F466289

General Info

Members Datasets Scaffolds Average Seq Length
583 483 1166 393

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0005173|Ga0395905_0005173_4052_5239
Length 395
Sequence MFLPFFLELKAAKIPVTLREFLTLMEGMDAHIADYDVEAFYYLARASLIKDERFIDRFDQVFAHYFRSVQAVSGAAEIVDVAEIPTEWLMRLAEKHLSEEEKRLIESLGGFEKIMDTLKQRLAEQKGRHQGGNKWIGTGGTSPFGAYGYNPEGVRIGQSESRHHRAVKVWDERNFKNLDDSVELGTRNIKVALKRLRRWVRDGADEELDLDNTIRATAEHGWLDVQTRPERRNRVKLLMFFDIGGSMDEHLKIAEELFSAARAEFRQLEYFYFHNCLYEGIWKDNLRRKSSMIPTEEVIRTYGPDYKVIFAGDASMSPYEISMAGGSVEHWNKEPGAVWLNRITGHFRKWVWLNPVSEAYWGHTHSIGMIRSLFGGKMYPLTLGGLEAAAKELSR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
44 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
45 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
129 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
135 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
136 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
137 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
138 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
139 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
140 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
141 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
142 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
143 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
144 2512875024
145 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
146 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
147 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
148 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
149 2516143018 Ensifer sp. BR816 Isolate Nodule
150 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
151 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
152 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
153 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
154 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
155 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
156 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
157 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
158 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
159 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
160 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
161 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
162 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
163 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
164 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
165 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
166 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
167 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
168 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
169 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
170 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
171 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
172 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
173 2643221557 Ensifer sp. Root558 Isolate Unclassified
174 2643221558 Rhizobium sp. Root149 Isolate Unclassified
175 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
176 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
177 2643221610 Ensifer sp. Root74 Isolate Unclassified
178 2643221618 Ensifer sp. Root231 Isolate Unclassified
179 2643221626 Ensifer sp. Root31 Isolate Unclassified
180 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
181 2643221655 Ensifer sp. Root1252 Isolate Unclassified
182 2643221659 Ensifer sp. Root127 Isolate Unclassified
183 2643221668 Ensifer sp. Root423 Isolate Unclassified
184 2643221675 Ensifer sp. Root1298 Isolate Unclassified
185 2643221680 Ensifer sp. Root1312 Isolate Unclassified
186 2643221698 Ensifer sp. Root142 Isolate Unclassified
187 2643221712 Ensifer sp. Root258 Isolate Unclassified
188 2643221723 Ensifer sp. Root278 Isolate Unclassified
189 2643221726 Ensifer sp. Root954 Isolate Unclassified
190 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
191 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
192 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
193 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
194 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
195 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
196 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
197 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
198 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
199 2738543024 Aminobacter sp. AP02 Isolate Unclassified
200 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
201 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
202 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
203 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
204 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
205 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
206 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
207 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
208 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
209 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
210 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
211 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
212 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
213 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
214 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
215 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
216 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
217 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
218 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
219 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
220 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
221 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
222 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
223 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
224 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
225 2844163670 Ensifer sp. 1H6 Isolate Unclassified
226 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
227 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
228 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
229 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
230 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
231 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
232 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
233 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
234 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
235 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
236 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
237 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
238 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
239 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
240 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
241 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
242 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
243 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
244 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
245 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
246 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
247 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
248 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
249 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
250 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
