 1185 |
| 394 | Ga0265320_10086978 | 3300031240 | Unclassified | 1452 |
| 395 | Ga0265320_10088195 | 3300031240 | Bacteria | 1439 |
| 396 | Ga0265325_10000021 | 3300031241 | Bacteria | 124310 |
| 397 | Ga0265325_10004377 | 3300031241 | Bacteria | 8936 |
| 398 | Ga0265325_10024308 | 3300031241 | Bacteria | 3297 |
| 399 | Ga0265325_10025072 | 3300031241 | Bacteria | 3240 |
| 400 | Ga0265325_10036964 | 3300031241 | Unclassified | 2584 |
| 401 | Ga0265325_10045807 | 3300031241 | Unclassified | 2271 |
| 402 | Ga0265325_10051798 | 3300031241 | Bacteria | 2109 |
| 403 | Ga0265325_10131550 | 3300031241 | Bacteria | 1197 |
| 404 | Ga0265325_10156106 | 3300031241 | Bacteria | 1076 |
| 405 | Ga0265329_10007377 | 3300031242 | Bacteria | 4264 |
| 406 | Ga0265329_10038447 | 3300031242 | Bacteria | 1539 |
| 407 | Ga0265340_10005916 | 3300031247 | Bacteria | 6762 |
| 408 | Ga0265340_10019534 | 3300031247 | Bacteria | 3489 |
| 409 | Ga0265340_10027108 | 3300031247 | Bacteria | 2890 |
| 410 | Ga0265339_10000136 | 3300031249 | Bacteria | 60534 |
| 411 | Ga0265339_10010265 | 3300031249 | Bacteria | 5827 |
| 412 | Ga0265339_10024090 | 3300031249 | Bacteria | 3511 |
| 413 | Ga0265339_10040867 | 3300031249 | Bacteria | 2576 |
| 414 | Ga0265331_10084766 | 3300031250 | Bacteria | 1468 |
| 415 | Ga0265331_10195603 | 3300031250 | Bacteria | 911 |
| 416 | Ga0265327_10041802 | 3300031251 | Bacteria | 2466 |
| 417 | Ga0265316_10005832 | 3300031344 | Bacteria | 11874 |
| 418 | Ga0265316_10008198 | 3300031344 | Bacteria | 9724 |
| 419 | Ga0265316_10008943 | 3300031344 | Bacteria | 9242 |
| 420 | Ga0265316_10011985 | 3300031344 | Bacteria | 7793 |
| 421 | Ga0265316_10012787 | 3300031344 | Bacteria | 7499 |
| 422 | Ga0265316_10020472 | 3300031344 | Bacteria | 5630 |
| 423 | Ga0265316_10036751 | 3300031344 | Bacteria | 3959 |
| 424 | Ga0265316_10150825 | 3300031344 | Bacteria | 1741 |
| 425 | Ga0265316_10218101 | 3300031344 | Bacteria | 1409 |
| 426 | Ga0265316_10246964 | 3300031344 | Bacteria | 1311 |
| 427 | Ga0265313_10000001 | 3300031595 | Bacteria | 313647 |
| 428 | Ga0265313_10006832 | 3300031595 | Bacteria | 7963 |
| 429 | Ga0265313_10008708 | 3300031595 | Bacteria | 6704 |
| 430 | Ga0265313_10032025 | 3300031595 | Bacteria | 2689 |
| 431 | Ga0265313_10152867 | 3300031595 | Bacteria | 985 |
| 432 | Ga0265314_10000025 | 3300031711 | Bacteria | 292548 |
| 433 | Ga0265314_10014112 | 3300031711 | Bacteria | 6414 |
| 434 | Ga0265314_10078605 | 3300031711 | Unclassified | 2184 |
| 435 | Ga0265314_10212173 | 3300031711 | Bacteria | 1136 |
| 436 | Ga0265342_10001637 | 3300031712 | Bacteria | 20649 |
| 437 | Ga0265342_10003974 | 3300031712 | Bacteria | 11842 |
| 438 | Ga0265342_10006636 | 3300031712 | Bacteria | 8589 |
| 439 | Ga0265342_10006650 | 3300031712 | Bacteria | 8577 |
| 440 | Ga0265342_10007652 | 3300031712 | Bacteria | 7868 |
| 441 | Ga0265342_10008308 | 3300031712 | Bacteria | 7466 |
| 442 | Ga0265342_10013407 | 3300031712 | Bacteria | 5501 |
| 443 | Ga0265342_10064715 | 3300031712 | Unclassified | 2145 |
| 444 | Ga0316577_10081419 | 3300031733 | Bacteria | 1810 |
| 445 | Ga0316214_1022653 | 3300033545 | Bacteria | 882 |
| 446 | Ga0373954_0048793 | 3300035118 | Bacteria | 1984 |
| 447 | Ga0373931_0355318 | 3300035691 | Unclassified | 918 |
| 448 | Ga0373933_0071091 | 3300035724 | Unclassified | 2118 |
| 449 | Ga0373937_0018887 | 3300036401 | Bacteria | 6162 |
| 450 | Ga0373937_0157832 | 3300036401 | Bacteria | 2127 |
| 451 | Ga0373937_0182886 | 3300036401 | Bacteria | 1969 |
| 452 | Ga0436365_0734353 | 3300039437 | Bacteria | 2456 |
| 453 | Ga0436361_1165009 | 3300039447 | Unclassified | 1888 |
| 454 | Ga0451577_0000218 | 3300042876 | Bacteria | 118324 |
| 455 | Ga0451577_0021057 | 3300042876 | Bacteria | 5975 |
| 456 | Ga0466963_0661930 | 3300044694 | Unclassified | 737 |
| 457 | Ga0453684_0000193 | 3300044712 | Bacteria | 266146 |
| 458 | Ga0453684_0187421 | 3300044712 | Bacteria | 2423 |
| 459 | Ga0466967_0036298 | 3300045976 | Unclassified | 4206 |
| 460 | Ga0495603_0079300 | 3300046455 | Bacteria | 1925 |