251 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
252 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
253 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
254 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
255 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
256 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
257 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
258 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
259 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
260 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
261 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
262 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
263 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
264 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
265 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
266 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
267 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
268 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
269 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
270 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
271 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
272 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
273 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
274 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
275 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
276 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
277 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
278 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
279 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
280 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
281 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
282 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
283 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
284 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
285 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
286 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
287 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
288 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
289 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
290 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
291 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
292 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
293 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
294 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
295 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
296 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
297 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
298 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
299 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
300 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
301 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
302 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
303 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
304 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
305 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
306 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
307 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
308 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
309 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
310 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
311 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
312 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
313 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
314 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
315 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
316 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
317 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
318 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
319 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
320 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
321 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
322 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
323 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
324 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
325 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
326 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
327 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
328 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
329 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
330 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
331 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
332 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
333 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
334 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
335 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
336 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
337 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
338 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
339 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
340 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
341 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
342 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
343 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
344 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
345 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
346 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
347 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
348 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
349 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
350 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
351 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
352 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
353 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
354 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
355 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
356 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
357 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
358 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
359 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
360 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
361 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
362 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
363 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
364 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
365 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
366 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
367 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
368 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
369 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
370 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
371 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
372 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
373 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
374 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
375 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
376 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
377 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
378 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