| 461 | Ga0495629_0076242 | 3300046459 | Bacteria | 2341 |
| 462 | Ga0495580_0101475 | 3300046472 | Bacteria | 2001 |
| 463 | Ga0495580_0209508 | 3300046472 | Bacteria | 1341 |
| 464 | Ga0495605_0107266 | 3300046474 | Bacteria | 1278 |
| 465 | Ga0495628_0540450 | 3300046516 | Bacteria | 838 |
| 466 | Ga0495665_0229325 | 3300046531 | Bacteria | 959 |
| 467 | Ga0495586_0486591 | 3300046535 | Bacteria | 712 |
| 468 | Ga0495635_0162898 | 3300046663 | Unclassified | 1518 |
| 469 | Ga0495588_0343746 | 3300046674 | Bacteria | 784 |
| 470 | Ga0495657_0494022 | 3300046675 | Bacteria | 714 |
| 471 | Ga0495623_0105701 | 3300046679 | Bacteria | 1711 |
| 472 | Ga0495613_0081369 | 3300046689 | Bacteria | 2353 |
| 473 | Ga0495676_0336808 | 3300047321 | Bacteria | 1011 |
| 474 | Ga0495677_0161926 | 3300047445 | Bacteria | 864 |
| 475 | Ga0495602_0088647 | 3300048088 | Bacteria | 2575 |
| 476 | Ga0495602_0534970 | 3300048088 | Bacteria | 814 |
| 477 | Ga0496100_0241569 | 3300048903 | Unclassified | 1333 |
| 478 | Ga0496101_0014693 | 3300048904 | Bacteria | 5268 |
| 479 | Ga0496101_0077694 | 3300048904 | Bacteria | 2447 |
| 480 | Ga0496104_0102501 | 3300048907 | Bacteria | 2741 |
| 481 | Ga0496104_1025395 | 3300048907 | Bacteria | 729 |
| 482 | Ga0496105_0095076 | 3300048908 | Bacteria | 2461 |
| 483 | Ga0496105_0161747 | 3300048908 | Bacteria | 1838 |
| 484 | Ga0496105_0382811 | 3300048908 | Bacteria | 1119 |
| 485 | Ga0496106_0030667 | 3300048909 | Bacteria | 4008 |
| 486 | Ga0496106_0177953 | 3300048909 | Bacteria | 1688 |
| 487 | Ga0496107_0382402 | 3300048910 | Bacteria | 1047 |
| 488 | Ga0496107_0544255 | 3300048910 | Bacteria | 860 |
| 489 | Ga0496108_0337979 | 3300048911 | Bacteria | 1314 |
| 490 | Ga0496110_0320484 | 3300048913 | Bacteria | 1412 |
| 491 | Ga0496113_0203345 | 3300048916 | Bacteria | 1575 |
| 492 | Ga0496114_0563782 | 3300048917 | Bacteria | 1006 |
| 493 | Ga0496115_0038512 | 3300048918 | Bacteria | 3794 |
| 494 | Ga0496115_0103487 | 3300048918 | Bacteria | 2336 |
| 495 | Ga0496115_0598934 | 3300048918 | Bacteria | 876 |
| 496 | Ga0501031_0112065 | 3300049568 | Bacteria | 1781 |
| 497 | Ga0501031_0441622 | 3300049568 | Bacteria | 841 |
| 498 | Ga0501032_0223352 | 3300049569 | Bacteria | 1225 |
| 499 | Ga0501033_0089185 | 3300049570 | Bacteria | 2256 |
| 500 | Ga0501033_0107467 | 3300049570 | Bacteria | 2032 |
| 501 | Ga0501033_0283676 | 3300049570 | Bacteria | 1169 |
| 502 | Ga0501034_0117023 | 3300049571 | Bacteria | 2653 |
| 503 | Ga0501034_0990963 | 3300049571 | Bacteria | 725 |
| 504 | Ga0501036_0059447 | 3300049572 | Bacteria | 3238 |
| 505 | Ga0501037_0035493 | 3300049573 | Bacteria | 3677 |
| 506 | Ga0501037_0040189 | 3300049573 | Bacteria | 3442 |
| 507 | Ga0501038_0078895 | 3300049574 | Bacteria | 2777 |
| 508 | Ga0501038_0086960 | 3300049574 | Bacteria | 2625 |
| 509 | Ga0501039_0002466 | 3300049575 | Bacteria | 13772 |
| 510 | Ga0501039_0017482 | 3300049575 | Bacteria | 5501 |
| 511 | Ga0501039_0019732 | 3300049575 | Bacteria | 5169 |
| 512 | Ga0501040_0006838 | 3300049576 | Bacteria | 7393 |
| 513 | Ga0501040_0030479 | 3300049576 | Bacteria | 3643 |
| 514 | Ga0501041_0002270 | 3300049577 | Bacteria | 10872 |
| 515 | Ga0501041_0014578 | 3300049577 | Bacteria | 4667 |
| 516 | Ga0501041_0162775 | 3300049577 | Bacteria | 1395 |
| 517 | Ga0501042_0008363 | 3300049578 | Bacteria | 6824 |
| 518 | Ga0501042_0032508 | 3300049578 | Bacteria | 3695 |
| 519 | Ga0501042_0059930 | 3300049578 | Bacteria | 2718 |
| 520 | Ga0501043_0127723 | 3300049579 | Bacteria | 1993 |
| 521 | Ga0501043_0218231 | 3300049579 | Bacteria | 1476 |
| 522 | Ga0501046_0003994 | 3300049580 | Bacteria | 13467 |
| 523 | Ga0501046_0025257 | 3300049580 | Bacteria | 4863 |
| 524 | Ga0501048_0002970 | 3300049582 | Bacteria | 12941 |
| 525 | Ga0501048_0058802 | 3300049582 | Bacteria | 2724 |
| 526 | Ga0501067_0237489 | 3300049583 | Bacteria | 1014 |
| 527 | Ga0501068_0046216 | 3300049584 | Bacteria | 2625 |
| 528 | Ga0501068_0065994 | 3300049584 | Bacteria | 2204 |
| 529 | Ga0501070_0016054 | 3300049586 | Bacteria | 6293 |
| 530 | Ga0501070_0092493 | 3300049586 | Bacteria | 2503 |
| 531 | Ga0501071_0002225 | 3300049587 | Bacteria | 11665 |
| 532 | Ga0501071_0012387 | 3300049587 | Bacteria | 5784 |
| 533 | Ga0501071_0144391 | 3300049587 | Bacteria | 1773 |
| 534 | Ga0501071_0443754 | 3300049587 | Bacteria | 993 |
| 535 | Ga0501072_0001495 | 3300049588 | Bacteria | 17508 |
| 536 | Ga0501072_0109694 | 3300049588 | Bacteria | 2196 |
| 537 | Ga0501072_0365741 | 3300049588 | Bacteria | 1145 |
| 538 | Ga0501073_0031207 | 3300049589 | Bacteria | 3802 |
| 539 | Ga0501073_0222711 | 3300049589 | Bacteria | 1303 |
| 540 | Ga0501074_0007102 | 3300049590 | Bacteria | 8094 |
| 541 | Ga0501074_0020818 | 3300049590 | Bacteria | 4765 |
| 542 | Ga0501074_0087323 | 3300049590 | Bacteria | 2233 |
| 543 | Ga0501075_0004886 | 3300049591 | Bacteria | 9133 |
| 544 | Ga0501075_0319810 | 3300049591 | Bacteria | 1182 |
| 545 | Ga0501076_0028951 | 3300049592 | Bacteria | 4304 |
| 546 | Ga0501076_0033393 | 3300049592 | Bacteria | 4017 |
| 547 | Ga0501076_0050902 | 3300049592 | Bacteria | 3277 |
| 548 | Ga0501076_0533303 | 3300049592 | Bacteria | 968 |
| 549 | Ga0501077_0000849 | 3300049593 | Bacteria | 18453 |
| 550 | Ga0501077_0002849 | 3300049593 | Bacteria | 10370 |
| 551 | Ga0501077_0110893 | 3300049593 | Bacteria | 1739 |
| 552 | Ga0501079_0002376 | 3300049741 | Bacteria | 13672 |
| 553 | Ga0501079_0002802 | 3300049741 | Bacteria | 12707 |
| 554 | Ga0501079_0043810 | 3300049741 | Bacteria | 3454 |
| 555 | Ga0501080_0004429 | 3300049742 | Bacteria | 12495 |
| 556 | Ga0501080_0010361 | 3300049742 | Bacteria | 8524 |
| 557 | Ga0501080_0472032 | 3300049742 | Bacteria | 1123 |
| 558 | Ga0501081_0001603 | 3300049743 | Bacteria | 13977 |
| 559 | Ga0501081_0019030 | 3300049743 | Bacteria | 4567 |
| 560 | Ga0501081_0036827 | 3300049743 | Bacteria | 3336 |
| 561 | Ga0501083_0064815 | 3300049744 | Bacteria | 2434 |
| 562 | Ga0501083_0174413 | 3300049744 | Bacteria | 1405 |
| 563 | Ga0501035_0048872 | 3300049822 | Bacteria | 3792 |
| 564 | Ga0501035_0097178 | 3300049822 | Bacteria | 2587 |
| 565 | Ga0501035_0498618 | 3300049822 | Bacteria | 1002 |
| 566 | Ga0501035_0648839 | 3300049822 | Bacteria | 856 |
| 567 | Ga0501044_0464267 | 3300049823 | Bacteria | 1171 |
| 568 | Ga0501045_0002913 | 3300049824 | Bacteria | 11693 |
| 569 | Ga0501045_0245916 | 3300049824 | Bacteria | 1331 |
| 570 | nmdc:mga08y16_193063_c1 | 3300050511 | Bacteria | 2112 |
| 571 | nmdc:mga0n895_196459_c1 | 3300050512 | Bacteria | 2048 |
| 572 | Ga0495601_0122627 | 3300053077 | Bacteria | 1689 |
| 573 | Ga0501084_0000979 | 3300054114 | Bacteria | 22169 |
| 574 | Ga0501084_0005173 | 3300054114 | Bacteria | 10669 |
| 575 | Ga0501084_0421321 | 3300054114 | Bacteria | 1128 |
| 576 | Ga0501084_1011261 | 3300054114 | Bacteria | 698 |
| 577 | Ga0501082_0008181 | 3300060353 | Bacteria | 9026 |
| 578 | Ga0501082_0113838 | 3300060353 | Bacteria | 2342 |
| 579 | Ga0501082_0128161 | 3300060353 | Bacteria | 2201 |
| 580 | Ga0501082_0446285 | 3300060353 | Bacteria | 1130 |
| 581 | Ga0466962_0277806 | 3300061719 | Bacteria | 826 |
| 582 | Ga0530510_0070031 | 3300061734 | Bacteria | 2545 |
| 583 | Ga0530510_0237061 | 3300061734 | Bacteria | 1358 |
| 584 | Ga0265338_10017861 | |||
| 585 | JGI24738J21930_10006916 | |||
| 586 | JGI25406J46586_10033250 | |||
| 587 | rootH2_10084729 | |||
| 588 | rootH2_10197888 | |||
| 589 | rootL2_10252766 | |||
| 590 | Ga0070658_10004389 | |||
| 591 | Ga0070658_10015432 | |||
| 592 | Ga0070658_10299431 | |||
| 593 | Ga0070676_10340322 | |||
| 594 | Ga0070676_10512892 | |||
| 595 | Ga0070683_100024648 | |||
| 596 | Ga0070683_100051518 | |||
| 597 | Ga0070683_100070815 | |||
| 598 | Ga0070683_100110676 | |||
| 599 | Ga0070683_100145534 | |||
| 600 | Ga0070670_100095694 | |||
| 601 | Ga0070670_100301814 | |||
| 602 | Ga0070670_100561346 | |||
| 603 | Ga0068869_100000150 | |||
| 604 | Ga0068869_100025480 | |||
| 605 | Ga0070666_10076863 | |||
| 606 | Ga0070680_100350317 | |||