379 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
380 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
381 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
382 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
383 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
384 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
385 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
386 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
387 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
388 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
389 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
390 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
391 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
392 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
393 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
394 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
395 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
396 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
397 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
398 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
399 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
400 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
401 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
402 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
403 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
404 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
405 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
406 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
407 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
408 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
409 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
410 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
411 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
412 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
413 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
414 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
415 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
416 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
417 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
418 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
419 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
420 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
421 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
422 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
423 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
424 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
425 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
426 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
427 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
428 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
429 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
430 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
431 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
432 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
433 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
434 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
435 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
436 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
437 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
438 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
439 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
440 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
441 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
442 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
443 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
444 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
445 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
446 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
447 3004167301 Mesorhizobium loti 582 Isolate Unclassified
448 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
449 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
450 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
451 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
452 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
453 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
454 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
455 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
456 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
457 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
458 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
459 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
460 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
461 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
462 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
463 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
464 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
465 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
466 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
467 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
468 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
469 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
470 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
471 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
472 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
473 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
474 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
475 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
476 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
477 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
478 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
479 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
480 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
481 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
482 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
483 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.79
Metatranscriptomes 0
Isolates 60.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.38
Nodule 42.71
Rhizoplane 0.51
Rhizosphere 24.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0005173 3300037471 Bacteria 13384
2 JGI24740J21852_10023545 3300001979 Bacteria 2102
3 JGI25155J39150_1000004 3300002704 Bacteria 269098
4 JGI25156J39149_1000014 3300002705 Bacteria 189257
5 JGI25156J39149_1000015 3300002705 Bacteria 181949
6 JGI25162J39368_1000654 3300002737 Bacteria 24456
7 JGI25162J39368_1000789 3300002737 Bacteria 21250
8 JGI25154J39366_1000026 3300002738 Bacteria 200613
9 JGI25157J39369_1000005 3300002741 Bacteria 269089
10 JGI25157J39369_1001877 3300002741 Bacteria 6437
11 JGI25159J45721_1000326 3300002987 Bacteria 22165
12 JGI25159J45721_1002163 3300002987 Bacteria 7657
13 JGI25151J46595_10033677 3300003187 Bacteria 1969
14 JGI25406J46586_10004253 3300003203 Bacteria 6687
15 JGI25165J46597_1000026 3300003214 Bacteria 332550
16 JGI25165J46597_1000633 3300003214 Bacteria 29109
17 JGI25165J46597_1000642 3300003214 Bacteria 28950
18 JGI25160J50197_1000022 3300003354 Bacteria 201071
19 JGI25160J50197_1000027 3300003354 Bacteria 182809
20 JGI25161J50226_1000024 3300003374 Bacteria 152176
21 JGI25161J50226_1001541 3300003374 Bacteria 6776
22 Ga0055542_1000838 3300003762 Bacteria 21800
23 Ga0055529_1002018 3300003763 Bacteria 4434