| 607 | Ga0070682_100006770 | |||
| 608 | Ga0068868_100011365 | |||
| 609 | Ga0068868_100023398 | |||
| 610 | Ga0068868_100046123 | |||
| 611 | Ga0070660_100051716 | |||
| 612 | Ga0070660_100277556 | |||
| 613 | Ga0070691_10005504 | |||
| 614 | Ga0070661_100048234 | |||
| 615 | Ga0070661_100049905 | |||
| 616 | Ga0070661_100069938 | |||
| 617 | Ga0070692_10007609 | |||
| 618 | Ga0070668_100084541 | |||
| 619 | Ga0070669_100884686 | |||
| 620 | Ga0070675_100066321 | |||
| 621 | Ga0070675_100269717 | |||
| 622 | Ga0070671_100190049 | |||
| 623 | Ga0070671_100203872 | |||
| 624 | Ga0070671_100252035 | |||
| 625 | Ga0070674_100013758 | |||
| 626 | Ga0070673_100009294 | |||
| 627 | Ga0070673_100219038 | |||
| 628 | Ga0070688_100353099 | |||
| 629 | Ga0070659_100012742 | |||
| 630 | Ga0070659_100339518 | |||
| 631 | Ga0070667_100000615 | |||
| 632 | Ga0070667_100021139 | |||
| 633 | Ga0070714_100165890 | |||
| 634 | Ga0070714_100773283 | |||
| 635 | Ga0070713_100356448 | |||
| 636 | Ga0070713_100598591 | |||
| 637 | Ga0070701_10098665 | |||
| 638 | Ga0070711_100047352 | |||
| 639 | Ga0070694_100057016 | |||
| 640 | Ga0070694_100259513 | |||
| 641 | Ga0070663_100005606 | |||
| 642 | Ga0070663_100013862 | |||
| 643 | Ga0070678_100386058 | |||
| 644 | Ga0070662_100016136 | |||
| 645 | Ga0070681_10137033 | |||
| 646 | Ga0070681_10165308 | |||
| 647 | Ga0070681_10453079 | |||
| 648 | Ga0068867_100031327 | |||
| 649 | Ga0070685_10155435 | |||
| 650 | Ga0070679_100084112 | |||
| 651 | Ga0070679_100724304 | |||
| 652 | Ga0070684_100010320 | |||
| 653 | Ga0070684_100031318 | |||
| 654 | Ga0070684_100048924 | |||
| 655 | Ga0070684_100076121 | |||
| 656 | Ga0070684_100093939 | |||
| 657 | Ga0070684_100311156 | |||
| 658 | Ga0068853_100000530 | |||
| 659 | Ga0068853_100014928 | |||
| 660 | Ga0068853_100274309 | |||
| 661 | Ga0068853_100307105 | |||
| 662 | Ga0068853_100542999 | |||
| 663 | Ga0070672_100014075 | |||
| 664 | Ga0070672_100066769 | |||
| 665 | Ga0070686_100155016 | |||
| 666 | Ga0070665_100132439 | |||
| 667 | Ga0070665_100223444 | |||
| 668 | Ga0070665_100346043 | |||
| 669 | Ga0068855_100005975 | |||
| 670 | Ga0068855_100012946 | |||
| 671 | Ga0068855_100029327 | |||
| 672 | Ga0068855_100588611 | |||
| 673 | Ga0070664_100050189 | |||
| 674 | Ga0070664_100407779 | |||
| 675 | Ga0068857_100013990 | |||
| 676 | Ga0068857_100103864 | |||
| 677 | Ga0068854_100003705 | |||
| 678 | Ga0068854_100128226 | |||
| 679 | Ga0068854_100364250 | |||
| 680 | Ga0068856_100006867 | |||
| 681 | Ga0068856_100008208 | |||
| 682 | Ga0068856_100035436 | |||
| 683 | Ga0068856_100062054 | |||
| 684 | Ga0068856_100070891 | |||
| 685 | Ga0068852_100000015 | |||
| 686 | Ga0068852_100000818 | |||
| 687 | Ga0068852_100039859 | |||
| 688 | Ga0068852_100181781 | |||
| 689 | Ga0068852_100336456 | |||
| 690 | Ga0068852_100370995 | |||
| 691 | Ga0068859_100018768 | |||
| 692 | Ga0068859_101141280 | |||
| 693 | Ga0068864_100000358 | |||
| 694 | Ga0068864_100142180 | |||
| 695 | Ga0068864_100554099 | |||
| 696 | Ga0068866_10006436 | |||
| 697 | Ga0068866_10098299 | |||
| 698 | Ga0068861_100055769 | |||
| 699 | Ga0068851_10008453 | |||
| 700 | Ga0068851_10105111 | |||
| 701 | Ga0068851_10279031 | |||
| 702 | Ga0068870_10222343 | |||
| 703 | Ga0068863_100011647 | |||
| 704 | Ga0068863_100137686 | |||
| 705 | Ga0068858_100013624 | |||
| 706 | Ga0068858_100161074 | |||
| 707 | Ga0068860_100001581 | |||
| 708 | Ga0068860_100229221 | |||
| 709 | Ga0068862_100042776 | |||
| 710 | Ga0068862_100082592 | |||
| 711 | Ga0081539_10000957 | |||
| 712 | Ga0070717_10024780 | |||
| 713 | Ga0070717_10719633 | |||
| 714 | Ga0075432_10053263 | |||
| 715 | Ga0070712_100064020 | |||
| 716 | Ga0097621_100001213 | |||
| 717 | Ga0097621_100024594 | |||
| 718 | Ga0097621_100030755 | |||
| 719 | Ga0097621_100084150 | |||
| 720 | Ga0068871_100003512 | |||
| 721 | Ga0068871_100020659 | |||
| 722 | Ga0068871_100073717 | |||
| 723 | Ga0068871_100095091 | |||
| 724 | Ga0075430_100258943 | |||
| 725 | Ga0068865_100024937 | |||