24 Ga0055526_1000643 3300003771 Bacteria 27115
25 Ga0055536_1000540 3300003781 Bacteria 25879
26 Ga0055530_10009611 3300003791 Bacteria 3694
27 Ga0055540_1011658 3300003792 Bacteria 2814
28 Ga0055531_10004567 3300003794 Bacteria 8370
29 Ga0055531_10013995 3300003794 Bacteria 3651
30 Ga0055543_1000025 3300004625 Bacteria 137886
31 Ga0055543_1000030 3300004625 Bacteria 130849
32 Ga0065165_1000133 3300005262 Bacteria 128540
33 Ga0065165_1000200 3300005262 Bacteria 103564
34 Ga0070667_100009682 3300005367 Bacteria 7988
35 Ga0068853_100014335 3300005539 Bacteria 6488
36 Ga0070665_100065591 3300005548 Bacteria 3642
37 Ga0068857_100074412 3300005577 Bacteria 3026
38 Ga0068856_100008817 3300005614 Bacteria 9816
39 Ga0068862_100064183 3300005844 Bacteria 3161
40 Ga0081539_10002121 3300005985 Bacteria 29391
41 Ga0075365_10000442 3300006038 Bacteria 15431
42 Ga0075365_10006071 3300006038 Bacteria 6600
43 Ga0075365_10009573 3300006038 Bacteria 5583
44 Ga0075365_10137933 3300006038 Bacteria 1692
45 Ga0075364_10073184 3300006051 Bacteria 2259
46 Ga0075367_10040065 3300006178 Bacteria 2734
47 Ga0075367_10044839 3300006178 Bacteria 2593
48 Ga0075366_10037308 3300006195 Bacteria 2869
49 Ga0075370_10008035 3300006353 Bacteria 5412
50 Ga0075370_10018368 3300006353 Bacteria 3795
51 Ga0079104_1014104 3300006946 Bacteria 2428
52 Ga0105240_10000013 3300009093 Bacteria 483458
53 Ga0105240_10095775 3300009093 Bacteria 3618
54 Ga0105240_10153740 3300009093 Bacteria 2738
55 Ga0105248_10100282 3300009177 Bacteria 3263
56 Ga0105237_10002515 3300009545 Bacteria 22704
57 Ga0105237_10085078 3300009545 Bacteria 3152
58 Ga0105238_10014332 3300009551 Bacteria 8013
59 Ga0105239_10000768 3300010375 Bacteria 45353
60 Ga0157370_10001544 3300013104 Bacteria 28489
61 Ga0157370_10207289 3300013104 Bacteria 1817
62 Ga0157369_10060514 3300013105 Bacteria 4084
63 Ga0171463_1004 3300013249 Bacteria 437207
64 Ga0183363_1216 3300015690 Bacteria 11212
65 Ga0213874_10007136 3300021377 Bacteria 2670
66 Ga0213875_10013653 3300021388 Bacteria 3980
67 Ga0209435_100009 3300025206 Bacteria 476614
68 Ga0209436_101843 3300025208 Bacteria 6875
69 Ga0209436_104511 3300025208 Bacteria 3429
70 Ga0209672_102687 3300025228 Bacteria 4139
71 Ga0209437_100182 3300025233 Bacteria 130514
72 Ga0209437_100204 3300025233 Bacteria 115781
73 Ga0207425_1011965 3300025245 Bacteria 2051
74 Ga0209646_1000018 3300025246 Bacteria 476716
75 Ga0209026_1000032 3300025250 Bacteria 322378
76 Ga0209026_1000043 3300025250 Bacteria 269142
77 Ga0209148_1000317 3300025254 Bacteria 67724
78 Ga0209148_1007586 3300025254 Bacteria 2240
79 Ga0209759_1000007 3300025256 Bacteria 476614
80 Ga0209759_1000168 3300025256 Bacteria 111106
81 Ga0209233_1000030 3300025261 Bacteria 636702
82 Ga0209233_1000130 3300025261 Bacteria 205687
83 Ga0209233_1000255 3300025261 Bacteria 82230
84 Ga0209233_1000332 3300025261 Bacteria 48225
85 Ga0209233_1015697 3300025261 Bacteria 2103
86 Ga0209455_1000152 3300025272 Bacteria 125942
87 Ga0209130_1000027 3300025284 Bacteria 327700
88 Ga0209130_1000164 3300025284 Bacteria 97595
89 Ga0209676_1000406 3300025292 Bacteria 77603
90 Ga0209676_1019437 3300025292 Bacteria 2338
91 Ga0209025_1000241 3300025294 Bacteria 128329
92 Ga0209564_1000111 3300025295 Bacteria 212210
93 Ga0209758_1003330 3300025297 Bacteria 14781
94 Ga0209758_1017148 3300025297 Bacteria 3628
95 Ga0209050_1001751 3300025298 Bacteria 21554
96 Ga0209050_1002627 3300025298 Bacteria 14778
97 Ga0209256_1000773 3300025299 Bacteria 41485
98 Ga0209256_1004304 3300025299 Bacteria 9067
99 Ga0207426_1000072 3300025302 Bacteria 327700
100 Ga0207426_1000082 3300025302 Bacteria 298939
101 Ga0209051_1001124 3300025303 Bacteria 24447
102 Ga0209257_1001584 3300025304 Bacteria 26149
103 Ga0209257_1002672 3300025304 Bacteria 17103
104 Ga0207695_10000044 3300025913 Bacteria 440819
105 Ga0207695_10176576 3300025913 Bacteria 2058
106 Ga0207671_10000043 3300025914 Bacteria 206915
107 Ga0207671_10009507 3300025914 Bacteria 8121
108 Ga0207694_10055341 3300025924 Bacteria 3080
109 Ga0207694_10060702 3300025924 Bacteria 2943
110 Ga0207711_10106061 3300025941 Bacteria 2493
111 Ga0207668_10000033 3300025972 Bacteria 121080
112 Ga0207702_10008695 3300026078 Bacteria 8564
113 Ga0268266_10001055 3300028379 Bacteria 34552
114 Ga0268266_10032264 3300028379 Bacteria 4451
115 Ga0268266_10042953 3300028379 Bacteria 3862
116 Ga0268266_10200489 3300028379 Bacteria 1826
117 Ga0268265_10041591 3300028380 Bacteria 3403
118 Ga0307515_10006431 3300028794 Bacteria 23507
119 Ga0307515_10150406 3300028794 Bacteria 2437
120 Ga0373927_0000019 3300035695 Bacteria 139754
121 Ga0316582_0135129 3300036647 Bacteria 1659
122 Ga0373925_0001010 3300037068 Bacteria 25444
123 Ga0395899_0000288 3300037312 Bacteria 64881
124 Ga0395900_0000246 3300037418 Bacteria 85104
125 Ga0395900_0061311 3300037418 Bacteria 3867
126 Ga0395898_0000447 3300037466 Bacteria 85103
127 Ga0395898_0135835 3300037466 Bacteria 2355
128 Ga0395898_0150956 3300037466 Bacteria 2223
129 Ga0395905_0000228 3300037471 Bacteria 85103
130 Ga0395905_0011579 3300037471 Bacteria 8520
131 Ga0395905_0014784 3300037471 Bacteria 7442
132 Ga0395905_0019857 3300037471 Bacteria 6368
133 Ga0395905_0152306 3300037471 Bacteria 2175
134 Ga0395905_0351031 3300037471 Bacteria 1367
135 Ga0436364_0281278 3300037853 Bacteria 34090
136 Ga0395901_0000167 3300038443 Bacteria 85844
137 Ga0395901_0024967 3300038443 Bacteria 6134
138 Ga0395901_0115521 3300038443 Bacteria 2819
139 Ga0395901_0185498 3300038443 Bacteria 2182
140 Ga0395901_0288723 3300038443 Bacteria 1703
141 Ga0400483_010879 3300039062 Bacteria 4564
142 Ga0400483_039567 3300039062 Bacteria 1704
143 Ga0400483_047364 3300039062 Bacteria 2638
144 Ga0400483_206413 3300039062 Bacteria 2693
145 Ga0400483_260578 3300039062 Bacteria 4633
146 Ga0436365_0085161 3300039437 Bacteria 16288
147 Ga0436363_1114875 3300039450 Bacteria 2853
148 Ga0439449_0028667 3300042007 Bacteria 2075
149 Ga0466960_0011807 3300044901 Bacteria 3669
150 Ga0495638_0002866 3300046460 Bacteria 13806
151 Ga0495638_0064354 3300046460 Bacteria 2259
152 Ga0495606_0074017 3300046507 Bacteria 2135
153 Ga0495643_0020048 3300046522 Bacteria 3862
154 Ga0495672_0000265 3300047320 Bacteria 72657
155 Ga0496116_0009992 3300048919 Bacteria 8014
156 Ga0496117_0005812 3300048920 Bacteria 12780
157 Ga0496118_0004317 3300048921 Bacteria 16959
158 Ga0496118_0039556 3300048921 Bacteria 3761
159 Ga0496119_0005207 3300048922 Bacteria 12563
160 Ga0496119_0050027 3300048922 Bacteria 2579
161 Ga0496120_0004478 3300048923 Bacteria 11697
162 Ga0496121_0101984 3300048924 Bacteria 2212
163 Ga0496122_0014398 3300048925 Bacteria 7651
164 Ga0496123_0010798 3300048926 Bacteria 8014
165 Ga0496126_0042541 3300048929 Bacteria 4195
166 Ga0496126_0078405 3300048929 Bacteria 2927
167 Ga0496126_0285208 3300048929 Bacteria 1367
168 Ga0501031_0037510 3300049568 Bacteria 3162
169 Ga0501032_0000001 3300049569 Bacteria 422097
170 Ga0501032_0043871 3300049569 Bacteria 3027
171 Ga0501033_0000077 3300049570 Bacteria 92696
172 Ga0501033_0000318 3300049570 Bacteria 45707
173 Ga0501033_0109582 3300049570 Bacteria 2010
174 Ga0501033_0129539 3300049570 Bacteria 1828
175 Ga0501034_0000023 3300049571 Bacteria 263892
176 Ga0501034_0000291 3300049571 Bacteria 89828
177 Ga0501034_0264376 3300049571 Bacteria 1662
178 Ga0501034_0268513 3300049571 Bacteria 1648
179 Ga0501036_0000482 3300049572 Bacteria 28438
180 Ga0501037_0000136 3300049573 Bacteria 68536
181 Ga0501037_0000754 3300049573 Bacteria 24464
182 Ga0501038_0000043 3300049574 Bacteria 113010
183 Ga0501039_0000022 3300049575 Bacteria 160858
184 Ga0501043_0000006 3300049579 Bacteria 234413
185 Ga0501043_0000310 3300049579 Bacteria 44324
186 Ga0501043_0053667 3300049579 Bacteria 3165
187 Ga0501047_0121048 3300049581 Bacteria 2499
188 Ga0501047_0189821 3300049581 Bacteria 1918
189 Ga0501047_0197721 3300049581 Bacteria 1872
190 Ga0501048_0146366 3300049582 Bacteria 1671
191 Ga0501067_0132915 3300049583 Bacteria 1385
192 Ga0501068_0033698 3300049584 Bacteria 3051
193 Ga0501068_0058153 3300049584 Bacteria 2346
194 Ga0501069_0000024 3300049585 Bacteria 117140
195 Ga0501069_0025509 3300049585 Bacteria 3232
196 Ga0501070_0000093 3300049586 Bacteria 76623
197 Ga0501070_0001707 3300049586 Bacteria 19484
198 Ga0501070_0085857 3300049586 Bacteria 2605
199 Ga0501073_0017899 3300049589 Bacteria 5127
200 Ga0501080_0001346 3300049742 Bacteria 20520
201 Ga0501080_0010785 3300049742 Bacteria 8362
202 Ga0501083_0000097 3300049744 Bacteria 59474
203 Ga0501035_0000068 3300049822 Bacteria 128392
204 Ga0501035_0000997 3300049822 Bacteria 29896
205 Ga0501035_0006366 3300049822 Bacteria 11103
206 Ga0501035_0008638 3300049822 Bacteria 9482
207 Ga0501035_0015071 3300049822 Bacteria 7132
208 Ga0501035_0077120 3300049822 Bacteria 2945
209 Ga0501035_0118977 3300049822 Bacteria 2311
210 Ga0501035_0222181 3300049822 Bacteria 1612
211 Ga0501044_0000096 3300049823 Bacteria 109532
212 Ga0501044_0002553 3300049823 Bacteria 20731
213 Ga0501044_0017784 3300049823 Bacteria 7625
214 Ga0501044_0017942 3300049823 Bacteria 7589
215 Ga0501044_0020541 3300049823 Bacteria 7051
216 Ga0501044_0110215 3300049823 Bacteria 2761
217 Ga0501044_0127857 3300049823 Bacteria 2537
218 Ga0501044_0142048 3300049823 Bacteria 2389
219 nmdc:mga00v17_67852_c1 3300050491 Bacteria 2204
220 nmdc:mga0yw44_622_c1 3300050492 Bacteria 12854
221 nmdc:mga0k408_8641_c1 3300050493 Bacteria 5474
222 nmdc:mga06z11_47004_c1 3300050494 Bacteria 2190
223 nmdc:mga0sz30_19563_c1 3300050516 Bacteria 2723
224 nmdc:mga0sz30_65081_c1 3300050516 Bacteria 1563
225 Ga0500610_0004729 3300053079 Bacteria 5462
226 Ga0500644_0010287 3300053088 Bacteria 2528
227 Ga0500568_0000066 3300053139 Bacteria 104826
228 Ga0500616_0000441 3300053153 Bacteria 54819
229 Ga0500616_0003486 3300053153 Bacteria 11964
230 Ga0500616_0033423 3300053153 Bacteria 2807
231 Ga0500622_0000343 3300053156 Bacteria 45668
232 Ga0501082_0091455 3300060353 Bacteria 2627
233 2503199282 2503198000 Bacteria 6884444
234 2509113294 2508501123 Bacteria 6283661
235 2509142129 2508501127 Bacteria 7037543
236 2509369823 2509276018 Bacteria 6910194
237 2509394211 2509276022 Bacteria 6200534
238 2510318093 2510065059 Bacteria 6847884
239 2510840456 2510461069 Bacteria 5505000
240 2511133115 2510917022 Bacteria 6504556
241 2511170447 2510917026 Bacteria 7046020
242 2512933331 2512875016 Bacteria 6529530
243 2512961436 2512875024 Bacteria 7195110
244 2513610408 2513237090 Bacteria 7096802
245 2514036729 2513237164 Bacteria 7563725
246 2514417134 2513237305 Bacteria 7293571
247 2514586937 2513237351 Bacteria 6968952
248 2516205588 2516143018 Bacteria 6951533
249 2524458637 2524023209 Bacteria 6679728
250 2585271855 2582581307 Bacteria 6597605
251 2585279782 2582581308 Bacteria 7413247
252 2585326678 2582581315 Bacteria 7318924
253 2585333843 2582581316 Bacteria 7774528
254 2585531814 2585427527 Bacteria 7273426
255 2585551238 2585427530 Bacteria 7383882
256 2585563782 2585427531 Bacteria 6992870
257 2585897021 2585427608 Bacteria 6544331
258 2585907121 2585427609 Bacteria 6667127
259 2585997813 2585427633 Bacteria 6413184
260 2586002400 2585427634 Bacteria 6455027
261 2587982885 2585428125 Bacteria 6662905
262 2588519399 2588253730 Bacteria 6881675
263 2597811674 2597489875 Bacteria 7010078
264 2599937197 2599185301 Bacteria 6161860
265 2600193397 2599185352 Bacteria 7228948
266 2616306573 2615840626 Bacteria 7921970
267 2616551210 2615840698 Bacteria 7319877
268 2617382962 2617270742 Bacteria 6808054
269 2643771190 2643221550 Bacteria 4619371
270 2643777062 2643221551 Bacteria 3750538
271 2643795510 2643221555 Bacteria 3749717
272 2643808095 2643221557 Bacteria 7184309
273 2643813806 2643221558 Bacteria 5460675
274 2643838003 2643221564 Bacteria 4193379
275 2643988874 2643221595 Bacteria 6565519
276 2644068716 2643221610 Bacteria 7480339
277 2644110119 2643221618 Bacteria 7717186
278 2644150395 2643221626 Bacteria 8069654
279 2644154843 2643221627 Bacteria 6761570
280 2644312999 2643221655 Bacteria 7722067
281 2644336547 2643221659 Bacteria 7890716
282 2644379529 2643221668 Bacteria 7306521
283 2644419786 2643221675 Bacteria 7473456
284 2644453143 2643221680 Bacteria 7473610
285 2644546193 2643221698 Bacteria 7756764
286 2644618729 2643221712 Bacteria 7729434
287 2644677123 2643221723 Bacteria 7095460
288 2644688829 2643221726 Bacteria 7455827
289 2657682475 2657244999 Bacteria 5946535
290 2671113333 2667528174 Bacteria 6435400
291 2688596559 2687453392 Bacteria 6880454
292 2692320021 2690316117 Bacteria 6800650
293 2694629939 2693429783 Bacteria 7019804
294 2694635751 2693429784 Bacteria 7241525
295 2723573668 2721755686 Bacteria 7343952
296 2738746021 2738541281 Bacteria 5112672
297 2738947007 2738541317 Bacteria 5340176
298 2739310187 2738543024 Bacteria 5603683
299 2739355251 2738543032 Bacteria 5115625
300 2753462495 2751185821 Bacteria 6189929
301 2756673960 2756170246 Bacteria 7451806
302 2776915566 2775507049 Bacteria 6284736
303 2778179058 2775507266 Bacteria 7392367
304 2792621952 2791355091 Bacteria 6135441
305 2792628791 2791355092 Bacteria 6248105
306 2792747820 2791355123 Bacteria 8049106
307 2804753634 2802429268 Bacteria 6094027
308 2819244558 2818991272 Bacteria 4622173
309 2819611653 2818991448 Bacteria 6772224
310 2819638669 2818991453 Bacteria 7181617
311 2837651126 2837651117 Bacteria 3772164
312 2838031082 2838029111 Bacteria 6603031
313 2838078215 2838074704 Bacteria 6785777
314 2840881105 2840878972 Bacteria 5483153
315 2841736982 2841734538 Bacteria 6784580
316 2842300101 2842298080 Bacteria 6123127
317 2842359012 2842357229 Bacteria 6485165
318 2842477814 2842475841 Bacteria 6603183
319 2842485109 2842482326 Bacteria 7212537
320 2842504314 2842502639 Bacteria 6604161
321 2842511533 2842509118 Bacteria 6850950
322 2844002489 2844002411 Bacteria 7168230
323 2844011796 2844009547 Bacteria 6728125
324 2844164324 2844163670 Bacteria 7266046
325 2847420755 2847417321 Bacteria 6913799
326 2847674334 2847670302 Bacteria 6165597
327 2847690448 2847686936 Bacteria 6278406
328 2848995583 2848992105 Bacteria 6810864
329 2852391926 2852387548 Bacteria 8025568
330 2854682012 2854681122 Bacteria 4548679
331 2855878109 2855872281 Bacteria 6964271
332 2856317750 2856314179 Bacteria 6477897
333 2856321370 2856320880 Bacteria 7263508
334 2856341026 2856334872 Bacteria 7037011
335 2856342512 2856342000 Bacteria 7176905
336 2856355054 2856349417 Bacteria 6230045
337 2856359327 2856356410 Bacteria 6297484
338 2856366432 2856364286 Bacteria 6939991
339 2857356882 2857349434 Bacteria 7926032
340 2869165111 2869162929 Bacteria 6399702
341 2869170000 2869169390 Bacteria 6659796
342 2869246546 2869242130 Bacteria 6609239
343 2869253880 2869249662 Bacteria 6868783
344 2869263622 2869256925 Bacteria 6981691
345 2869268683 2869264136 Bacteria 6880765
346 2869276102 2869271264 Bacteria 6908218
347 2869285309 2869278585 Bacteria 7077053