| 726 | Ga0068865_100121832 | |||
| 727 | Ga0068865_100372006 | |||
| 728 | Ga0097620_100018768 | |||
| 729 | Ga0097620_101141313 | |||
| 730 | Ga0105240_10000181 | |||
| 731 | Ga0105240_10000284 | |||
| 732 | Ga0105240_10000296 | |||
| 733 | Ga0105240_10001725 | |||
| 734 | Ga0105240_10005322 | |||
| 735 | Ga0105240_10008237 | |||
| 736 | Ga0105240_10009478 | |||
| 737 | Ga0105240_10605900 | |||
| 738 | Ga0111539_10008274 | |||
| 739 | Ga0105245_10003458 | |||
| 740 | Ga0105245_10008935 | |||
| 741 | Ga0105245_10029759 | |||
| 742 | Ga0105245_10102106 | |||
| 743 | Ga0105245_10222976 | |||
| 744 | Ga0105245_10424928 | |||
| 745 | Ga0105245_10776725 | |||
| 746 | Ga0105245_10894197 | |||
| 747 | Ga0105247_10008004 | |||
| 748 | Ga0105243_10006362 | |||
| 749 | Ga0105243_10659693 | |||
| 750 | Ga0105243_11214325 | |||
| 751 | Ga0105241_10000076 | |||
| 752 | Ga0105241_10001468 | |||
| 753 | Ga0105241_10005434 | |||
| 754 | Ga0105241_10024306 | |||
| 755 | Ga0105241_10027837 | |||
| 756 | Ga0105241_10034554 | |||
| 757 | Ga0105241_10050664 | |||
| 758 | Ga0105242_10064075 | |||
| 759 | Ga0105242_10151228 | |||
| 760 | Ga0105248_10003308 | |||
| 761 | Ga0105248_10005054 | |||
| 762 | Ga0105248_10148850 | |||
| 763 | Ga0105248_10231909 | |||
| 764 | Ga0105248_10725092 | |||
| 765 | Ga0105237_10003829 | |||
| 766 | Ga0105237_10005020 | |||
| 767 | Ga0105237_10033720 | |||
| 768 | Ga0105237_10057390 | |||
| 769 | Ga0105238_10000338 | |||
| 770 | Ga0105238_10001760 | |||
| 771 | Ga0105238_10007626 | |||
| 772 | Ga0105238_10034782 | |||
| 773 | Ga0105238_10066898 | |||
| 774 | Ga0105238_10074187 | |||
| 775 | Ga0105239_10002626 | |||
| 776 | Ga0105239_10003936 | |||
| 777 | Ga0105239_10020385 | |||
| 778 | Ga0105239_10026372 | |||
| 779 | Ga0105239_10060299 | |||
| 780 | Ga0105239_11180267 | |||
| 781 | Ga0105246_10064944 | |||
| 782 | Ga0105246_10078484 | |||
| 783 | Ga0105246_10513803 | |||
| 784 | Ga0157370_10000196 | |||
| 785 | Ga0157370_10060302 | |||
| 786 | Ga0157370_10375740 | |||
| 787 | Ga0157369_10000400 | |||
| 788 | Ga0157369_10002310 | |||
| 789 | Ga0157369_10008267 | |||
| 790 | Ga0157369_10018719 | |||
| 791 | Ga0157369_10090017 | |||
| 792 | Ga0157369_10103170 | |||
| 793 | Ga0157369_10371220 | |||
| 794 | Ga0157369_11284214 | |||
| 795 | Ga0157369_11286315 | |||
| 796 | Ga0157374_10002118 | |||
| 797 | Ga0157374_10048831 | |||
| 798 | Ga0157374_10084085 | |||
| 799 | Ga0157374_10106892 | |||
| 800 | Ga0157374_10575778 | |||
| 801 | Ga0157378_10003633 | |||
| 802 | Ga0157378_10026180 | |||
| 803 | Ga0157378_10343053 | |||
| 804 | Ga0163162_10055200 | |||
| 805 | Ga0163162_10701841 | |||
| 806 | Ga0157372_10000197 | |||
| 807 | Ga0157372_10009082 | |||
| 808 | Ga0157372_10046817 | |||
| 809 | Ga0157372_10110076 | |||
| 810 | Ga0157372_10128958 | |||
| 811 | Ga0157372_10220622 | |||
| 812 | Ga0157372_10359114 | |||
| 813 | Ga0157372_10651782 | |||
| 814 | Ga0157372_10745693 | |||
| 815 | Ga0157375_10034136 | |||
| 816 | Ga0157375_10038671 | |||
| 817 | Ga0157375_10091583 | |||
| 818 | Ga0163163_10001714 | |||
| 819 | Ga0163163_10069345 | |||
| 820 | Ga0163163_10745429 | |||
| 821 | Ga0157380_10164499 | |||
| 822 | Ga0157380_10206384 | |||
| 823 | Ga0157380_10380386 | |||
| 824 | Ga0157377_10031739 | |||
| 825 | Ga0157377_10109673 | |||
| 826 | Ga0157379_10000092 | |||
| 827 | Ga0157379_10005905 | |||
| 828 | Ga0157379_10032549 | |||
| 829 | Ga0157379_10316945 | |||
| 830 | Ga0157376_10004219 | |||
| 831 | Ga0157376_10015353 | |||
| 832 | Ga0157376_10321034 | |||
| 833 | Ga0157376_10581743 | |||
| 834 | Ga0213872_10054390 | |||
| 835 | Ga0207656_10003700 | |||
| 836 | Ga0207656_10003773 | |||
| 837 | Ga0207656_10118420 | |||
| 838 | Ga0207656_10186972 | |||
| 839 | Ga0207642_10058306 | |||
| 840 | Ga0207710_10000400 | |||
| 841 | Ga0207688_10077238 | |||
| 842 | Ga0207688_10100824 | |||
| 843 | Ga0207680_10113536 | |||
| 844 | Ga0207645_10318219 | |||
| 845 | Ga0207643_10280904 | |||
| 846 | Ga0207705_10069152 | |||
| 847 | Ga0207705_10161360 | |||