348 2869288157 2869285874 Bacteria 6901219
349 2871430043 2871429161 Bacteria 6547891
350 2871438030 2871435913 Bacteria 6880295
351 2871453937 2871451962 Bacteria 7336357
352 2871464095 2871459585 Bacteria 6866887
353 2871467433 2871466892 Bacteria 6923287
354 2871479563 2871474448 Bacteria 6806570
355 2871482152 2871481445 Bacteria 6700002
356 2871494704 2871488783 Bacteria 6929816
357 2871497732 2871495908 Bacteria 6935695
358 2874102388 2874102143 Bacteria 6342645
359 2874113782 2874109183 Bacteria 6517025
360 2874121114 2874116593 Bacteria 6674494
361 2874130306 2874123672 Bacteria 7238285
362 2874137904 2874131515 Bacteria 6820270
363 2874146449 2874139085 Bacteria 7021506
364 2874151790 2874146452 Bacteria 7533118
365 2874159423 2874155637 Bacteria 6724144
366 2874164677 2874162495 Bacteria 6174670
367 2874176602 2874168670 Bacteria 8062617
368 2876364416 2876363079 Bacteria 6544991
369 2876375093 2876369609 Bacteria 6807521
370 2876388463 2876386047 Bacteria 6698674
371 2876396550 2876392853 Bacteria 6660880
372 2876402069 2876399893 Bacteria 6927900
373 2876412167 2876406927 Bacteria 6191900
374 2876417841 2876413966 Bacteria 6831344
375 2876422736 2876420981 Bacteria 6687741
376 2878038809 2878035449 Bacteria 6555736
377 2878732534 2878730984 Bacteria 6380721
378 2878741496 2878738818 Bacteria 7136951
379 2878749668 2878745973 Bacteria 6867388
380 2878759838 2878753008 Bacteria 6922523
381 2878761955 2878760144 Bacteria 6823465
382 2878768921 2878767105 Bacteria 6898628
383 2878783794 2878781027 Bacteria 6834456
384 2881149092 2881147464 Bacteria 7779814
385 2881160330 2881155292 Bacteria 6461656
386 2881165932 2881161766 Bacteria 7127907
387 2881846589 2881845957 Bacteria 6611900
388 2881853462 2881853255 Bacteria 6698367
389 2881864972 2881861095 Bacteria 7128710
390 2882638396 2882632389 Bacteria 8154593
391 2882915722 2882912400 Bacteria 6801539
392 2885307416 2885305155 Bacteria 7348390
393 2885313550 2885312484 Bacteria 6415165
394 2885322378 2885318864 Bacteria 6729568
395 2885333943 2885326080 Bacteria 7134805
396 2885335578 2885334103 Bacteria 7216818
397 2885349467 2885342637 Bacteria 7011821
398 2885355186 2885350715 Bacteria 6787678
399 2888337621 2888337043 Bacteria 6629336
400 2888344943 2888343758 Bacteria 6611049
401 2889015853 2889010040 Bacteria 6749192
402 2889019096 2889016732 Bacteria 6700763
403 2896390245 2896384573 Bacteria 7700774
404 2898798912 2898795034 Bacteria 4294459
405 2899808014 2899803654 Bacteria 5577784
406 2903455059 2903448605 Bacteria 7357801
407 2903493897 2903492973 Bacteria 13473544
408 2903494062 2903492973 Bacteria 13473544
409 2903517472 2903513507 Bacteria 6344008
410 2903523401 2903521522 Bacteria 6525694
411 2903531397 2903528002 Bacteria 6586099
412 2903542530 2903540706 Bacteria 7062119
413 2904663326 2904659560 Bacteria 6685615
414 2906310706 2906308376 Bacteria 6841989
415 2906324769 2906321335 Bacteria 6579571
416 2906333567 2906328253 Bacteria 6585166
417 2906367114 2906363423 Bacteria 6856682
418 2906377555 2906370794 Bacteria 6881062
419 2906391095 2906386501 Bacteria 5977019
420 2906399324 2906393657 Bacteria 6790866
421 2906405011 2906401398 Bacteria 6693206
422 2906408564 2906408224 Bacteria 6162342
423 2906417815 2906414383 Bacteria 6580790
424 2906428915 2906427513 Bacteria 6375796
425 2913312166 2913308742 Bacteria 5350706
426 2919175753 2919171160 Bacteria 6499771
427 2919411213 2919408235 Bacteria 6149349
428 2920760370 2920760137 Bacteria 7427611
429 2920825902 2920822456 Bacteria 6897201
430 2922155485 2922151315 Bacteria 6902399
431 2922159604 2922158528 Bacteria 6573167
432 2922174910 2922172374 Bacteria 6167644
433 2924714031 2924710171 Bacteria 6752351
434 2924726383 2924718760 Bacteria 6331356
435 2924732295 2924726620 Bacteria 6271473
436 2924737128 2924733363 Bacteria 7574837
437 2924749974 2924748358 Bacteria 6154725
438 2924758179 2924754689 Bacteria 6774424
439 2924766635 2924762789 Bacteria 6561353
440 2924779178 2924776078 Bacteria 7492003
441 2924790480 2924784321 Bacteria 7416538
442 2937817533 2937813078 Bacteria 7783518
443 2937828073 2937822353 Bacteria 7290551
444 2937841168 2937836603 Bacteria 6811263
445 2937848497 2937843397 Bacteria 5256375
446 2937849454 2937848649 Bacteria 6983481
447 2937865935 2937861824 Bacteria 6660327
448 2937883171 2937877337 Bacteria 7246526
449 2937893062 2937891427 Bacteria 6357007
450 2937979217 2937972304 Bacteria 7532020
451 2937985881 2937980651 Bacteria 6517427
452 2937996383 2937994558 Bacteria 7036190
453 2938014893 2938014810 Bacteria 6700592
454 2941501320 2941499720 Bacteria 7599444
455 2958041014 2958034702 Bacteria 6989922
456 2958057508 2958041894 Bacteria 13082850
457 2958070199 2958064165 Bacteria 7158582
458 2958090337 2958084443 Bacteria 7312792
459 2958100268 2958092219 Bacteria 6861151
460 2958101200 2958100919 Bacteria 6800575
461 2958108871 2958108152 Bacteria 6681128
462 2958115220 2958115193 Bacteria 6923548
463 2958127975 2958122699 Bacteria 7280457
464 2958132559 2958130278 Bacteria 6897202
465 2958140487 2958137437 Bacteria 6050276
466 2958145429 2958144490 Bacteria 6677056
467 2958160280 2958158011 Bacteria 6058449
468 2958166853 2958165035 Bacteria 6906348
469 2958174340 2958172287 Bacteria 6716688
470 2958182373 2958179912 Bacteria 6874908
471 2961080218 2961077736 Bacteria 7079850
472 2961118353 2961114664 Bacteria 6680456
473 2961129161 2961127735 Bacteria 7196641
474 2961138758 2961136820 Bacteria 6775228
475 2961165323 2961163497 Bacteria 6901077
476 2961177713 2961170736 Bacteria 7072258
477 2961187351 2961183825 Bacteria 6688536
478 2963645873 2963644680 Bacteria 6530403
479 2965020145 2965018300 Bacteria 6883036
480 2965030821 2965025482 Bacteria 6532201
481 2965039319 2965032056 Bacteria 6887443
482 2965040718 2965040258 Bacteria 6855979
483 2965054566 2965047637 Bacteria 6623551
484 2965064491 2965062239 Bacteria 7412989
485 2965096315 2965089291 Bacteria 6866420
486 2965109649 2965102966 Bacteria 6800987
487 2965117980 2965110997 Bacteria 6693150
488 2965120973 2965119406 Bacteria 6956431
489 2968002200 2967996073 Bacteria 6787468
490 2968009434 2968003550 Bacteria 6929263
491 2968022608 2968016561 Bacteria 7022047
492 2968089383 2968083720 Bacteria 7351627
493 2968091717 2968091066 Bacteria 6052692
494 2968102048 2968097103 Bacteria 6107094
495 2968114414 2968110612 Bacteria 6814636
496 2968123529 2968117919 Bacteria 6536078
497 2968133313 2968128360 Bacteria 6270294
498 2968142038 2968138860 Bacteria 6605449
499 2968173724 2968171901 Bacteria 6894245
500 2970475192 2970469710 Bacteria 6969209
501 2970491362 2970489779 Bacteria 6517260
502 2970510391 2970503327 Bacteria 7099517
503 2970526670 2970524798 Bacteria 6840927
504 2970539217 2970532167 Bacteria 6553173
505 2970543469 2970540015 Bacteria 6977556
506 2970549274 2970547951 Bacteria 6931819
507 2970556810 2970554993 Bacteria 6814252
508 2970599925 2970593180 Bacteria 7073582
509 2970623753 2970619444 Bacteria 6986144
510 2970628170 2970627176 Bacteria 6680862
511 2977828360 2977821940 Bacteria 6906439
512 2977831702 2977828996 Bacteria 7007971
513 2977847821 2977843712 Bacteria 6753583
514 2977857402 2977851361 Bacteria 6694324
515 2977861120 2977858184 Bacteria 6215359
516 2977868800 2977864932 Bacteria 7534097
517 2977879269 2977872689 Bacteria 7270173
518 2977904313 2977898635 Bacteria 6675551
519 2977910908 2977907340 Bacteria 6577984
520 2977915768 2977915119 Bacteria 6829656
521 2977923732 2977922695 Bacteria 6956781
522 2977937946 2977935797 Bacteria 6252826
523 2977950093 2977942078 Bacteria 7570577
524 2977955835 2977950692 Bacteria 6893264
525 2977957901 2977957713 Bacteria 6877875
526 2977989594 2977986579 Bacteria 6581278
527 2979713263 2979710463 Bacteria 6785254
528 2979768427 2979764755 Bacteria 6610066
529 2979775489 2979772303 Bacteria 6618277
530 2979782570 2979779861 Bacteria 6219781
531 2979793585 2979793036 Bacteria 6808957
532 2979815264 2979808191 Bacteria 7179355
533 2987644163 2987636660 Bacteria 8088555
534 2987651620 2987645492 Bacteria 6117018
535 2987654057 2987652177 Bacteria 6969023
536 2987661330 2987659509 Bacteria 6966464
537 2987671021 2987666974 Bacteria 6509233
538 2987678086 2987673487 Bacteria 6884027
539 2996315522 2996310559 Bacteria 6357320
540 2996341911 2996341866 Bacteria 6643098
541 2996353382 2996348954 Bacteria 7239054
542 2996393439 2996386984 Bacteria 6978667
543 3000141659 3000135777 Bacteria 6891109
544 3000408368 3000405567 Bacteria 3779330
545 3002141392 3002141150 Bacteria 5254435
546 3003669138 3003665799 Bacteria 7279786
547 3004173894 3004167301 Bacteria 8330599
548 3004190379 3004188549 Bacteria 6952365
549 3004199028 3004195979 Bacteria 6776956
550 3004208312 3004203850 Bacteria 7307914
551 3004212927 3004211236 Bacteria 7417683
552 3004220606 3004218560 Bacteria 7421728
553 3004233259 3004232784 Bacteria 6662140
554 3004245986 3004239961 Bacteria 6892290
555 3004249932 3004248173 Bacteria 6563236
556 3004272131 3004268573 Bacteria 7043476
557 3004280064 3004275668 Bacteria 7114440
558 3004336577 3004334049 Bacteria 8449246
559 3005421472 3005416602 Bacteria 7064308
560 637076411 637000159 Bacteria 7596297
561 643827349 643692032 Bacteria 6891900
562 649871115 649633066 Bacteria 6690028
563 8002290443 8002285264 Bacteria 6717907
564 8004305779 8004300914 Bacteria 6132239
565 8004318764 8004312739 Bacteria 7444653
566 8004368711 8004361976 Bacteria 6858373
567 8004381336 8004374579 Bacteria 6898112
568 8004389944 8004387939 Bacteria 7049250
569 8004450981 8004445564 Bacteria 6322258
570 8004639522 8004633249 Bacteria 6723080
571 8004645296 8004640170 Bacteria 6723001
572 8004700086 8004695233 Bacteria 6731676
573 8004718341 8004714634 Bacteria 6776161
574 8004727747 8004727605 Bacteria 6643904
575 8005249328 8005246636 Bacteria 4933972
576 8005319825 8005314921 Bacteria 7072929
577 8005490449 8005484373 Bacteria 6297373
578 8005647093 8005645114 Bacteria 6950293
579 8005687023 8005682033 Bacteria 6726518
580 8018153401 8018150411 Bacteria 5549903
581 8046767419 8046767195 Bacteria 7547379
582 8055618514 8055617313 Bacteria 7548464
583 8057578443 8057575449 Bacteria 7367519
584 Ga0395905_0005173
585 JGI24740J21852_10023545
586 JGI25155J39150_1000004
587 JGI25156J39149_1000014
588 JGI25156J39149_1000015
589 JGI25162J39368_1000654
590 JGI25162J39368_1000789
591 JGI25154J39366_1000026
592 JGI25157J39369_1000005
593 JGI25157J39369_1001877
594 JGI25159J45721_1000326
595 JGI25159J45721_1002163
596 JGI25151J46595_10033677
597 JGI25406J46586_10004253
598 JGI25165J46597_1000026
599 JGI25165J46597_1000633
600 JGI25165J46597_1000642
601 JGI25160J50197_1000022
602 JGI25160J50197_1000027
603 JGI25161J50226_1000024
604 JGI25161J50226_1001541
605 Ga0055542_1000838
606 Ga0055529_1002018
607 Ga0055526_1000643
608 Ga0055536_1000540
609 Ga0055530_10009611
610 Ga0055540_1011658
611 Ga0055531_10004567
612 Ga0055531_10013995
613 Ga0055543_1000025
614 Ga0055543_1000030
615 Ga0065165_1000133
616 Ga0065165_1000200
617 Ga0070667_100009682
618 Ga0068853_100014335
619 Ga0070665_100065591
620 Ga0068857_100074412
621 Ga0068856_100008817
622 Ga0068862_100064183
623 Ga0081539_10002121
624 Ga0075365_10000442
625 Ga0075365_10006071
626 Ga0075365_10009573
627 Ga0075365_10137933
628 Ga0075364_10073184
629 Ga0075367_10040065
630 Ga0075367_10044839
631 Ga0075366_10037308
632 Ga0075370_10008035
633 Ga0075370_10018368
634 Ga0079104_1014104
635 Ga0105240_10000013
636 Ga0105240_10095775
637 Ga0105240_10153740
638 Ga0105248_10100282
639 Ga0105237_10002515
640 Ga0105237_10085078
641 Ga0105238_10014332
642 Ga0105239_10000768
643 Ga0157370_10001544
644 Ga0157370_10207289
645 Ga0157369_10060514
646 Ga0171463_1004
647 Ga0183363_1216
648 Ga0213874_10007136
649 Ga0213875_10013653
650 Ga0209435_100009
651 Ga0209436_101843
652 Ga0209436_104511
653 Ga0209672_102687
654 Ga0209437_100182
655 Ga0209437_100204
656 Ga0207425_1011965
657 Ga0209646_1000018
658 Ga0209026_1000032
659 Ga0209026_1000043
660 Ga0209148_1000317
661 Ga0209148_1007586
662 Ga0209759_1000007
663 Ga0209759_1000168
664 Ga0209233_1000030
665 Ga0209233_1000130
666 Ga0209233_1000255
667 Ga0209233_1000332
668 Ga0209233_1015697
669 Ga0209455_1000152
670 Ga0209130_1000027
671 Ga0209130_1000164
672 Ga0209676_1000406
673 Ga0209676_1019437
674 Ga0209025_1000241
675 Ga0209564_1000111
676 Ga0209758_1003330
677 Ga0209758_1017148
678 Ga0209050_1001751
679 Ga0209050_1002627
680 Ga0209256_1000773
681 Ga0209256_1004304
682 Ga0207426_1000072
683 Ga0207426_1000082
684 Ga0209051_1001124
685 Ga0209257_1001584
686 Ga0209257_1002672
687 Ga0207695_10000044
688 Ga0207695_10176576
689 Ga0207671_10000043
690 Ga0207671_10009507
691 Ga0207694_10055341
692 Ga0207694_10060702
693 Ga0207711_10106061
694 Ga0207668_10000033
695 Ga0207702_10008695
696 Ga0268266_10001055
697 Ga0268266_10032264
698 Ga0268266_10042953
699 Ga0268266_10200489
700 Ga0268265_10041591
701 Ga0307515_10006431
702 Ga0307515_10150406
703 Ga0373927_0000019
704 Ga0316582_0135129
705 Ga0373925_0001010
706 Ga0395899_0000288
707 Ga0395900_0000246
708 Ga0395900_0061311
709 Ga0395898_0000447
710 Ga0395898_0135835
711 Ga0395898_0150956
712 Ga0395905_0000228
713 Ga0395905_0011579
714 Ga0395905_0014784
715 Ga0395905_0019857
716 Ga0395905_0152306
717 Ga0395905_0351031
718 Ga0436364_0281278
719 Ga0395901_0000167
720 Ga0395901_0024967
721 Ga0395901_0115521
722 Ga0395901_0185498
723 Ga0395901_0288723
724 Ga0400483_010879
725 Ga0400483_039567
726 Ga0400483_047364
727 Ga0400483_206413
728 Ga0400483_260578
729 Ga0436365_0085161
730 Ga0436363_1114875
731 Ga0439449_0028667
732 Ga0466960_0011807
733 Ga0495638_0002866
734 Ga0495638_0064354
735 Ga0495606_0074017
736 Ga0495643_0020048
737 Ga0495672_0000265
738 Ga0496116_0009992
739 Ga0496117_0005812
740 Ga0496118_0004317
741 Ga0496118_0039556
742 Ga0496119_0005207
743 Ga0496119_0050027
744 Ga0496120_0004478
745 Ga0496121_0101984
746 Ga0496122_0014398
747 Ga0496123_0010798
748 Ga0496126_0042541
749 Ga0496126_0078405
750 Ga0496126_0285208
751 Ga0501031_0037510
752 Ga0501032_0000001
753 Ga0501032_0043871
754 Ga0501033_0000077
755 Ga0501033_0000318
756 Ga0501033_0109582
757 Ga0501033_0129539
758 Ga0501034_0000023
759 Ga0501034_0000291
760 Ga0501034_0264376
761 Ga0501034_0268513
762 Ga0501036_0000482
763 Ga0501037_0000136
764 Ga0501037_0000754
765 Ga0501038_0000043
766 Ga0501039_0000022
767 Ga0501043_0000006
768 Ga0501043_0000310
769 Ga0501043_0053667
770 Ga0501047_0121048
771 Ga0501047_0189821
772 Ga0501047_0197721
773 Ga0501048_0146366
774 Ga0501067_0132915
775 Ga0501068_0033698
776 Ga0501068_0058153
777 Ga0501069_0000024
778 Ga0501069_0025509
779 Ga0501070_0000093
780 Ga0501070_0001707
781 Ga0501070_0085857
782 Ga0501073_0017899
783 Ga0501080_0001346
784 Ga0501080_0010785
785 Ga0501083_0000097
786 Ga0501035_0000068
787 Ga0501035_0000997
788 Ga0501035_0006366
789 Ga0501035_0008638
790 Ga0501035_0015071
791 Ga0501035_0077120
792 Ga0501035_0118977
793 Ga0501035_0222181