| 848 | Ga0207654_10000025 | |||
| 849 | Ga0207654_10000035 | |||
| 850 | Ga0207654_10000242 | |||
| 851 | Ga0207654_10001907 | |||
| 852 | Ga0207654_10016753 | |||
| 853 | Ga0207654_10045021 | |||
| 854 | Ga0207654_10048073 | |||
| 855 | Ga0207707_10143521 | |||
| 856 | Ga0207707_10371156 | |||
| 857 | Ga0207695_10000069 | |||
| 858 | Ga0207695_10000098 | |||
| 859 | Ga0207695_10000314 | |||
| 860 | Ga0207695_10005123 | |||
| 861 | Ga0207695_10013741 | |||
| 862 | Ga0207695_10066107 | |||
| 863 | Ga0207695_10067444 | |||
| 864 | Ga0207671_10000246 | |||
| 865 | Ga0207671_10000600 | |||
| 866 | Ga0207671_10072528 | |||
| 867 | Ga0207671_10074896 | |||
| 868 | Ga0207663_10040627 | |||
| 869 | Ga0207657_10017446 | |||
| 870 | Ga0207657_10143825 | |||
| 871 | Ga0207657_10329702 | |||
| 872 | Ga0207649_10001308 | |||
| 873 | Ga0207649_10045913 | |||
| 874 | Ga0207649_10069164 | |||
| 875 | Ga0207649_10086597 | |||
| 876 | Ga0207694_10000105 | |||
| 877 | Ga0207694_10000731 | |||
| 878 | Ga0207694_10000906 | |||
| 879 | Ga0207694_10030836 | |||
| 880 | Ga0207694_10854970 | |||
| 881 | Ga0207650_10080679 | |||
| 882 | Ga0207650_10564021 | |||
| 883 | Ga0207659_10061014 | |||
| 884 | Ga0207687_10007385 | |||
| 885 | Ga0207687_10189420 | |||
| 886 | Ga0207687_10439764 | |||
| 887 | Ga0207700_10700728 | |||
| 888 | Ga0207664_10412327 | |||
| 889 | Ga0207644_10011256 | |||
| 890 | Ga0207644_10068283 | |||
| 891 | Ga0207644_10159675 | |||
| 892 | Ga0207706_10019854 | |||
| 893 | Ga0207706_10089850 | |||
| 894 | Ga0207686_10810399 | |||
| 895 | Ga0207704_10079719 | |||
| 896 | Ga0207704_10406132 | |||
| 897 | Ga0207691_10035911 | |||
| 898 | Ga0207691_10045314 | |||
| 899 | Ga0207711_10001943 | |||
| 900 | Ga0207711_10026843 | |||
| 901 | Ga0207711_10325419 | |||
| 902 | Ga0207711_10422976 | |||
| 903 | Ga0207689_10000553 | |||
| 904 | Ga0207689_10043383 | |||
| 905 | Ga0207689_10081797 | |||
| 906 | Ga0207661_10001411 | |||
| 907 | Ga0207661_10119768 | |||
| 908 | Ga0207661_10178115 | |||
| 909 | Ga0207661_10293475 | |||
| 910 | Ga0207679_10035833 | |||
| 911 | Ga0207667_10008591 | |||
| 912 | Ga0207667_10012909 | |||
| 913 | Ga0207667_10040358 | |||
| 914 | Ga0207667_10067691 | |||
| 915 | Ga0207667_10091331 | |||
| 916 | Ga0207667_10107145 | |||
| 917 | Ga0207667_10422801 | |||
| 918 | Ga0207667_10748255 | |||
| 919 | Ga0207640_10028027 | |||
| 920 | Ga0207640_10129060 | |||
| 921 | Ga0207640_10145210 | |||
| 922 | Ga0207640_10224745 | |||
| 923 | Ga0207658_10000386 | |||
| 924 | Ga0207677_10000104 | |||
| 925 | Ga0207677_10350350 | |||
| 926 | Ga0207703_10009371 | |||
| 927 | Ga0207639_10000229 | |||
| 928 | Ga0207639_10012651 | |||
| 929 | Ga0207639_10090629 | |||
| 930 | Ga0207639_10101113 | |||
| 931 | Ga0207678_10024779 | |||
| 932 | Ga0207702_10000633 | |||
| 933 | Ga0207702_10016523 | |||
| 934 | Ga0207702_10043824 | |||
| 935 | Ga0207702_10172920 | |||
| 936 | Ga0207702_10296044 | |||
| 937 | Ga0207702_10795123 | |||
| 938 | Ga0207641_10000609 | |||
| 939 | Ga0207648_10039382 | |||
| 940 | Ga0207648_10056284 | |||
| 941 | Ga0207676_10004630 | |||
| 942 | Ga0207676_10591050 | |||
| 943 | Ga0207674_10004842 | |||
| 944 | Ga0207674_10057073 | |||
| 945 | Ga0207675_100094960 | |||
| 946 | Ga0207683_10006339 | |||
| 947 | Ga0207683_10427709 | |||
| 948 | Ga0207698_10000006 | |||
| 949 | Ga0207698_10000825 | |||
| 950 | Ga0207698_10052035 | |||
| 951 | Ga0207698_10120118 | |||
| 952 | Ga0207698_10148346 | |||
| 953 | Ga0207698_10189937 | |||
| 954 | Ga0207698_10251809 | |||
| 955 | Ga0207698_10302533 | |||
| 956 | Ga0207698_10370632 | |||
| 957 | Ga0207428_10080414 | |||
| 958 | Ga0268266_10294911 | |||
| 959 | Ga0268265_10097158 | |||
| 960 | Ga0268264_10000877 | |||
| 961 | Ga0265334_10047310 | |||
| 962 | Ga0265318_10023502 | |||
| 963 | Ga0265323_10031549 | |||
| 964 | Ga0265336_10008530 | |||
| 965 | Ga0265338_10000162 | |||
| 966 | Ga0265338_10005396 | |||
| 967 | Ga0265338_10141145 | |||
| 968 | Ga0265324_10098292 | |||
| 969 | Ga0265330_10002017 | |||
| 970 | Ga0265330_10009189 | |||