794 Ga0501044_0000096
795 Ga0501044_0002553
796 Ga0501044_0017784
797 Ga0501044_0017942
798 Ga0501044_0020541
799 Ga0501044_0110215
800 Ga0501044_0127857
801 Ga0501044_0142048
802 nmdc:mga00v17_67852_c1
803 nmdc:mga0yw44_622_c1
804 nmdc:mga0k408_8641_c1
805 nmdc:mga06z11_47004_c1
806 nmdc:mga0sz30_19563_c1
807 nmdc:mga0sz30_65081_c1
808 Ga0500610_0004729
809 Ga0500644_0010287
810 Ga0500568_0000066
811 Ga0500616_0000441
812 Ga0500616_0003486
813 Ga0500616_0033423
814 Ga0500622_0000343
815 Ga0501082_0091455
816 2503199282
817 2509113294
818 2509142129
819 2509369823
820 2509394211
821 2510318093
822 2510840456
823 2511133115
824 2511170447
825 2512933331
826 2512961436
827 2513610408
828 2514036729
829 2514417134
830 2514586937
831 2516205588
832 2524458637
833 2585271855
834 2585279782
835 2585326678
836 2585333843
837 2585531814
838 2585551238
839 2585563782
840 2585897021
841 2585907121
842 2585997813
843 2586002400
844 2587982885
845 2588519399
846 2597811674
847 2599937197
848 2600193397
849 2616306573
850 2616551210
851 2617382962
852 2643771190
853 2643777062
854 2643795510
855 2643808095
856 2643813806
857 2643838003
858 2643988874
859 2644068716
860 2644110119
861 2644150395
862 2644154843
863 2644312999
864 2644336547
865 2644379529
866 2644419786
867 2644453143
868 2644546193
869 2644618729
870 2644677123
871 2644688829
872 2657682475
873 2671113333
874 2688596559
875 2692320021
876 2694629939
877 2694635751
878 2723573668
879 2738746021
880 2738947007
881 2739310187
882 2739355251
883 2753462495
884 2756673960
885 2776915566
886 2778179058
887 2792621952
888 2792628791
889 2792747820
890 2804753634
891 2819244558
892 2819611653
893 2819638669
894 2837651126
895 2838031082
896 2838078215
897 2840881105
898 2841736982
899 2842300101
900 2842359012
901 2842477814
902 2842485109
903 2842504314
904 2842511533
905 2844002489
906 2844011796
907 2844164324
908 2847420755
909 2847674334
910 2847690448
911 2848995583
912 2852391926
913 2854682012
914 2855878109
915 2856317750
916 2856321370
917 2856341026
918 2856342512
919 2856355054
920 2856359327
921 2856366432
922 2857356882
923 2869165111
924 2869170000
925 2869246546
926 2869253880
927 2869263622
928 2869268683
929 2869276102
930 2869285309
931 2869288157
932 2871430043
933 2871438030
934 2871453937
935 2871464095
936 2871467433
937 2871479563
938 2871482152
939 2871494704
940 2871497732
941 2874102388
942 2874113782
943 2874121114
944 2874130306
945 2874137904
946 2874146449
947 2874151790
948 2874159423
949 2874164677
950 2874176602
951 2876364416
952 2876375093
953 2876388463
954 2876396550
955 2876402069
956 2876412167
957 2876417841
958 2876422736
959 2878038809
960 2878732534
961 2878741496
962 2878749668
963 2878759838
964 2878761955
965 2878768921
966 2878783794
967 2881149092
968 2881160330
969 2881165932
970 2881846589
971 2881853462
972 2881864972
973 2882638396
974 2882915722
975 2885307416
976 2885313550
977 2885322378
978 2885333943
979 2885335578
980 2885349467
981 2885355186
982 2888337621
983 2888344943
984 2889015853
985 2889019096
986 2896390245
987 2898798912
988 2899808014
989 2903455059
990 2903493897
991 2903494062
992 2903517472
993 2903523401
994 2903531397
995 2903542530
996 2904663326
997 2906310706
998 2906324769
999 2906333567
1000 2906367114
1001 2906377555
1002 2906391095
1003 2906399324
1004 2906405011
1005 2906408564
1006 2906417815
1007 2906428915
1008 2913312166
1009 2919175753
1010 2919411213
1011 2920760370
1012 2920825902
1013 2922155485
1014 2922159604
1015 2922174910
1016 2924714031
1017 2924726383
1018 2924732295
1019 2924737128
1020 2924749974
1021 2924758179
1022 2924766635
1023 2924779178
1024 2924790480
1025 2937817533
1026 2937828073
1027 2937841168
1028 2937848497
1029 2937849454
1030 2937865935
1031 2937883171
1032 2937893062
1033 2937979217
1034 2937985881
1035 2937996383
1036 2938014893
1037 2941501320
1038 2958041014
1039 2958057508
1040 2958070199
1041 2958090337
1042 2958100268
1043 2958101200
1044 2958108871
1045 2958115220
1046 2958127975
1047 2958132559
1048 2958140487
1049 2958145429
1050 2958160280
1051 2958166853
1052 2958174340
1053 2958182373
1054 2961080218
1055 2961118353
1056 2961129161
1057 2961138758
1058 2961165323
1059 2961177713
1060 2961187351
1061 2963645873
1062 2965020145
1063 2965030821
1064 2965039319
1065 2965040718
1066 2965054566
1067 2965064491
1068 2965096315
1069 2965109649
1070 2965117980
1071 2965120973
1072 2968002200
1073 2968009434
1074 2968022608
1075 2968089383
1076 2968091717
1077 2968102048
1078 2968114414
1079 2968123529
1080 2968133313
1081 2968142038
1082 2968173724
1083 2970475192
1084 2970491362
1085 2970510391
1086 2970526670
1087 2970539217
1088 2970543469
1089 2970549274
1090 2970556810
1091 2970599925
1092 2970623753
1093 2970628170
1094 2977828360
1095 2977831702
1096 2977847821
1097 2977857402
1098 2977861120
1099 2977868800
1100 2977879269
1101 2977904313
1102 2977910908
1103 2977915768
1104 2977923732
1105 2977937946
1106 2977950093
1107 2977955835
1108 2977957901
1109 2977989594
1110 2979713263
1111 2979768427
1112 2979775489
1113 2979782570
1114 2979793585
1115 2979815264
1116 2987644163
1117 2987651620
1118 2987654057
1119 2987661330
1120 2987671021
1121 2987678086
1122 2996315522
1123 2996341911
1124 2996353382
1125 2996393439
1126 3000141659
1127 3000408368
1128 3002141392
1129 3003669138
1130 3004173894
1131 3004190379
1132 3004199028
1133 3004208312
1134 3004212927
1135 3004220606
1136 3004233259
1137 3004245986
1138 3004249932
1139 3004272131
1140 3004280064
1141 3004336577
1142 3005421472
1143 637076411
1144 643827349
1145 649871115
1146 8002290443
1147 8004305779
1148 8004318764
1149 8004368711
1150 8004381336
1151 8004389944
1152 8004450981
1153 8004639522
1154 8004645296
1155 8004700086
1156 8004718341
1157 8004727747
1158 8005249328
1159 8005319825
1160 8005490449
1161 8005647093
1162 8005687023
1163 8018153401
1164 8046767419
1165 8055618514
1166 8057578443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05762

VWA_CoxE

VWA domain containing CoxE-like protein

183

279

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wrr-assembly1.cif.gz_B a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.5515 235 314
3lyh-assembly1.cif.gz_A crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.5446 235 309
4rad-assembly1.cif.gz_A aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents 0.5415 184 353
5brn-assembly1.cif.gz_B human hgprt in complex with (s)-hpephx, an acyclic nucleoside phosphonate 0.5396 185 353
4rad-assembly2.cif.gz_G aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents 0.531 185 353
ID Description Score Start End Superfamily
af_A0A0G2K7L7_66_197_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6947 234 272 3.40.50.410
af_P20702_20_252_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6392 222 274 3.40.50.410
af_Q54DB3_435_724_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.613 234 280 3.40.50.410
af_K7URV3_217_339_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.6019 234 269 3.40.190.80
2p11B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5435 308 379 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A530NHH5-F1-model_v4 deleted 0.9908 299 396
AF-A0A659YHS6-F1-model_v4 deleted 0.9841 1 66
AF-A0A5C7YLX1-F1-model_v4 VWA domain-containing protein 0.9836 304 394
AF-A0A520EI00-F1-model_v4 deleted 0.9834 295 396
AF-A0A352V4F5-F1-model_v4 VWA domain-containing protein 0.9804 293 392

Map