| 971 | Ga0265330_10012566 | |||
| 972 | Ga0265330_10061509 | |||
| 973 | Ga0265332_10077493 | |||
| 974 | Ga0265332_10189284 | |||
| 975 | Ga0265328_10017201 | |||
| 976 | Ga0265328_10082459 | |||
| 977 | Ga0265320_10086978 | |||
| 978 | Ga0265320_10088195 | |||
| 979 | Ga0265325_10000021 | |||
| 980 | Ga0265325_10004377 | |||
| 981 | Ga0265325_10024308 | |||
| 982 | Ga0265325_10025072 | |||
| 983 | Ga0265325_10036964 | |||
| 984 | Ga0265325_10045807 | |||
| 985 | Ga0265325_10051798 | |||
| 986 | Ga0265325_10131550 | |||
| 987 | Ga0265325_10156106 | |||
| 988 | Ga0265329_10007377 | |||
| 989 | Ga0265329_10038447 | |||
| 990 | Ga0265340_10005916 | |||
| 991 | Ga0265340_10019534 | |||
| 992 | Ga0265340_10027108 | |||
| 993 | Ga0265339_10000136 | |||
| 994 | Ga0265339_10010265 | |||
| 995 | Ga0265339_10024090 | |||
| 996 | Ga0265339_10040867 | |||
| 997 | Ga0265331_10084766 | |||
| 998 | Ga0265331_10195603 | |||
| 999 | Ga0265327_10041802 | |||
| 1000 | Ga0265316_10005832 | |||
| 1001 | Ga0265316_10008198 | |||
| 1002 | Ga0265316_10008943 | |||
| 1003 | Ga0265316_10011985 | |||
| 1004 | Ga0265316_10012787 | |||
| 1005 | Ga0265316_10020472 | |||
| 1006 | Ga0265316_10036751 | |||
| 1007 | Ga0265316_10150825 | |||
| 1008 | Ga0265316_10218101 | |||
| 1009 | Ga0265316_10246964 | |||
| 1010 | Ga0265313_10000001 | |||
| 1011 | Ga0265313_10006832 | |||
| 1012 | Ga0265313_10008708 | |||
| 1013 | Ga0265313_10032025 | |||
| 1014 | Ga0265313_10152867 | |||
| 1015 | Ga0265314_10000025 | |||
| 1016 | Ga0265314_10014112 | |||
| 1017 | Ga0265314_10078605 | |||
| 1018 | Ga0265314_10212173 | |||
| 1019 | Ga0265342_10001637 | |||
| 1020 | Ga0265342_10003974 | |||
| 1021 | Ga0265342_10006636 | |||
| 1022 | Ga0265342_10006650 | |||
| 1023 | Ga0265342_10007652 | |||
| 1024 | Ga0265342_10008308 | |||
| 1025 | Ga0265342_10013407 | |||
| 1026 | Ga0265342_10064715 | |||
| 1027 | Ga0316577_10081419 | |||
| 1028 | Ga0316214_1022653 | |||
| 1029 | Ga0373954_0048793 | |||
| 1030 | Ga0373931_0355318 | |||
| 1031 | Ga0373933_0071091 | |||
| 1032 | Ga0373937_0018887 | |||
| 1033 | Ga0373937_0157832 | |||
| 1034 | Ga0373937_0182886 | |||
| 1035 | Ga0436365_0734353 | |||
| 1036 | Ga0436361_1165009 | |||
| 1037 | Ga0451577_0000218 | |||
| 1038 | Ga0451577_0021057 | |||
| 1039 | Ga0466963_0661930 | |||
| 1040 | Ga0453684_0000193 | |||
| 1041 | Ga0453684_0187421 | |||
| 1042 | Ga0466967_0036298 | |||
| 1043 | Ga0495603_0079300 | |||
| 1044 | Ga0495629_0076242 | |||
| 1045 | Ga0495580_0101475 | |||
| 1046 | Ga0495580_0209508 | |||
| 1047 | Ga0495605_0107266 | |||
| 1048 | Ga0495628_0540450 | |||
| 1049 | Ga0495665_0229325 | |||
| 1050 | Ga0495586_0486591 | |||
| 1051 | Ga0495635_0162898 | |||
| 1052 | Ga0495588_0343746 | |||
| 1053 | Ga0495657_0494022 | |||
| 1054 | Ga0495623_0105701 | |||
| 1055 | Ga0495613_0081369 | |||
| 1056 | Ga0495676_0336808 | |||
| 1057 | Ga0495677_0161926 | |||
| 1058 | Ga0495602_0088647 | |||
| 1059 | Ga0495602_0534970 | |||
| 1060 | Ga0496100_0241569 | |||
| 1061 | Ga0496101_0014693 | |||
| 1062 | Ga0496101_0077694 | |||
| 1063 | Ga0496104_0102501 | |||
| 1064 | Ga0496104_1025395 | |||
| 1065 | Ga0496105_0095076 | |||
| 1066 | Ga0496105_0161747 | |||
| 1067 | Ga0496105_0382811 | |||
| 1068 | Ga0496106_0030667 | |||
| 1069 | Ga0496106_0177953 | |||
| 1070 | Ga0496107_0382402 | |||
| 1071 | Ga0496107_0544255 | |||
| 1072 | Ga0496108_0337979 | |||
| 1073 | Ga0496110_0320484 | |||
| 1074 | Ga0496113_0203345 | |||
| 1075 | Ga0496114_0563782 | |||
| 1076 | Ga0496115_0038512 | |||
| 1077 | Ga0496115_0103487 | |||
| 1078 | Ga0496115_0598934 | |||
| 1079 | Ga0501031_0112065 | |||
| 1080 | Ga0501031_0441622 | |||
| 1081 | Ga0501032_0223352 | |||
| 1082 | Ga0501033_0089185 | |||
| 1083 | Ga0501033_0107467 | |||
| 1084 | Ga0501033_0283676 | |||
| 1085 | Ga0501034_0117023 | |||
| 1086 | Ga0501034_0990963 | |||
| 1087 | Ga0501036_0059447 | |||
| 1088 | Ga0501037_0035493 | |||
| 1089 | Ga0501037_0040189 | |||
| 1090 | Ga0501038_0078895 | |||
| 1091 | Ga0501038_0086960 | |||
| 1092 | Ga0501039_0002466 | |||
| 1093 | Ga0501039_0017482 | |||
| 1094 | Ga0501039_0019732 | |||
| 1095 | Ga0501040_0006838 | |||
| 1096 | Ga0501040_0030479 | |||
| 1097 | Ga0501041_0002270 | |||
| 1098 | Ga0501041_0014578 | |||
| 1099 | Ga0501041_0162775 | |||
| 1100 | Ga0501042_0008363 | |||
| 1101 | Ga0501042_0032508 | |||
| 1102 | Ga0501042_0059930 | |||
| 1103 | Ga0501043_0127723 | |||
| 1104 | Ga0501043_0218231 | |||
| 1105 | Ga0501046_0003994 | |||
| 1106 | Ga0501046_0025257 | |||
| 1107 | Ga0501048_0002970 | |||
| 1108 | Ga0501048_0058802 | |||
| 1109 | Ga0501067_0237489 | |||
| 1110 | Ga0501068_0046216 | |||
| 1111 | Ga0501068_0065994 | |||
| 1112 | Ga0501070_0016054 | |||
| 1113 | Ga0501070_0092493 | |||
| 1114 | Ga0501071_0002225 | |||
| 1115 | Ga0501071_0012387 | |||
| 1116 | Ga0501071_0144391 | |||
| 1117 | Ga0501071_0443754 | |||
| 1118 | Ga0501072_0001495 | |||
| 1119 | Ga0501072_0109694 | |||
| 1120 | Ga0501072_0365741 | |||
| 1121 | Ga0501073_0031207 | |||
| 1122 | Ga0501073_0222711 | |||
| 1123 | Ga0501074_0007102 | |||
| 1124 | Ga0501074_0020818 | |||
| 1125 | Ga0501074_0087323 | |||
| 1126 | Ga0501075_0004886 | |||
| 1127 | Ga0501075_0319810 | |||
| 1128 | Ga0501076_0028951 | |||
| 1129 | Ga0501076_0033393 | |||
| 1130 | Ga0501076_0050902 | |||
| 1131 | Ga0501076_0533303 | |||
| 1132 | Ga0501077_0000849 | |||
| 1133 | Ga0501077_0002849 | |||
| 1134 | Ga0501077_0110893 | |||
| 1135 | Ga0501079_0002376 | |||
| 1136 | Ga0501079_0002802 | |||
| 1137 | Ga0501079_0043810 | |||
| 1138 | Ga0501080_0004429 | |||
| 1139 | Ga0501080_0010361 | |||
| 1140 | Ga0501080_0472032 | |||
| 1141 | Ga0501081_0001603 | |||
| 1142 | Ga0501081_0019030 | |||
| 1143 | Ga0501081_0036827 | |||
| 1144 | Ga0501083_0064815 | |||
| 1145 | Ga0501083_0174413 | |||
| 1146 | Ga0501035_0048872 | |||
| 1147 | Ga0501035_0097178 | |||
| 1148 | Ga0501035_0498618 | |||
| 1149 | Ga0501035_0648839 | |||
| 1150 | Ga0501044_0464267 | |||
| 1151 | Ga0501045_0002913 | |||
| 1152 | Ga0501045_0245916 | |||
| 1153 | nmdc:mga08y16_193063_c1 | |||
| 1154 | nmdc:mga0n895_196459_c1 | |||
| 1155 | Ga0495601_0122627 | |||
| 1156 | Ga0501084_0000979 | |||
| 1157 | Ga0501084_0005173 | |||
| 1158 | Ga0501084_0421321 | |||
| 1159 | Ga0501084_1011261 | |||
| 1160 | Ga0501082_0008181 | |||
| 1161 | Ga0501082_0113838 | |||
| 1162 | Ga0501082_0128161 | |||
| 1163 | Ga0501082_0446285 | |||
| 1164 | Ga0466962_0277806 | |||
| 1165 | Ga0530510_0070031 | |||
| 1166 | Ga0530510_0237061 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjn-assembly1.cif.gz_A | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9807 | 1 | 194 |
| 3hjn-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9794 | 1 | 192 |
| 5x7j-assembly1.cif.gz_A | crystal structure of thymidylate kinase from thermus thermophilus hb8 | 0.9723 | 1 | 195 |
| 3hjn-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9689 | 1 | 192 |
| 5x8a-assembly1.cif.gz_B | crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 | 0.9673 | 1 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9654 | 1 | 195 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9628 | 2 | 192 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9521 | 2 | 192 | 3.40.50.300 |
| 3ld9C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9473 | 1 | 195 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9413 | 1 | 195 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538G2L1-F1-model_v4 | dTMP kinase (EC 2.7.4.9) | 0.9995 | 1 | 131 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A538G2L1-F1-model_v4 | dTMP kinase (EC 2.7.4.9) | 0.9919 | 1 | 131 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-D7BL55-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9892 | 1 | 194 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A1H2LCR9-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9875 | 1 | 194 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A345NQ44-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9866 | 1 | 194 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |