F466301

General Info

Members Datasets Scaffolds Average Seq Length
583 260 582 264

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0292784|Ga0495651_0292784_194_1051
Length 285
Sequence MGSRFDNLRLNRHIMTLTPRYSAVALLFLGLSTGALAMQRGAGLSQFPIPQSRSPYGYVDTTHEFAWSRLQYTPLGGAFGGFGRGASWSRDYPKADITFLAALRRLTRVDARSYQQVVNLGNDDIFNYPFVYAVQVASWTFTEAEAKRLREYLLKGGFLMVDDFHGTADWDSFLRGMRMALPADEYPISDLADGDEIFHVMYDIGQRFQVPGEQFVATGRTYEKDGYVPKWRAIRDGKGRIIVAICHNMHLGDAWEWADSAEYPEPFAAMAFRVGIDYVMYSMTH

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 2.92
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 1.72
Rhizosphere 95.54
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10027318 3300003659 Bacteria 1227
2 Ga0058863_11907544 3300004799 Bacteria 1014
3 Ga0058861_11969837 3300004800 Bacteria 1269
4 Ga0058861_12014651 3300004800 Bacteria 1178
5 Ga0058862_12827812 3300004803 Bacteria 917
6 Ga0058862_12854581 3300004803 Bacteria 1226
7 Ga0070658_10006025 3300005327 Bacteria 9839
8 Ga0070658_10146270 3300005327 Unclassified 1976
9 Ga0070658_10261902 3300005327 Bacteria 1469
10 Ga0070658_10319824 3300005327 Bacteria 1325
11 Ga0070676_10018046 3300005328 Bacteria 3907
12 Ga0070683_100000035 3300005329 Bacteria 122362
13 Ga0070683_100187501 3300005329 Bacteria 1964
14 Ga0070670_100010900 3300005331 Bacteria 7765
15 Ga0070677_10077523 3300005333 Bacteria 1414
16 Ga0068869_100062533 3300005334 Bacteria 2733
17 Ga0070666_10025215 3300005335 Bacteria 3875
18 Ga0070666_10054158 3300005335 Bacteria 2706
19 Ga0070680_100018222 3300005336 Bacteria 5546
20 Ga0070680_100028659 3300005336 Bacteria 4467
21 Ga0070680_100190288 3300005336 Bacteria 1729
22 Ga0068868_100015271 3300005338 Bacteria 5676
23 Ga0068868_100309265 3300005338 Bacteria 1344
24 Ga0070660_100019765 3300005339 Bacteria 4941
25 Ga0070691_10099751 3300005341 Bacteria 1441
26 Ga0070691_10206620 3300005341 Bacteria 1034
27 Ga0070661_100135256 3300005344 Bacteria 1854
28 Ga0070668_100035497 3300005347 Bacteria 3802
29 Ga0070668_100094850 3300005347 Bacteria 2356
30 Ga0070668_100155452 3300005347 Bacteria 1852
31 Ga0070675_100012874 3300005354 Bacteria 6565
32 Ga0070671_100007646 3300005355 Bacteria 8641
33 Ga0070671_100222123 3300005355 Bacteria 1602
34 Ga0070673_100023631 3300005364 Bacteria 4493
35 Ga0070667_100030654 3300005367 Bacteria 4486
36 Ga0070714_100000992 3300005435 Bacteria 20251
37 Ga0070714_100069565 3300005435 Bacteria 3041
38 Ga0070714_100092771 3300005435 Bacteria 2647
39 Ga0070713_100002621 3300005436 Bacteria 11736
40 Ga0070713_100170804 3300005436 Bacteria 1948
41 Ga0070713_100409098 3300005436 Unclassified 1268
42 Ga0070713_100434904 3300005436 Unclassified 1230
43 Ga0070713_100500918 3300005436 Bacteria 1146
44 Ga0070711_100123069 3300005439 Bacteria 1921
45 Ga0070663_100138714 3300005455 Bacteria 1854
46 Ga0070662_100086679 3300005457 Bacteria 2342
47 Ga0070681_10009661 3300005458 Bacteria 9488
48 Ga0070681_10053834 3300005458 Bacteria 4010
49 Ga0068867_100289812 3300005459 Bacteria 1345
50 Ga0070698_100001024 3300005471 Bacteria 30722
51 Ga0070699_100033445 3300005518 Bacteria 4442
52 Ga0070699_100186543 3300005518 Unclassified 1842
53 Ga0070699_100337555 3300005518 Bacteria 1356
54 Ga0070679_100000708 3300005530 Bacteria 28643
55 Ga0070679_100008336 3300005530 Bacteria 9749
56 Ga0070679_100033285 3300005530 Bacteria 5104
57 Ga0070679_100039932 3300005530 Bacteria 4665
58 Ga0070679_100051271 3300005530 Bacteria 4110
59 Ga0070684_100000037 3300005535 Bacteria 95058
60 Ga0070684_100021531 3300005535 Bacteria 5367
61 Ga0070684_100133334 3300005535 Bacteria 2242
62 Ga0070697_100065430 3300005536 Bacteria 2971
63 Ga0070697_100503366 3300005536 Unclassified 1059
64 Ga0068853_100114776 3300005539 Bacteria 2396
65 Ga0068853_100138596 3300005539 Bacteria 2183
66 Ga0068853_100340545 3300005539 Bacteria 1393
67 Ga0068853_100733934 3300005539 Bacteria 943
68 Ga0070695_100409310 3300005545 Unclassified 1030
69 Ga0070665_100049583 3300005548 Unclassified 4212
70 Ga0070665_100140419 3300005548 Bacteria 2419
71 Ga0068855_100000283 3300005563 Bacteria 62643
72 Ga0068855_100001444 3300005563 Bacteria 29612
73 Ga0068855_100004621 3300005563 Bacteria 16801
74 Ga0068855_100027490 3300005563 Bacteria 6803
75 Ga0068855_100156781 3300005563 Bacteria 2586
76 Ga0068855_100190655 3300005563 Bacteria 2312
77 Ga0068855_100251772 3300005563 Bacteria 1970
78 Ga0068855_100289880 3300005563 Unclassified 1815
79 Ga0068855_100389553 3300005563 Unclassified 1529
80 Ga0070664_100220689 3300005564 Bacteria 1696
81 Ga0068857_100044294 3300005577 Bacteria 3947
82 Ga0068854_100020329 3300005578 Bacteria 4490
83 Ga0068854_100138693 3300005578 Bacteria 1864
84 Ga0068854_100218669 3300005578 Bacteria 1506
85 Ga0068854_100247589 3300005578 Unclassified 1422
86 Ga0068856_100057784 3300005614 Bacteria 3830
87 Ga0068856_100067983 3300005614 Bacteria 3521
88 Ga0068856_100168132 3300005614 Bacteria 2204
89 Ga0068856_100293081 3300005614 Bacteria 1644
90 Ga0068856_100473622 3300005614 Bacteria 1273
91 Ga0070702_100102935 3300005615 Bacteria 1755
92 Ga0068852_100014996 3300005616 Bacteria 5989
93 Ga0068852_100035373 3300005616 Bacteria 4166
94 Ga0068852_100056039 3300005616 Bacteria 3405
95 Ga0068864_100089227 3300005618 Bacteria 2716
96 Ga0068864_100187672 3300005618 Bacteria 1893
97 Ga0068863_100033107 3300005841 Bacteria 4924
98 Ga0068858_100052541 3300005842 Bacteria 3770
99 Ga0068860_100133307 3300005843 Bacteria 2385
100 Ga0081540_1002265 3300005983 Bacteria 15829
101 Ga0070717_10032582 3300006028 Bacteria 4200
102 Ga0070717_10047098 3300006028 Unclassified 3531
103 Ga0075367_10021715 3300006178 Bacteria 3591
104 Ga0097621_100047075 3300006237 Bacteria 3492
105 Ga0097621_100478606 3300006237 Unclassified 1125
106 Ga0097621_100648306 3300006237 Bacteria 969
107 Ga0068871_100199120 3300006358 Bacteria 1728
108 Ga0068865_100023036 3300006881 Bacteria 4072
109 Ga0075436_100098945 3300006914 Bacteria 2030
110 Ga0075435_100338116 3300007076 Bacteria 1290
111 Ga0099794_10077857 3300007265 Bacteria 1632
112 Ga0099795_10075583 3300007788 Bacteria 1279
113 Ga0105240_10000531 3300009093 Bacteria 70393
114 Ga0105240_10000987 3300009093 Bacteria 50763
115 Ga0105240_10002185 3300009093 Bacteria 31954
116 Ga0105240_10006817 3300009093 Bacteria 16706
117 Ga0105240_10033202 3300009093 Bacteria 6671
118 Ga0105240_10069942 3300009093 Bacteria 4343
119 Ga0105240_10154791 3300009093 Unclassified 2728
120 Ga0105240_10164819 3300009093 Bacteria 2629
121 Ga0105240_10338880 3300009093 Bacteria 1709
122 Ga0105240_10374304 3300009093 Bacteria 1610
123 Ga0105240_10553479 3300009093 Bacteria 1272
124 Ga0105245_10020117 3300009098 Bacteria 5851
125 Ga0105245_10103660 3300009098 Bacteria 2636
126 Ga0105247_10044484 3300009101 Bacteria 2723
127 Ga0105247_10181129 3300009101 Bacteria 1406
128 Ga0105243_10057968 3300009148 Bacteria 3085
129 Ga0105241_10109652 3300009174 Bacteria 2208
130 Ga0105242_10073011 3300009176 Bacteria 2851
131 Ga0105242_10226003 3300009176 Unclassified 1675
132 Ga0105248_10076909 3300009177 Bacteria 3751
133 Ga0105248_10273541 3300009177 Bacteria 1902
134 Ga0105237_10013779 3300009545 Bacteria 8466
135 Ga0105237_10041655 3300009545 Bacteria 4631
136 Ga0105237_10060012 3300009545 Bacteria 3805
137 Ga0105237_10145564 3300009545 Bacteria 2364
138 Ga0105237_10188031 3300009545 Unclassified 2065
139 Ga0105237_10262288 3300009545 Bacteria 1730
140 Ga0105237_10292554 3300009545 Bacteria 1631
141 Ga0105238_10002780 3300009551 Bacteria 17460
142 Ga0105238_10014800 3300009551 Bacteria 7890
143 Ga0105238_10046614 3300009551 Bacteria 4372
144 Ga0105238_10063959 3300009551 Bacteria 3680
145 Ga0105238_10100814 3300009551 Bacteria 2870
146 Ga0105238_10336378 3300009551 Unclassified 1497
147 Ga0105249_10042373 3300009553 Bacteria 4139
148 Ga0105249_10053953 3300009553 Bacteria 3675
149 Ga0099796_10043980 3300010159 Unclassified 1524
150 Ga0105239_10168437 3300010375 Bacteria 2449
151 Ga0157371_10038123 3300013102 Bacteria 3439
152 Ga0157370_10002599 3300013104 Bacteria 21696
153 Ga0157370_10006045 3300013104 Bacteria 13455
154 Ga0157370_10026916 3300013104 Bacteria 5672
155 Ga0157370_10062741 3300013104 Bacteria 3523
156 Ga0157370_10165208 3300013104 Unclassified 2058
157 Ga0157370_10242772 3300013104 Unclassified 1666
158 Ga0157369_10036249 3300013105 Bacteria 5405
159 Ga0157369_10040778 3300013105 Bacteria 5068
160 Ga0157369_10042191 3300013105 Bacteria 4977
161 Ga0157369_10048445 3300013105 Bacteria 4611
162 Ga0157369_10056657 3300013105 Bacteria 4229
163 Ga0157369_10132915 3300013105 Bacteria 2636
164 Ga0157369_10234682 3300013105 Bacteria 1917
165 Ga0157369_10271285 3300013105 Unclassified 1768
166 Ga0157374_10000387 3300013296 Bacteria 40397
167 Ga0157374_10003041 3300013296 Bacteria 14064
168 Ga0157374_10097703 3300013296 Bacteria 2810
169 Ga0157374_10175292 3300013296 Bacteria 2093
170 Ga0157374_10178934 3300013296 Bacteria 2071
171 Ga0157374_10457828 3300013296 Bacteria 1278
172 Ga0157378_10003951 3300013297 Bacteria 13100
173 Ga0157378_10006432 3300013297 Bacteria 10273
174 Ga0157378_10334260 3300013297 Bacteria 1475
175 Ga0163162_10385747 3300013306 Bacteria 1534
176 Ga0157372_10010004 3300013307 Bacteria 10086
177 Ga0157372_10013591 3300013307 Bacteria 8702
178 Ga0157372_10014094 3300013307 Bacteria 8537
179 Ga0157372_10019755 3300013307 Bacteria 7261
180 Ga0157372_10257007 3300013307 Bacteria 2028
181 Ga0157372_10542872 3300013307 Bacteria 1355
182 Ga0157375_10145975 3300013308 Bacteria 2497
183 Ga0157375_10769994 3300013308 Unclassified 1113
184 Ga0163163_10001209 3300014325 Bacteria 21835
185 Ga0163163_10092508 3300014325 Bacteria 3039
186 Ga0157377_10073139 3300014745 Bacteria 1986
187 Ga0157379_10060117 3300014968 Bacteria 3397
188 Ga0157379_10153132 3300014968 Bacteria 2080
189 Ga0157376_10050457 3300014969 Bacteria 3452
190 Ga0163161_10207752 3300017792 Bacteria 1511
191 Ga0197907_10508567 3300020069 Bacteria 1010
192 Ga0206356_10135058 3300020070 Bacteria 1020
193 Ga0206351_10143000 3300020077 Bacteria 2540
194 Ga0206352_10850448 3300020078 Bacteria 1048
195 Ga0206352_11098780 3300020078 Bacteria 954
196 Ga0206350_11177540 3300020080 Bacteria 1250
197 Ga0206354_10784727 3300020081 Bacteria 975
198 Ga0154015_1094687 3300020610 Bacteria 1002
199 Ga0154015_1686291 3300020610 Bacteria 1313
200 Ga0213872_10039473 3300021361 Bacteria 2154
201 Ga0209233_1001450 3300025261 Bacteria 9359
202 Ga0207697_10025858 3300025315 Bacteria 2399
203 Ga0207692_10030827 3300025898 Unclassified 2562
204 Ga0207642_10092773 3300025899 Bacteria 1496
205 Ga0207688_10174670 3300025901 Bacteria 1279
206 Ga0207680_10074045 3300025903 Bacteria 2119
207 Ga0207680_10102534 3300025903 Bacteria 1841
208 Ga0207647_10024187 3300025904 Bacteria 4007
209 Ga0207647_10044541 3300025904 Bacteria 2772
210 Ga0207647_10198850 3300025904 Bacteria 1160
211 Ga0207699_10205566 3300025906 Bacteria 1337
212 Ga0207699_10290101 3300025906 Unclassified 1140
213 Ga0207645_10057640 3300025907 Bacteria 2480
214 Ga0207705_10011320 3300025909 Bacteria 6460
215 Ga0207705_10046956 3300025909 Bacteria 3104
216 Ga0207705_10052394 3300025909 Bacteria 2938
217 Ga0207705_10244428 3300025909 Bacteria 1368
218 Ga0207707_10000107 3300025912 Bacteria 82899
219 Ga0207707_10028648 3300025912 Bacteria 4867
220 Ga0207707_10073505 3300025912 Bacteria 2981
221 Ga0207707_10169612 3300025912 Bacteria 1907
222 Ga0207695_10002371 3300025913 Bacteria 27983
223 Ga0207695_10004580 3300025913 Bacteria 18785
224 Ga0207695_10008245 3300025913 Bacteria 13077
225 Ga0207695_10015076 3300025913 Bacteria 9118
226 Ga0207695_10077491 3300025913 Bacteria 3376
227 Ga0207695_10126381 3300025913 Bacteria 2518
228 Ga0207695_10188417 3300025913 Bacteria 1981
229 Ga0207695_10214671 3300025913 Unclassified 1833
230 Ga0207671_10042817 3300025914 Bacteria 3350
231 Ga0207671_10067484 3300025914 Bacteria 2664
232 Ga0207671_10182706 3300025914 Bacteria 1632
233 Ga0207671_10287337 3300025914 Bacteria 1298
234 Ga0207693_10034229 3300025915 Bacteria 4008
235 Ga0207663_10129854 3300025916 Bacteria 1739
236 Ga0207660_10021314 3300025917 Bacteria 4357
237 Ga0207660_10073419 3300025917 Bacteria 2494
238 Ga0207660_10080182 3300025917 Unclassified 2396
239 Ga0207660_10243747 3300025917 Bacteria 1417
240 Ga0207657_10021392 3300025919 Bacteria 6088
241 Ga0207657_10023865 3300025919 Bacteria 5682
242 Ga0207649_10088533 3300025920 Bacteria 2022
243 Ga0207652_10003528 3300025921 Bacteria 12904
244 Ga0207652_10009932 3300025921 Bacteria 7661
245 Ga0207652_10122191 3300025921 Bacteria 2317
246 Ga0207652_10265459 3300025921 Bacteria 1548
247 Ga0207646_10433787 3300025922 Bacteria 1186
248 Ga0207694_10010308 3300025924 Bacteria 7046
249 Ga0207694_10046792 3300025924 Bacteria 3344
250 Ga0207694_10054405 3300025924 Bacteria 3105
251 Ga0207694_10108005 3300025924 Bacteria 2211
252 Ga0207694_10257166 3300025924 Unclassified 1430
253 Ga0207650_10068238 3300025925 Bacteria 2670
254 Ga0207687_10069369 3300025927 Bacteria 2514
255 Ga0207687_10169819 3300025927 Bacteria 1681
256 Ga0207700_10139428 3300025928 Bacteria 1991
257 Ga0207700_10326911 3300025928 Bacteria 1330
258 Ga0207700_10344491 3300025928 Unclassified 1296
259 Ga0207700_10510899 3300025928 Unclassified 1064
260 Ga0207664_10001747 3300025929 Bacteria 14318
261 Ga0207664_10411590 3300025929 Bacteria 1204
262 Ga0207664_10470888 3300025929 Bacteria 1123
263 Ga0207644_10075752 3300025931 Bacteria 2473
264 Ga0207706_10005440 3300025933 Bacteria 11864
265 Ga0207691_10024517 3300025940 Bacteria 5672
266 Ga0207711_10085635 3300025941 Bacteria 2762
267 Ga0207711_10306596 3300025941 Bacteria 1465
268 Ga0207689_10028782 3300025942 Bacteria 4645
269 Ga0207661_10000008 3300025944 Bacteria 451211
270 Ga0207661_10153675 3300025944 Bacteria 1991
271 Ga0207661_10440129 3300025944 Unclassified 1186
272 Ga0207679_10192157 3300025945 Bacteria 1698
273 Ga0207667_10000696 3300025949 Bacteria 43589
274 Ga0207667_10015029 3300025949 Bacteria 8806
275 Ga0207667_10017436 3300025949 Bacteria 8081
276 Ga0207667_10020653 3300025949 Bacteria 7319
277 Ga0207667_10024727 3300025949 Bacteria 6587
278 Ga0207667_10148939 3300025949 Unclassified 2409
279 Ga0207667_10252783 3300025949 Unclassified 1803
280 Ga0207667_10285593 3300025949 Unclassified 1686
281 Ga0207651_10259685 3300025960 Bacteria 1425
282 Ga0207668_10094991 3300025972 Bacteria 2200
283 Ga0207668_10187549 3300025972 Bacteria 1636
284 Ga0207640_10074667 3300025981 Bacteria 2295
285 Ga0207640_10092806 3300025981 Bacteria 2095
286 Ga0207640_10261131 3300025981 Bacteria 1349
287 Ga0207640_10500324 3300025981 Unclassified 1012
288 Ga0207658_10434717 3300025986 Bacteria 1159
289 Ga0207677_10173171 3300026023 Bacteria 1690
290 Ga0207677_10252133 3300026023 Bacteria 1434
291 Ga0207703_10263616 3300026035 Bacteria 1558
292 Ga0207639_10076941 3300026041 Bacteria 2629
293 Ga0207639_10263905 3300026041 Bacteria 1507
294 Ga0207639_10275900 3300026041 Bacteria 1477
295 Ga0207639_10887773 3300026041 Unclassified 833
296 Ga0207678_10047742 3300026067 Bacteria 3702
297 Ga0207678_10116755 3300026067 Bacteria 2277
298 Ga0207702_10134998 3300026078 Bacteria 2225
299 Ga0207702_10463833 3300026078 Bacteria 1231
300 Ga0207702_10502876 3300026078 Bacteria 1182
301 Ga0207702_10558798 3300026078 Bacteria 1120
302 Ga0207641_10005669 3300026088 Bacteria 10630
303 Ga0207641_10076186 3300026088 Bacteria 2899
304 Ga0207676_10045029 3300026095 Bacteria 3407
305 Ga0207676_10248995 3300026095 Bacteria 1598
306 Ga0207674_10036599 3300026116 Bacteria 5110
307 Ga0207675_100349539 3300026118 Bacteria 1449
308 Ga0207683_10003440 3300026121 Bacteria 13800
309 Ga0207698_10191033 3300026142 Unclassified 1824
310 Ga0207698_10311426 3300026142 Bacteria 1470
311 Ga0268266_10001873 3300028379 Bacteria 23746
312 Ga0268266_10070403 3300028379 Bacteria 3031
313 Ga0268266_10127042 3300028379 Bacteria 2277
314 Ga0265319_1000898 3300028563 Bacteria 18743
315 Ga0265318_10000151 3300028577 Bacteria 62611
316 Ga0265318_10016367 3300028577 Unclassified 3064
317 Ga0265336_10061547 3300028666 Bacteria 1126
318 Ga0265338_10007585 3300028800 Bacteria 13403
319 Ga0265338_10031750 3300028800 Bacteria 5170
320 Ga0265338_10135718 3300028800 Bacteria 1935
321 Ga0265338_10162437 3300028800 Bacteria 1723
322 Ga0265338_10194327 3300028800 Bacteria 1535
323 Ga0265338_10233144 3300028800 Bacteria 1368
324 Ga0265763_1001273 3300030763 Bacteria 1773
325 Ga0265760_10042896 3300031090 Bacteria 1351
326 Ga0265760_10055553 3300031090 Bacteria 1197
327 Ga0265330_10011707 3300031235 Unclassified 4110
328 Ga0265332_10002631 3300031238 Bacteria 9042
329 Ga0265320_10000105 3300031240 Bacteria 72088
330 Ga0265325_10001059 3300031241 Bacteria 19779
331 Ga0265325_10006713 3300031241 Bacteria 6963
332 Ga0265325_10017784 3300031241 Bacteria 3949
333 Ga0265325_10153539 3300031241 Bacteria 1087
334 Ga0265325_10178481 3300031241 Bacteria 990
335 Ga0265329_10000054 3300031242 Bacteria 49499
336 Ga0265329_10091027 3300031242 Unclassified 968
337 Ga0265340_10005124 3300031247 Bacteria 7285
338 Ga0265340_10012280 3300031247 Unclassified 4526
339 Ga0265339_10000583 3300031249 Bacteria 28465
340 Ga0265339_10037533 3300031249 Unclassified 2707
341 Ga0265339_10061609 3300031249 Bacteria 2018
342 Ga0265331_10000189 3300031250 Bacteria 75772
343 Ga0265331_10041235 3300031250 Unclassified 2243
344 Ga0265331_10086404 3300031250 Bacteria 1453
345 Ga0265316_10001191 3300031344 Bacteria 28176
346 Ga0265316_10049157 3300031344 Bacteria 3323
347 Ga0265316_10120089 3300031344 Bacteria 1985
348 Ga0265316_10269498 3300031344 Bacteria 1246
349 Ga0265313_10000621 3300031595 Bacteria 36704
350 Ga0265314_10000055 3300031711 Bacteria 172478
351 Ga0265314_10008975 3300031711 Bacteria 8510
352 Ga0265342_10000382 3300031712 Bacteria 49009
353 Ga0265342_10001832 3300031712 Bacteria 19265
354 Ga0265342_10075456 3300031712 Bacteria 1956
355 Ga0307510_10040310 3300033180 Bacteria 5128
356 Ga0307510_10216305 3300033180 Unclassified 1433
357 Ga0373926_0003545 3300035083 Bacteria 5053
358 Ga0373923_0001384 3300035111 Bacteria 6910
359 Ga0373954_0017282 3300035118 Bacteria 3238
360 Ga0373954_0107663 3300035118 Bacteria 1347
361 Ga0373956_0045458 3300035119 Unclassified 1959
362 Ga0373943_0260129 3300035170 Bacteria 977
363 Ga0373935_0005554 3300035692 Bacteria 7430
364 Ga0373935_0016504 3300035692 Bacteria 4467
365 Ga0373935_0296511 3300035692 Bacteria 1142
366 Ga0373935_0378205 3300035692 Bacteria 1014
367 Ga0373933_0000621 3300035724 Bacteria 22159
368 Ga0373933_0012619 3300035724 Bacteria 4669
369 Ga0373937_0001927 3300036401 Bacteria 17361
370 Ga0373937_0001985 3300036401 Bacteria 17112
371 Ga0373937_0033202 3300036401 Bacteria 4685
372 Ga0373937_0106613 3300036401 Bacteria 2605
373 Ga0395898_0755351 3300037466 Bacteria 914
374 Ga0436361_0350943 3300039447 Bacteria 16088
375 Ga0436361_1210201 3300039447 Bacteria 975
376 Ga0436363_0237435 3300039450 Bacteria 1835
377 Ga0466969_0008525 3300044656 Bacteria 5440
378 Ga0466959_0097773 3300045049 Unclassified 2103
379 Ga0466967_0296048 3300045976 Bacteria 1556
380 Ga0495592_0021852 3300046454 Bacteria 4869
381 Ga0495592_0298613 3300046454 Unclassified 1048
382 Ga0495603_0008247 3300046455 Bacteria 6296
383 Ga0495629_0002270 3300046459 Bacteria 14829
384 Ga0495629_0003365 3300046459 Bacteria 12077
385 Ga0495651_0000024 3300046462 Bacteria 113645
386 Ga0495651_0001109 3300046462 Bacteria 20801
387 Ga0495651_0008221 3300046462 Bacteria 7997
388 Ga0495651_0011609 3300046462 Bacteria 6770
389 Ga0495651_0067144 3300046462 Bacteria 2736
390 Ga0495651_0292784 3300046462 Bacteria 1095
391 Ga0495653_0003041 3300046463 Bacteria 13455
392 Ga0495653_0031977 3300046463 Bacteria 4181
393 Ga0495653_0070134 3300046463 Bacteria 2624
394 Ga0495653_0116656 3300046463 Bacteria 1909
395 Ga0495653_0218892 3300046463 Bacteria 1281
396 Ga0495650_0020899 3300046471 Bacteria 3179
397 Ga0495580_0013009 3300046472 Bacteria 6372
398 Ga0495580_0084610 3300046472 Bacteria 2209
399 Ga0495580_0166828 3300046472 Bacteria 1523
400 Ga0495580_0266332 3300046472 Bacteria 1171
401 Ga0495580_0409445 3300046472 Unclassified 913
402 Ga0495582_0012856 3300046473 Bacteria 4612
403 Ga0495582_0027443 3300046473 Bacteria 3121
404 Ga0495582_0174348 3300046473 Bacteria 1225
405 Ga0495639_0004247 3300046475 Bacteria 6149
406 Ga0495662_0044531 3300046476 Bacteria 2142
407 Ga0495664_0001028 3300046477 Bacteria 14441
408 Ga0495664_0004479 3300046477 Bacteria 7646
409 Ga0495664_0044105 3300046477 Bacteria 2643
410 Ga0495664_0105303 3300046477 Bacteria 1700
411 Ga0495664_0115211 3300046477 Bacteria 1624
412 Ga0495664_0194508 3300046477 Unclassified 1229
413 Ga0495594_0000369 3300046499 Bacteria 22598
414 Ga0495594_0002282 3300046499 Bacteria 9992
415 Ga0495594_0147745 3300046499 Bacteria 1334
416 Ga0495583_0022439 3300046506 Bacteria 3220
417 Ga0495583_0028612 3300046506 Unclassified 2737
418 Ga0495608_0006362 3300046511 Bacteria 8385
419 Ga0495608_0008044 3300046511 Bacteria 7411
420 Ga0495608_0117430 3300046511 Bacteria 1707
421 Ga0495608_0158674 3300046511 Bacteria 1439
422 Ga0495608_0210991 3300046511 Unclassified 1221
423 Ga0495618_0005841 3300046514 Bacteria 7481
424 Ga0495628_0001985 3300046516 Bacteria 18552
425 Ga0495628_0003864 3300046516 Bacteria 13341
426 Ga0495628_0117622 3300046516 Unclassified 2041
427 Ga0495630_0001862 3300046517 Bacteria 14726
428 Ga0495630_0012406 3300046517 Bacteria 6188
429 Ga0495630_0015333 3300046517 Bacteria 5595
430 Ga0495631_0058794 3300046518 Bacteria 1671
431 Ga0495644_0000023 3300046523 Bacteria 79095
432 Ga0495666_0003659 3300046526 Bacteria 7761
433 Ga0495666_0125849 3300046526 Bacteria 1198
434 Ga0495642_0129090 3300046528 Bacteria 1087
435 Ga0495652_0006933 3300046529 Bacteria 10483
436 Ga0495652_0015495 3300046529 Bacteria 6825
437 Ga0495652_0039436 3300046529 Bacteria 4084
438 Ga0495652_0089976 3300046529 Bacteria 2512
439 Ga0495652_0134147 3300046529 Bacteria 1955
440 Ga0495665_0006874 3300046531 Bacteria 6139
441 Ga0495665_0035376 3300046531 Bacteria 2668
442 Ga0495665_0070153 3300046531 Bacteria 1847
443 Ga0495640_0038545 3300046533 Bacteria 3361
444 Ga0495640_0057752 3300046533 Unclassified 2648
445 Ga0495586_0040796 3300046535 Bacteria 2498
446 Ga0495587_0000750 3300046536 Bacteria 21634
447 Ga0495587_0008576 3300046536 Bacteria 6571
448 Ga0495587_0093032 3300046536 Bacteria 1741
449 Ga0495587_0139684 3300046536 Unclassified 1383
450 Ga0495645_0007260 3300046543 Bacteria 7711
451 Ga0495645_0015846 3300046543 Bacteria 5367
452 Ga0495645_0027121 3300046543 Bacteria 4160
453 Ga0495645_0142853 3300046543 Bacteria 1669
454 Ga0495622_0198778 3300046557 Bacteria 894
455 Ga0495633_0038163 3300046558 Bacteria 2296
456 Ga0495667_0001411 3300046559 Bacteria 15799
457 Ga0495667_0021672 3300046559 Bacteria 4336
458 Ga0495667_0052135 3300046559 Bacteria 2696
459 Ga0495667_0069306 3300046559 Bacteria 2302
460 Ga0495668_0291491 3300046616 Unclassified 894
461 Ga0495634_0017226 3300046642 Bacteria 5158
462 Ga0495634_0106849 3300046642 Bacteria 1803
463 Ga0495634_0294234 3300046642 Bacteria 983
464 Ga0495625_0000796 3300046660 Bacteria 43709
465 Ga0495625_0053725 3300046660 Bacteria 2880
466 Ga0495625_0083329 3300046660 Unclassified 2223
467 Ga0495635_0030836 3300046663 Bacteria 3725
468 Ga0495657_0003833 3300046675 Bacteria 12148
469 Ga0495657_0019873 3300046675 Bacteria 4840
470 Ga0495657_0225553 3300046675 Unclassified 1135
471 Ga0495599_0036136 3300046678 Bacteria 3101
472 Ga0495623_0002696 3300046679 Bacteria 11727
473 Ga0495623_0002699 3300046679 Bacteria 11724
474 Ga0495623_0007196 3300046679 Bacteria 7226
475 Ga0495623_0007967 3300046679 Bacteria 6884
476 Ga0495623_0152596 3300046679 Bacteria 1364
477 Ga0495646_0007090 3300046680 Bacteria 7120
478 Ga0495646_0101057 3300046680 Bacteria 1654
479 Ga0495669_0002280 3300046684 Bacteria 7869
480 Ga0495669_0076008 3300046684 Bacteria 1537
481 Ga0495613_0007057 3300046689 Bacteria 8362
482 Ga0495613_0021250 3300046689 Bacteria 4840
483 Ga0495613_0051731 3300046689 Bacteria 3027
484 Ga0495613_0054867 3300046689 Bacteria 2929
485 Ga0495613_0235990 3300046689 Bacteria 1280
486 Ga0495624_0002205 3300046690 Bacteria 14879
487 Ga0495624_0002954 3300046690 Bacteria 12720
488 Ga0495624_0032057 3300046690 Bacteria 3409
489 Ga0495624_0469465 3300046690 Unclassified 754
490 Ga0495649_0037809 3300046694 Unclassified 2649
491 Ga0495589_0186306 3300046794 Unclassified 983
492 Ga0495600_0003466 3300046809 Bacteria 9282
493 Ga0495581_0007694 3300047315 Bacteria 6234
494 Ga0495581_0041552 3300047315 Bacteria 2661
495 Ga0495604_0003709 3300047317 Bacteria 12166
496 Ga0495604_0069122 3300047317 Unclassified 2678
497 Ga0495604_0336096 3300047317 Bacteria 1006
498 Ga0495674_0002093 3300047319 Bacteria 19591
499 Ga0495674_0046674 3300047319 Bacteria 3844
500 Ga0495674_0053638 3300047319 Bacteria 3543
501 Ga0495674_0055844 3300047319 Bacteria 3461
502 Ga0495674_0231041 3300047319 Bacteria 1526
503 Ga0495674_0265424 3300047319 Unclassified 1409
504 Ga0495674_0344075 3300047319 Bacteria 1211
505 Ga0495674_0393806 3300047319 Unclassified 1119
506 Ga0495672_0001628 3300047320 Bacteria 21845
507 Ga0495676_0018292 3300047321 Bacteria 6178
508 Ga0495680_0000749 3300047322 Bacteria 36388
509 Ga0495680_0020341 3300047322 Bacteria 5586
510 Ga0495680_0087536 3300047322 Bacteria 2343
511 Ga0495680_0138896 3300047322 Bacteria 1779
512 Ga0495675_0000052 3300047444 Bacteria 79959
513 Ga0495675_0001719 3300047444 Bacteria 13101
514 Ga0495675_0007813 3300047444 Bacteria 6602
515 Ga0495675_0013990 3300047444 Bacteria 5073
516 Ga0495675_0028592 3300047444 Bacteria 3554
517 Ga0495675_0028790 3300047444 Bacteria 3540
518 Ga0495675_0057553 3300047444 Bacteria 2465
519 Ga0495675_0107788 3300047444 Bacteria 1740
520 Ga0495675_0203795 3300047444 Unclassified 1203
521 Ga0495677_0003312 3300047445 Bacteria 6270
522 Ga0495673_0064222 3300047469 Bacteria 1563
523 Ga0495684_0000552 3300047471 Bacteria 30354
524 Ga0495684_0006046 3300047471 Bacteria 9412
525 Ga0495684_0062549 3300047471 Bacteria 2831
526 Ga0495684_0112700 3300047471 Bacteria 2051
527 Ga0495684_0282723 3300047471 Unclassified 1196
528 Ga0495684_0392509 3300047471 Unclassified 976
529 Ga0495686_0000006 3300047472 Bacteria 770778
530 Ga0495686_0002195 3300047472 Bacteria 18979
531 Ga0495686_0061295 3300047472 Bacteria 2337
532 Ga0495593_0007636 3300047673 Bacteria 6316
533 Ga0495593_0105283 3300047673 Bacteria 1444
534 Ga0495593_0199224 3300047673 Bacteria 1006
535 Ga0495602_0001118 3300048088 Bacteria 26277
536 Ga0495602_0017357 3300048088 Bacteria 7216
537 Ga0495602_0034796 3300048088 Bacteria 4705
538 Ga0495602_0051562 3300048088 Bacteria 3663
539 Ga0495602_0186272 3300048088 Bacteria 1596
540 Ga0495602_0341911 3300048088 Bacteria 1082
541 Ga0495602_0478334 3300048088 Bacteria 874
542 Ga0495614_0003927 3300048089 Bacteria 6677
543 Ga0496104_0000072 3300048907 Bacteria 106074
544 Ga0496104_0116459 3300048907 Bacteria 2565
545 Ga0496105_0146883 3300048908 Bacteria 1939
546 Ga0496106_0059518 3300048909 Bacteria 2894
547 Ga0496112_0060439 3300048915 Bacteria 3735
548 Ga0496113_0298407 3300048916 Bacteria 1290
549 Ga0496114_0514061 3300048917 Bacteria 1059
550 Ga0496115_0087509 3300048918 Bacteria 2542
551 Ga0496115_0115142 3300048918 Bacteria 2211
552 Ga0496115_0185310 3300048918 Bacteria 1720
553 Ga0496119_0201759 3300048922 Bacteria 1029
554 Ga0496125_0110278 3300048928 Bacteria 1996
555 Ga0496126_0000024 3300048929 Bacteria 462877
556 Ga0496126_0000085 3300048929 Bacteria 216528
557 Ga0496126_0000820 3300048929 Bacteria 55350
558 Ga0496126_0006879 3300048929 Bacteria 12601
559 Ga0496126_0011765 3300048929 Bacteria 9011
560 Ga0496126_0047495 3300048929 Bacteria 3930
561 Ga0501031_0182605 3300049568 Bacteria 1370
562 Ga0501032_0011478 3300049569 Bacteria 6364
563 Ga0501032_0096213 3300049569 Bacteria 1963
564 Ga0501033_0000876 3300049570 Bacteria 27523
565 Ga0501034_0049026 3300049571 Bacteria 4262
566 Ga0501036_0011178 3300049572 Bacteria 7428
567 Ga0501037_0050673 3300049573 Bacteria 3038
568 Ga0501037_0164211 3300049573 Bacteria 1582
569 Ga0501038_0003247 3300049574 Bacteria 15159
570 Ga0501039_0099582 3300049575 Bacteria 2268
571 Ga0501043_0010410 3300049579 Bacteria 7287
572 Ga0501046_0000265 3300049580 Bacteria 53355
573 Ga0501047_0003679 3300049581 Bacteria 14454
574 Ga0501070_0162859 3300049586 Bacteria 1839
575 Ga0501070_0231448 3300049586 Bacteria 1514
576 Ga0501073_0122790 3300049589 Bacteria 1800
577 Ga0501035_0002898 3300049822 Bacteria 16521
578 Ga0501044_0006355 3300049823 Bacteria 13062
579 nmdc:mga06z11_57538_c1 3300050494 Unclassified 2014
580 nmdc:mga0rr50_377528_c1 3300050513 Bacteria 1195
581 Ga0500595_003197 3300053119 Bacteria 7749
582 Ga0500661_000537 3300055283 Bacteria 7054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_377528_c1 nmdc:mga0rr50_377528_c1_410_1135 217
2 3300028800 Ga0265338_10135718 Ga0265338_101357181 218
3 3300031241 Ga0265325_10017784 Ga0265325_100177842 218
4 3300035118 Ga0373954_0017282 Ga0373954_0017282_2278_3066 219
5 3300035692 Ga0373935_0005554 Ga0373935_0005554_4974_5762 219
6 3300046462 Ga0495651_0067144 Ga0495651_0067144_1617_2405 219
7 3300046463 Ga0495653_0003041 Ga0495653_0003041_10981_11769 219
8 3300046472 Ga0495580_0013009 Ga0495580_0013009_3145_3933 219
9 3300046477 Ga0495664_0115211 Ga0495664_0115211_812_1600 219
10 3300046511 Ga0495608_0008044 Ga0495608_0008044_1757_2545 219
11 3300046517 Ga0495630_0015333 Ga0495630_0015333_1027_1815 219
12 3300046543 Ga0495645_0142853 Ga0495645_0142853_141_929 219
13 3300046675 Ga0495657_0003833 Ga0495657_0003833_9613_10401 219
14 3300046679 Ga0495623_0002699 Ga0495623_0002699_9452_10240 219
15 3300046680 Ga0495646_0007090 Ga0495646_0007090_1455_2243 219
16 3300046690 Ga0495624_0002954 Ga0495624_0002954_1391_2179 219
17 3300047317 Ga0495604_0336096 Ga0495604_0336096_14_802 219
18 3300047319 Ga0495674_0344075 Ga0495674_0344075_19_807 219
19 3300047444 Ga0495675_0007813 Ga0495675_0007813_1783_2571 219
20 3300047471 Ga0495684_0112700 Ga0495684_0112700_102_890 219
21 3300047673 Ga0495593_0007636 Ga0495593_0007636_4828_5616 219
22 3300048088 Ga0495602_0017357 Ga0495602_0017357_1532_2320 219
23 3300013104 Ga0157370_10062741 Ga0157370_100627413 221
24 3300013105 Ga0157369_10040778 Ga0157369_100407784 221
25 3300046690 Ga0495624_0469465 Ga0495624_0469465_17_739 224
26 3300048088 Ga0495602_0478334 Ga0495602_0478334_82_852 227
27 3300005455 Ga0070663_100138714 Ga0070663_1001387143 228
28 3300005563 Ga0068855_100004621 Ga0068855_1000046218 228
29 3300005578 Ga0068854_100218669 Ga0068854_1002186692 228
30 3300025949 Ga0207667_10020653 Ga0207667_100206534 228
31 3300026067 Ga0207678_10116755 Ga0207678_101167552 228
32 3300028379 Ga0268266_10127042 Ga0268266_101270422 229
33 3300046517 Ga0495630_0001862 Ga0495630_0001862_13190_14017 233
34 3300048088 Ga0495602_0341911 Ga0495602_0341911_126_953 233
35 3300035083 Ga0373926_0003545 Ga0373926_0003545_56_886 234
36 3300035111 Ga0373923_0001384 Ga0373923_0001384_446_1276 234
37 3300035692 Ga0373935_0016504 Ga0373935_0016504_1856_2686 234
38 3300035724 Ga0373933_0012619 Ga0373933_0012619_3757_4587 234
39 3300036401 Ga0373937_0033202 Ga0373937_0033202_1451_2281 234
40 3300046454 Ga0495592_0021852 Ga0495592_0021852_1127_1957 234
41 3300046462 Ga0495651_0000024 Ga0495651_0000024_24227_25057 234
42 3300046462 Ga0495651_0011609 Ga0495651_0011609_4367_5197 234
43 3300046463 Ga0495653_0031977 Ga0495653_0031977_2349_3179 234
44 3300046472 Ga0495580_0084610 Ga0495580_0084610_241_1071 234
45 3300046511 Ga0495608_0006362 Ga0495608_0006362_7405_8235 234
46 3300046511 Ga0495608_0117430 Ga0495608_0117430_612_1442 234
47 3300046526 Ga0495666_0125849 Ga0495666_0125849_13_843 234
48 3300046529 Ga0495652_0039436 Ga0495652_0039436_2043_2873 234
49 3300046531 Ga0495665_0006874 Ga0495665_0006874_773_1603 234
50 3300046559 Ga0495667_0001411 Ga0495667_0001411_998_1828 234
51 3300046642 Ga0495634_0294234 Ga0495634_0294234_92_922 234
52 3300046679 Ga0495623_0002696 Ga0495623_0002696_5161_5991 234
53 3300046690 Ga0495624_0032057 Ga0495624_0032057_1198_2028 234
54 3300047319 Ga0495674_0046674 Ga0495674_0046674_874_1704 234
55 3300047322 Ga0495680_0000749 Ga0495680_0000749_22461_23291 234
56 3300047444 Ga0495675_0013990 Ga0495675_0013990_1954_2784 234
57 3300047444 Ga0495675_0028790 Ga0495675_0028790_2348_3178 234
58 3300047673 Ga0495593_0199224 Ga0495593_0199224_26_856 234
59 3300048088 Ga0495602_0034796 Ga0495602_0034796_1845_2675 234
60 3300009093 Ga0105240_10000531 Ga0105240_1000053128 235
61 3300025913 Ga0207695_10002371 Ga0207695_100023716 235
62 3300031090 Ga0265760_10055553 Ga0265760_100555531 235
63 3300046557 Ga0495622_0198778 Ga0495622_0198778_97_849 235
64 3300009093 Ga0105240_10000987 Ga0105240_1000098740 236
65 3300009545 Ga0105237_10013779 Ga0105237_100137796 236
66 3300009551 Ga0105238_10063959 Ga0105238_100639592 236
67 3300013296 Ga0157374_10457828 Ga0157374_104578282 236
68 3300013307 Ga0157372_10257007 Ga0157372_102570072 236
69 3300026078 Ga0207702_10463833 Ga0207702_104638332 236
70 3300030763 Ga0265763_1001273 Ga0265763_10012731 236
71 3300046517 Ga0495630_0012406 Ga0495630_0012406_5005_5790 236
72 3300025921 Ga0207652_10265459 Ga0207652_102654592 237
73 3300009545 Ga0105237_10292554 Ga0105237_102925541 240
74 3300048918 Ga0496115_0115142 Ga0496115_0115142_1216_2022 240
75 3300050494 nmdc:mga06z11_57538_c1 nmdc:mga06z11_57538_c1_65_898 240
76 3300028800 Ga0265338_10031750 Ga0265338_100317503 241
77 3300028800 Ga0265338_10194327 Ga0265338_101943271 241
78 3300031242 Ga0265329_10091027 Ga0265329_100910271 241
79 3300031247 Ga0265340_10012280 Ga0265340_100122802 241
80 3300031250 Ga0265331_10041235 Ga0265331_100412352 241
81 3300031344 Ga0265316_10120089 Ga0265316_101200892 241
82 3300031712 Ga0265342_10075456 Ga0265342_100754561 241
83 3300013105 Ga0157369_10042191 Ga0157369_100421913 242
84 3300005518 Ga0070699_100033445 Ga0070699_1000334452 243
85 3300005518 Ga0070699_100186543 Ga0070699_1001865432 243
86 3300005536 Ga0070697_100065430 Ga0070697_1000654302 243
87 3300005545 Ga0070695_100409310 Ga0070695_1004093101 243
88 3300005548 Ga0070665_100140419 Ga0070665_1001404192 243
89 3300005563 Ga0068855_100000283 Ga0068855_10000028326 243
90 3300005614 Ga0068856_100473622 Ga0068856_1004736222 243
91 3300006914 Ga0075436_100098945 Ga0075436_1000989452 243
92 3300007076 Ga0075435_100338116 Ga0075435_1003381161 243
93 3300009093 Ga0105240_10033202 Ga0105240_100332024 243
94 3300025906 Ga0207699_10205566 Ga0207699_102055662 243
95 3300025913 Ga0207695_10015076 Ga0207695_100150762 243
96 3300025913 Ga0207695_10077491 Ga0207695_100774912 243
97 3300025914 Ga0207671_10042817 Ga0207671_100428172 243
98 3300025922 Ga0207646_10433787 Ga0207646_104337872 243
99 3300025949 Ga0207667_10000696 Ga0207667_1000069614 243
100 3300049568 Ga0501031_0182605 Ga0501031_0182605_58_864 243
101 3300049569 Ga0501032_0011478 Ga0501032_0011478_1355_2161 243
102 3300049570 Ga0501033_0000876 Ga0501033_0000876_22863_23669 243
103 3300049571 Ga0501034_0049026 Ga0501034_0049026_2866_3672 243
104 3300049572 Ga0501036_0011178 Ga0501036_0011178_4133_4939 243
105 3300049573 Ga0501037_0050673 Ga0501037_0050673_430_1236 243
106 3300049574 Ga0501038_0003247 Ga0501038_0003247_11175_11981 243
107 3300049575 Ga0501039_0099582 Ga0501039_0099582_865_1671 243
108 3300049579 Ga0501043_0010410 Ga0501043_0010410_6268_7074 243
109 3300049580 Ga0501046_0000265 Ga0501046_0000265_29978_30784 243
110 3300049581 Ga0501047_0003679 Ga0501047_0003679_3128_3934 243
111 3300049586 Ga0501070_0162859 Ga0501070_0162859_127_933 243
112 3300049589 Ga0501073_0122790 Ga0501073_0122790_75_881 243
113 3300049822 Ga0501035_0002898 Ga0501035_0002898_2710_3516 243
114 3300049823 Ga0501044_0006355 Ga0501044_0006355_8984_9790 243
115 3300005530 Ga0070679_100000708 Ga0070679_10000070811 244
116 3300005563 Ga0068855_100001444 Ga0068855_10000144411 244
117 3300005563 Ga0068855_100190655 Ga0068855_1001906552 244
118 3300005578 Ga0068854_100138693 Ga0068854_1001386932 244
119 3300006178 Ga0075367_10021715 Ga0075367_100217152 244
120 3300009093 Ga0105240_10002185 Ga0105240_1000218515 244
121 3300009093 Ga0105240_10006817 Ga0105240_100068178 244
122 3300009101 Ga0105247_10044484 Ga0105247_100444842 244
123 3300009551 Ga0105238_10002780 Ga0105238_100027809 244
124 3300013104 Ga0157370_10006045 Ga0157370_1000604511 244
125 3300013105 Ga0157369_10048445 Ga0157369_100484452 244
126 3300025912 Ga0207707_10000107 Ga0207707_100001074 244
127 3300025913 Ga0207695_10004580 Ga0207695_100045809 244
128 3300025917 Ga0207660_10021314 Ga0207660_100213142 244
129 3300025921 Ga0207652_10003528 Ga0207652_1000352812 244
130 3300025924 Ga0207694_10010308 Ga0207694_100103081 244
131 3300025949 Ga0207667_10015029 Ga0207667_100150291 244
132 3300025981 Ga0207640_10074667 Ga0207640_100746672 244
133 3300026078 Ga0207702_10558798 Ga0207702_105587982 244
134 3300044656 Ga0466969_0008525 Ga0466969_0008525_3946_4758 244
135 3300045049 Ga0466959_0097773 Ga0466959_0097773_1157_1966 244
136 3300047471 Ga0495684_0392509 Ga0495684_0392509_35_814 244
137 3300028800 Ga0265338_10233144 Ga0265338_102331441 245
138 3300005336 Ga0070680_100028659 Ga0070680_1000286592 247
139 3300005530 Ga0070679_100051271 Ga0070679_1000512712 247
140 3300005535 Ga0070684_100021531 Ga0070684_1000215312 247
141 3300009545 Ga0105237_10188031 Ga0105237_101880311 247
142 3300013104 Ga0157370_10165208 Ga0157370_101652082 247
143 3300014325 Ga0163163_10092508 Ga0163163_100925082 247
144 3300025912 Ga0207707_10073505 Ga0207707_100735052 247
145 3300025914 Ga0207671_10182706 Ga0207671_101827061 247
146 3300025917 Ga0207660_10080182 Ga0207660_100801822 247
147 3300025944 Ga0207661_10440129 Ga0207661_104401292 247
148 3300026142 Ga0207698_10191033 Ga0207698_101910331 247
149 3300028379 Ga0268266_10001873 Ga0268266_1000187311 247
150 3300028563 Ga0265319_1000898 Ga0265319_10008984 247
151 3300028577 Ga0265318_10000151 Ga0265318_1000015139 247
152 3300031238 Ga0265332_10002631 Ga0265332_100026311 247
153 3300031240 Ga0265320_10000105 Ga0265320_1000010515 247
154 3300031241 Ga0265325_10153539 Ga0265325_101535391 247
155 3300031242 Ga0265329_10000054 Ga0265329_1000005429 247
156 3300031247 Ga0265340_10005124 Ga0265340_100051244 247
157 3300031249 Ga0265339_10000583 Ga0265339_1000058315 247
158 3300031250 Ga0265331_10000189 Ga0265331_1000018952 247
159 3300031344 Ga0265316_10001191 Ga0265316_1000119115 247
160 3300031595 Ga0265313_10000621 Ga0265313_1000062118 247
161 3300031711 Ga0265314_10008975 Ga0265314_100089752 247
162 3300031712 Ga0265342_10000382 Ga0265342_1000038229 247
163 3300046462 Ga0495651_0292784 Ga0495651_0292784_194_1051 247
164 3300048928 Ga0496125_0110278 Ga0496125_0110278_143_976 247
165 3300048929 Ga0496126_0000024 Ga0496126_0000024_47838_48641 247
166 3300048929 Ga0496126_0011765 Ga0496126_0011765_515_1348 247
167 3300049569 Ga0501032_0096213 Ga0501032_0096213_616_1425 247
168 3300049573 Ga0501037_0164211 Ga0501037_0164211_200_1009 247
169 3300049586 Ga0501070_0231448 Ga0501070_0231448_369_1178 247
170 3300005336 Ga0070680_100190288 Ga0070680_1001902882 248
171 3300005439 Ga0070711_100123069 Ga0070711_1001230692 248
172 3300005458 Ga0070681_10053834 Ga0070681_100538343 248
173 3300005530 Ga0070679_100033285 Ga0070679_1000332852 248
174 3300005563 Ga0068855_100251772 Ga0068855_1002517722 248
175 3300007265 Ga0099794_10077857 Ga0099794_100778572 248
176 3300025906 Ga0207699_10290101 Ga0207699_102901011 248
177 3300025912 Ga0207707_10028648 Ga0207707_100286484 248
178 3300025917 Ga0207660_10243747 Ga0207660_102437472 248
179 3300025921 Ga0207652_10122191 Ga0207652_101221912 248
180 3300035118 Ga0373954_0107663 Ga0373954_0107663_351_1187 248
181 3300047471 Ga0495684_0000552 Ga0495684_0000552_3871_4707 248
182 iso_pu_bacteria 2884215851 2884216310 248
183 3300005518 Ga0070699_100337555 Ga0070699_1003375551 249
184 3300005563 Ga0068855_100289880 Ga0068855_1002898802 249
185 3300005614 Ga0068856_100293081 Ga0068856_1002930812 249
186 3300007788 Ga0099795_10075583 Ga0099795_100755832 249
187 3300009545 Ga0105237_10060012 Ga0105237_100600122 249
188 3300009553 Ga0105249_10042373 Ga0105249_100423732 249
189 3300014968 Ga0157379_10153132 Ga0157379_101531322 249
190 3300025913 Ga0207695_10126381 Ga0207695_101263811 249
191 3300025949 Ga0207667_10252783 Ga0207667_102527832 249
192 3300026078 Ga0207702_10502876 Ga0207702_105028761 249
193 3300046462 Ga0495651_0008221 Ga0495651_0008221_502_1311 249
194 3300046463 Ga0495653_0116656 Ga0495653_0116656_492_1301 249
195 3300046476 Ga0495662_0044531 Ga0495662_0044531_1167_1976 249
196 3300046477 Ga0495664_0004479 Ga0495664_0004479_2556_3365 249
197 3300046529 Ga0495652_0134147 Ga0495652_0134147_861_1670 249
198 3300046536 Ga0495587_0093032 Ga0495587_0093032_501_1310 249
199 3300046642 Ga0495634_0106849 Ga0495634_0106849_653_1462 249
200 3300046689 Ga0495613_0054867 Ga0495613_0054867_286_1095 249
201 3300047319 Ga0495674_0231041 Ga0495674_0231041_367_1176 249
202 3300047444 Ga0495675_0028592 Ga0495675_0028592_1050_1859 249
203 3300005327 Ga0070658_10006025 Ga0070658_100060252 250
204 3300005327 Ga0070658_10146270 Ga0070658_101462702 250
205 3300005327 Ga0070658_10319824 Ga0070658_103198242 250
206 3300005338 Ga0068868_100309265 Ga0068868_1003092651 250
207 3300005435 Ga0070714_100069565 Ga0070714_1000695652 250
208 3300005436 Ga0070713_100170804 Ga0070713_1001708041 250
209 3300005539 Ga0068853_100138596 Ga0068853_1001385961 250
210 3300005563 Ga0068855_100389553 Ga0068855_1003895531 250
211 3300005578 Ga0068854_100247589 Ga0068854_1002475891 250
212 3300005616 Ga0068852_100035373 Ga0068852_1000353735 250
213 3300006237 Ga0097621_100648306 Ga0097621_1006483061 250
214 3300009093 Ga0105240_10374304 Ga0105240_103743041 250
215 3300009098 Ga0105245_10103660 Ga0105245_101036603 250
216 3300009101 Ga0105247_10181129 Ga0105247_101811292 250
217 3300009551 Ga0105238_10336378 Ga0105238_103363782 250
218 3300010159 Ga0099796_10043980 Ga0099796_100439802 250
219 3300013104 Ga0157370_10242772 Ga0157370_102427722 250
220 3300013105 Ga0157369_10132915 Ga0157369_101329152 250
221 3300013105 Ga0157369_10271285 Ga0157369_102712851 250
222 3300013296 Ga0157374_10003041 Ga0157374_100030414 250
223 3300013297 Ga0157378_10003951 Ga0157378_100039512 250
224 3300013307 Ga0157372_10014094 Ga0157372_100140945 250
225 3300013307 Ga0157372_10542872 Ga0157372_105428721 250
226 3300013308 Ga0157375_10769994 Ga0157375_107699941 250
227 3300014745 Ga0157377_10073139 Ga0157377_100731392 250
228 3300025909 Ga0207705_10011320 Ga0207705_100113201 250
229 3300025909 Ga0207705_10046956 Ga0207705_100469562 250
230 3300025909 Ga0207705_10244428 Ga0207705_102444281 250
231 3300025924 Ga0207694_10046792 Ga0207694_100467922 250
232 3300025924 Ga0207694_10257166 Ga0207694_102571661 250
233 3300025927 Ga0207687_10169819 Ga0207687_101698192 250
234 3300025949 Ga0207667_10148939 Ga0207667_101489393 250
235 3300025949 Ga0207667_10285593 Ga0207667_102855932 250
236 3300025981 Ga0207640_10500324 Ga0207640_105003241 250
237 3300026023 Ga0207677_10252133 Ga0207677_102521331 250
238 3300026041 Ga0207639_10076941 Ga0207639_100769412 250
239 3300035170 Ga0373943_0260129 Ga0373943_0260129_164_964 250
240 3300039447 Ga0436361_1210201 Ga0436361_1210201_127_927 250
241 3300045976 Ga0466967_0296048 Ga0466967_0296048_583_1422 250
242 3300046454 Ga0495592_0298613 Ga0495592_0298613_106_936 250
243 3300046477 Ga0495664_0194508 Ga0495664_0194508_308_1132 250
244 3300046499 Ga0495594_0147745 Ga0495594_0147745_312_1142 250
245 3300046511 Ga0495608_0210991 Ga0495608_0210991_401_1210 250
246 3300046514 Ga0495618_0005841 Ga0495618_0005841_92_916 250
247 3300046516 Ga0495628_0001985 Ga0495628_0001985_93_917 250
248 3300046529 Ga0495652_0006933 Ga0495652_0006933_1286_2110 250
249 3300046533 Ga0495640_0038545 Ga0495640_0038545_1841_2650 250
250 3300046533 Ga0495640_0057752 Ga0495640_0057752_97_921 250
251 3300046536 Ga0495587_0000750 Ga0495587_0000750_15897_16721 250
252 3300046559 Ga0495667_0021672 Ga0495667_0021672_3398_4222 250
253 3300046559 Ga0495667_0069306 Ga0495667_0069306_70_900 250
254 3300046663 Ga0495635_0030836 Ga0495635_0030836_543_1367 250
255 3300046675 Ga0495657_0019873 Ga0495657_0019873_942_1766 250
256 3300046675 Ga0495657_0225553 Ga0495657_0225553_174_1004 250
257 3300046689 Ga0495613_0051731 Ga0495613_0051731_877_1707 250
258 3300046809 Ga0495600_0003466 Ga0495600_0003466_50_874 250
259 3300047319 Ga0495674_0265424 Ga0495674_0265424_41_865 250
260 3300047322 Ga0495680_0020341 Ga0495680_0020341_4712_5536 250
261 3300047444 Ga0495675_0000052 Ga0495675_0000052_64_888 250
262 3300047444 Ga0495675_0107788 Ga0495675_0107788_828_1637 250
263 3300047471 Ga0495684_0062549 Ga0495684_0062549_558_1367 250
264 3300047471 Ga0495684_0282723 Ga0495684_0282723_110_934 250
265 3300048088 Ga0495602_0051562 Ga0495602_0051562_2797_3621 250
266 3300048915 Ga0496112_0060439 Ga0496112_0060439_706_1536 250
267 3300005329 Ga0070683_100000035 Ga0070683_10000003555 251
268 3300005535 Ga0070684_100000037 Ga0070684_10000003731 251
269 3300009176 Ga0105242_10073011 Ga0105242_100730112 251
270 3300013297 Ga0157378_10334260 Ga0157378_103342602 251
271 3300025929 Ga0207664_10470888 Ga0207664_104708882 251
272 3300025944 Ga0207661_10000008 Ga0207661_10000008335 251
273 3300046472 Ga0495580_0266332 Ga0495580_0266332_347_1156 251
274 3300046477 Ga0495664_0105303 Ga0495664_0105303_545_1351 251
275 3300046516 Ga0495628_0117622 Ga0495628_0117622_610_1416 251
276 3300047317 Ga0495604_0069122 Ga0495604_0069122_1683_2486 251
277 3300047319 Ga0495674_0002093 Ga0495674_0002093_11485_12291 251
278 3300047319 Ga0495674_0053638 Ga0495674_0053638_475_1278 251
279 3300047319 Ga0495674_0393806 Ga0495674_0393806_31_837 251
280 3300047322 Ga0495680_0138896 Ga0495680_0138896_29_835 251
281 3300047444 Ga0495675_0057553 Ga0495675_0057553_32_835 251
282 3300047444 Ga0495675_0203795 Ga0495675_0203795_122_928 251
283 3300005347 Ga0070668_100094850 Ga0070668_1000948501 252
284 3300009093 Ga0105240_10164819 Ga0105240_101648192 252
285 3300009545 Ga0105237_10262288 Ga0105237_102622882 252
286 3300025261 Ga0209233_1001450 Ga0209233_10014503 252
287 3300025904 Ga0207647_10198850 Ga0207647_101988501 252
288 3300025914 Ga0207671_10287337 Ga0207671_102873372 252
289 3300033180 Ga0307510_10216305 Ga0307510_102163052 252
290 3300046528 Ga0495642_0129090 Ga0495642_0129090_137_940 252
291 3300005471 Ga0070698_100001024 Ga0070698_10000102411 253
292 3300006028 Ga0070717_10047098 Ga0070717_100470982 253
293 3300025915 Ga0207693_10034229 Ga0207693_100342293 253
294 3300035119 Ga0373956_0045458 Ga0373956_0045458_567_1409 253
295 3300035724 Ga0373933_0000621 Ga0373933_0000621_5244_6086 253
296 3300036401 Ga0373937_0001927 Ga0373937_0001927_2879_3721 253
297 3300046462 Ga0495651_0001109 Ga0495651_0001109_6055_6897 253
298 3300046463 Ga0495653_0070134 Ga0495653_0070134_1385_2227 253
299 3300046536 Ga0495587_0008576 Ga0495587_0008576_3686_4528 253
300 3300046679 Ga0495623_0007196 Ga0495623_0007196_95_937 253
301 3300048088 Ga0495602_0001118 Ga0495602_0001118_16017_16859 253
302 3300048929 Ga0496126_0006879 Ga0496126_0006879_7777_8595 253
303 3300003659 JGI25404J52841_10027318 JGI25404J52841_100273181 254
304 3300004799 Ga0058863_11907544 Ga0058863_119075441 254
305 3300004800 Ga0058861_11969837 Ga0058861_119698372 254
306 3300004800 Ga0058861_12014651 Ga0058861_120146511 254
307 3300004803 Ga0058862_12827812 Ga0058862_128278121 254
308 3300004803 Ga0058862_12854581 Ga0058862_128545812 254
309 3300005327 Ga0070658_10261902 Ga0070658_102619021 254
310 3300005328 Ga0070676_10018046 Ga0070676_100180462 254
311 3300005329 Ga0070683_100187501 Ga0070683_1001875012 254
312 3300005331 Ga0070670_100010900 Ga0070670_1000109002 254
313 3300005333 Ga0070677_10077523 Ga0070677_100775232 254
314 3300005334 Ga0068869_100062533 Ga0068869_1000625332 254
315 3300005335 Ga0070666_10025215 Ga0070666_100252152 254
316 3300005335 Ga0070666_10054158 Ga0070666_100541582 254
317 3300005336 Ga0070680_100018222 Ga0070680_1000182223 254
318 3300005338 Ga0068868_100015271 Ga0068868_1000152713 254
319 3300005339 Ga0070660_100019765 Ga0070660_1000197652 254
320 3300005341 Ga0070691_10099751 Ga0070691_100997512 254
321 3300005341 Ga0070691_10206620 Ga0070691_102066202 254
322 3300005344 Ga0070661_100135256 Ga0070661_1001352562 254
323 3300005347 Ga0070668_100035497 Ga0070668_1000354974 254
324 3300005347 Ga0070668_100155452 Ga0070668_1001554522 254
325 3300005354 Ga0070675_100012874 Ga0070675_1000128745 254
326 3300005355 Ga0070671_100007646 Ga0070671_1000076467 254
327 3300005355 Ga0070671_100222123 Ga0070671_1002221232 254
328 3300005364 Ga0070673_100023631 Ga0070673_1000236312 254
329 3300005367 Ga0070667_100030654 Ga0070667_1000306543 254
330 3300005435 Ga0070714_100000992 Ga0070714_10000099210 254
331 3300005435 Ga0070714_100092771 Ga0070714_1000927711 254
332 3300005436 Ga0070713_100002621 Ga0070713_1000026212 254
333 3300005436 Ga0070713_100409098 Ga0070713_1004090982 254
334 3300005436 Ga0070713_100434904 Ga0070713_1004349041 254
335 3300005436 Ga0070713_100500918 Ga0070713_1005009181 254
336 3300005457 Ga0070662_100086679 Ga0070662_1000866792 254
337 3300005458 Ga0070681_10009661 Ga0070681_100096616 254
338 3300005459 Ga0068867_100289812 Ga0068867_1002898121 254
339 3300005530 Ga0070679_100008336 Ga0070679_1000083366 254
340 3300005530 Ga0070679_100039932 Ga0070679_1000399322 254
341 3300005535 Ga0070684_100133334 Ga0070684_1001333342 254
342 3300005536 Ga0070697_100503366 Ga0070697_1005033661 254
343 3300005539 Ga0068853_100114776 Ga0068853_1001147762 254
344 3300005539 Ga0068853_100340545 Ga0068853_1003405451 254
345 3300005539 Ga0068853_100733934 Ga0068853_1007339341 254
346 3300005548 Ga0070665_100049583 Ga0070665_1000495832 254
347 3300005563 Ga0068855_100027490 Ga0068855_1000274905 254
348 3300005563 Ga0068855_100156781 Ga0068855_1001567812 254
349 3300005564 Ga0070664_100220689 Ga0070664_1002206891 254
350 3300005577 Ga0068857_100044294 Ga0068857_1000442942 254
351 3300005578 Ga0068854_100020329 Ga0068854_1000203294 254
352 3300005614 Ga0068856_100057784 Ga0068856_1000577842 254
353 3300005614 Ga0068856_100067983 Ga0068856_1000679833 254
354 3300005614 Ga0068856_100168132 Ga0068856_1001681322 254
355 3300005615 Ga0070702_100102935 Ga0070702_1001029352 254
356 3300005616 Ga0068852_100014996 Ga0068852_1000149963 254
357 3300005616 Ga0068852_100056039 Ga0068852_1000560391 254
358 3300005618 Ga0068864_100089227 Ga0068864_1000892272 254
359 3300005618 Ga0068864_100187672 Ga0068864_1001876722 254
360 3300005841 Ga0068863_100033107 Ga0068863_1000331073 254
361 3300005842 Ga0068858_100052541 Ga0068858_1000525412 254
362 3300005843 Ga0068860_100133307 Ga0068860_1001333072 254
363 3300005983 Ga0081540_1002265 Ga0081540_10022655 254
364 3300006028 Ga0070717_10032582 Ga0070717_100325822 254
365 3300006237 Ga0097621_100047075 Ga0097621_1000470752 254
366 3300006237 Ga0097621_100478606 Ga0097621_1004786062 254
367 3300006358 Ga0068871_100199120 Ga0068871_1001991201 254
368 3300006881 Ga0068865_100023036 Ga0068865_1000230362 254
369 3300009093 Ga0105240_10069942 Ga0105240_100699423 254
370 3300009093 Ga0105240_10154791 Ga0105240_101547912 254
371 3300009093 Ga0105240_10338880 Ga0105240_103388802 254
372 3300009093 Ga0105240_10553479 Ga0105240_105534792 254
373 3300009098 Ga0105245_10020117 Ga0105245_100201173 254
374 3300009148 Ga0105243_10057968 Ga0105243_100579681 254
375 3300009174 Ga0105241_10109652 Ga0105241_101096522 254
376 3300009176 Ga0105242_10226003 Ga0105242_102260032 254
377 3300009177 Ga0105248_10076909 Ga0105248_100769092 254
378 3300009177 Ga0105248_10273541 Ga0105248_102735412 254
379 3300009545 Ga0105237_10041655 Ga0105237_100416552 254
380 3300009545 Ga0105237_10145564 Ga0105237_101455642 254
381 3300009551 Ga0105238_10014800 Ga0105238_100148005 254
382 3300009551 Ga0105238_10046614 Ga0105238_100466143 254
383 3300009551 Ga0105238_10100814 Ga0105238_101008142 254
384 3300009553 Ga0105249_10053953 Ga0105249_100539532 254
385 3300010375 Ga0105239_10168437 Ga0105239_101684372 254
386 3300013102 Ga0157371_10038123 Ga0157371_100381232 254
387 3300013104 Ga0157370_10002599 Ga0157370_100025995 254
388 3300013104 Ga0157370_10026916 Ga0157370_100269164 254
389 3300013105 Ga0157369_10036249 Ga0157369_100362492 254
390 3300013105 Ga0157369_10056657 Ga0157369_100566572 254
391 3300013105 Ga0157369_10234682 Ga0157369_102346822 254
392 3300013296 Ga0157374_10000387 Ga0157374_1000038716 254
393 3300013296 Ga0157374_10097703 Ga0157374_100977032 254
394 3300013296 Ga0157374_10175292 Ga0157374_101752922 254
395 3300013296 Ga0157374_10178934 Ga0157374_101789342 254
396 3300013297 Ga0157378_10006432 Ga0157378_100064323 254
397 3300013306 Ga0163162_10385747 Ga0163162_103857472 254
398 3300013307 Ga0157372_10010004 Ga0157372_100100043 254
399 3300013307 Ga0157372_10013591 Ga0157372_100135915 254
400 3300013307 Ga0157372_10019755 Ga0157372_100197552 254
401 3300013308 Ga0157375_10145975 Ga0157375_101459752 254
402 3300014325 Ga0163163_10001209 Ga0163163_100012094 254
403 3300014968 Ga0157379_10060117 Ga0157379_100601173 254
404 3300014969 Ga0157376_10050457 Ga0157376_100504572 254
405 3300017792 Ga0163161_10207752 Ga0163161_102077521 254
406 3300020069 Ga0197907_10508567 Ga0197907_105085672 254
407 3300020070 Ga0206356_10135058 Ga0206356_101350582 254
408 3300020077 Ga0206351_10143000 Ga0206351_101430001 254
409 3300020078 Ga0206352_10850448 Ga0206352_108504482 254
410 3300020078 Ga0206352_11098780 Ga0206352_110987802 254
411 3300020080 Ga0206350_11177540 Ga0206350_111775401 254
412 3300020081 Ga0206354_10784727 Ga0206354_107847272 254
413 3300020610 Ga0154015_1094687 Ga0154015_10946872 254
414 3300020610 Ga0154015_1686291 Ga0154015_16862911 254
415 3300021361 Ga0213872_10039473 Ga0213872_100394732 254
416 3300025315 Ga0207697_10025858 Ga0207697_100258582 254
417 3300025898 Ga0207692_10030827 Ga0207692_100308272 254
418 3300025899 Ga0207642_10092773 Ga0207642_100927732 254
419 3300025901 Ga0207688_10174670 Ga0207688_101746701 254
420 3300025903 Ga0207680_10074045 Ga0207680_100740452 254
421 3300025903 Ga0207680_10102534 Ga0207680_101025341 254
422 3300025904 Ga0207647_10024187 Ga0207647_100241871 254
423 3300025904 Ga0207647_10044541 Ga0207647_100445412 254
424 3300025907 Ga0207645_10057640 Ga0207645_100576401 254
425 3300025909 Ga0207705_10052394 Ga0207705_100523942 254
426 3300025912 Ga0207707_10169612 Ga0207707_101696122 254
427 3300025913 Ga0207695_10008245 Ga0207695_1000824512 254
428 3300025913 Ga0207695_10188417 Ga0207695_101884172 254
429 3300025913 Ga0207695_10214671 Ga0207695_102146712 254
430 3300025914 Ga0207671_10067484 Ga0207671_100674841 254
431 3300025916 Ga0207663_10129854 Ga0207663_101298542 254
432 3300025917 Ga0207660_10073419 Ga0207660_100734193 254
433 3300025919 Ga0207657_10021392 Ga0207657_100213922 254
434 3300025919 Ga0207657_10023865 Ga0207657_100238653 254
435 3300025920 Ga0207649_10088533 Ga0207649_100885331 254
436 3300025921 Ga0207652_10009932 Ga0207652_100099322 254
437 3300025924 Ga0207694_10054405 Ga0207694_100544052 254
438 3300025924 Ga0207694_10108005 Ga0207694_101080051 254
439 3300025925 Ga0207650_10068238 Ga0207650_100682382 254
440 3300025927 Ga0207687_10069369 Ga0207687_100693691 254
441 3300025928 Ga0207700_10139428 Ga0207700_101394282 254
442 3300025928 Ga0207700_10326911 Ga0207700_103269112 254
443 3300025928 Ga0207700_10344491 Ga0207700_103444912 254
444 3300025928 Ga0207700_10510899 Ga0207700_105108991 254
445 3300025929 Ga0207664_10001747 Ga0207664_100017477 254
446 3300025929 Ga0207664_10411590 Ga0207664_104115901 254
447 3300025931 Ga0207644_10075752 Ga0207644_100757522 254
448 3300025933 Ga0207706_10005440 Ga0207706_100054402 254
449 3300025940 Ga0207691_10024517 Ga0207691_100245174 254
450 3300025941 Ga0207711_10085635 Ga0207711_100856352 254
451 3300025941 Ga0207711_10306596 Ga0207711_103065962 254
452 3300025942 Ga0207689_10028782 Ga0207689_100287822 254
453 3300025944 Ga0207661_10153675 Ga0207661_101536751 254
454 3300025945 Ga0207679_10192157 Ga0207679_101921571 254
455 3300025949 Ga0207667_10017436 Ga0207667_100174365 254
456 3300025949 Ga0207667_10024727 Ga0207667_100247272 254
457 3300025960 Ga0207651_10259685 Ga0207651_102596851 254
458 3300025972 Ga0207668_10094991 Ga0207668_100949912 254
459 3300025972 Ga0207668_10187549 Ga0207668_101875492 254
460 3300025981 Ga0207640_10092806 Ga0207640_100928062 254
461 3300025981 Ga0207640_10261131 Ga0207640_102611312 254
462 3300025986 Ga0207658_10434717 Ga0207658_104347171 254
463 3300026023 Ga0207677_10173171 Ga0207677_101731712 254
464 3300026035 Ga0207703_10263616 Ga0207703_102636162 254
465 3300026041 Ga0207639_10263905 Ga0207639_102639052 254
466 3300026041 Ga0207639_10275900 Ga0207639_102759001 254
467 3300026041 Ga0207639_10887773 Ga0207639_108877731 254
468 3300026067 Ga0207678_10047742 Ga0207678_100477422 254
469 3300026078 Ga0207702_10134998 Ga0207702_101349982 254
470 3300026088 Ga0207641_10005669 Ga0207641_100056693 254
471 3300026088 Ga0207641_10076186 Ga0207641_100761862 254
472 3300026095 Ga0207676_10045029 Ga0207676_100450292 254
473 3300026095 Ga0207676_10248995 Ga0207676_102489952 254
474 3300026116 Ga0207674_10036599 Ga0207674_100365992 254
475 3300026118 Ga0207675_100349539 Ga0207675_1003495392 254
476 3300026121 Ga0207683_10003440 Ga0207683_100034405 254
477 3300026142 Ga0207698_10311426 Ga0207698_103114261 254
478 3300028379 Ga0268266_10070403 Ga0268266_100704032 254
479 3300028577 Ga0265318_10016367 Ga0265318_100163672 254
480 3300028666 Ga0265336_10061547 Ga0265336_100615471 254
481 3300028800 Ga0265338_10007585 Ga0265338_100075858 254
482 3300028800 Ga0265338_10162437 Ga0265338_101624372 254
483 3300031090 Ga0265760_10042896 Ga0265760_100428962 254
484 3300031235 Ga0265330_10011707 Ga0265330_100117072 254
485 3300031241 Ga0265325_10001059 Ga0265325_100010598 254
486 3300031241 Ga0265325_10006713 Ga0265325_100067134 254
487 3300031241 Ga0265325_10178481 Ga0265325_101784811 254
488 3300031249 Ga0265339_10037533 Ga0265339_100375333 254
489 3300031249 Ga0265339_10061609 Ga0265339_100616092 254
490 3300031250 Ga0265331_10086404 Ga0265331_100864042 254
491 3300031344 Ga0265316_10049157 Ga0265316_100491572 254
492 3300031344 Ga0265316_10269498 Ga0265316_102694981 254
493 3300031711 Ga0265314_10000055 Ga0265314_10000055118 254
494 3300031712 Ga0265342_10001832 Ga0265342_1000183210 254
495 3300033180 Ga0307510_10040310 Ga0307510_100403102 254
496 3300035692 Ga0373935_0296511 Ga0373935_0296511_73_879 254
497 3300035692 Ga0373935_0378205 Ga0373935_0378205_110_910 254
498 3300036401 Ga0373937_0001985 Ga0373937_0001985_11772_12572 254
499 3300036401 Ga0373937_0106613 Ga0373937_0106613_1531_2331 254
500 3300037466 Ga0395898_0755351 Ga0395898_0755351_35_832 254
501 3300039447 Ga0436361_0350943 Ga0436361_0350943_3442_4245 254
502 3300039450 Ga0436363_0237435 Ga0436363_0237435_642_1448 254
503 3300046455 Ga0495603_0008247 Ga0495603_0008247_49_855 254
504 3300046459 Ga0495629_0002270 Ga0495629_0002270_10078_10878 254
505 3300046459 Ga0495629_0003365 Ga0495629_0003365_4012_4818 254
506 3300046463 Ga0495653_0218892 Ga0495653_0218892_465_1265 254
507 3300046471 Ga0495650_0020899 Ga0495650_0020899_1583_2386 254
508 3300046472 Ga0495580_0166828 Ga0495580_0166828_44_841 254
509 3300046472 Ga0495580_0409445 Ga0495580_0409445_53_856 254
510 3300046473 Ga0495582_0012856 Ga0495582_0012856_81_887 254
511 3300046473 Ga0495582_0027443 Ga0495582_0027443_2162_2971 254
512 3300046473 Ga0495582_0174348 Ga0495582_0174348_373_1173 254
513 3300046475 Ga0495639_0004247 Ga0495639_0004247_1352_2158 254
514 3300046477 Ga0495664_0001028 Ga0495664_0001028_6637_7443 254
515 3300046477 Ga0495664_0044105 Ga0495664_0044105_761_1564 254
516 3300046499 Ga0495594_0000369 Ga0495594_0000369_4216_5019 254
517 3300046499 Ga0495594_0002282 Ga0495594_0002282_2011_2820 254
518 3300046506 Ga0495583_0022439 Ga0495583_0022439_384_1187 254
519 3300046506 Ga0495583_0028612 Ga0495583_0028612_669_1472 254
520 3300046511 Ga0495608_0158674 Ga0495608_0158674_207_1016 254
521 3300046516 Ga0495628_0003864 Ga0495628_0003864_12017_12823 254
522 3300046518 Ga0495631_0058794 Ga0495631_0058794_622_1425 254
523 3300046523 Ga0495644_0000023 Ga0495644_0000023_73279_74082 254
524 3300046526 Ga0495666_0003659 Ga0495666_0003659_29_835 254
525 3300046529 Ga0495652_0015495 Ga0495652_0015495_697_1503 254
526 3300046529 Ga0495652_0089976 Ga0495652_0089976_1148_1948 254
527 3300046531 Ga0495665_0035376 Ga0495665_0035376_231_1037 254
528 3300046531 Ga0495665_0070153 Ga0495665_0070153_167_967 254
529 3300046535 Ga0495586_0040796 Ga0495586_0040796_692_1498 254
530 3300046536 Ga0495587_0139684 Ga0495587_0139684_519_1319 254
531 3300046543 Ga0495645_0007260 Ga0495645_0007260_4889_5692 254
532 3300046543 Ga0495645_0015846 Ga0495645_0015846_465_1271 254
533 3300046543 Ga0495645_0027121 Ga0495645_0027121_234_1034 254
534 3300046558 Ga0495633_0038163 Ga0495633_0038163_933_1736 254
535 3300046559 Ga0495667_0052135 Ga0495667_0052135_1872_2678 254
536 3300046616 Ga0495668_0291491 Ga0495668_0291491_55_858 254
537 3300046642 Ga0495634_0017226 Ga0495634_0017226_462_1268 254
538 3300046660 Ga0495625_0000796 Ga0495625_0000796_21021_21824 254
539 3300046660 Ga0495625_0053725 Ga0495625_0053725_487_1290 254
540 3300046660 Ga0495625_0083329 Ga0495625_0083329_497_1300 254
541 3300046678 Ga0495599_0036136 Ga0495599_0036136_1794_2600 254
542 3300046679 Ga0495623_0007967 Ga0495623_0007967_502_1308 254
543 3300046679 Ga0495623_0152596 Ga0495623_0152596_415_1218 254
544 3300046680 Ga0495646_0101057 Ga0495646_0101057_802_1602 254
545 3300046684 Ga0495669_0002280 Ga0495669_0002280_5893_6696 254
546 3300046684 Ga0495669_0076008 Ga0495669_0076008_338_1135 254
547 3300046689 Ga0495613_0007057 Ga0495613_0007057_7451_8257 254
548 3300046689 Ga0495613_0021250 Ga0495613_0021250_3926_4735 254
549 3300046689 Ga0495613_0235990 Ga0495613_0235990_254_1051 254
550 3300046690 Ga0495624_0002205 Ga0495624_0002205_8355_9161 254
551 3300046694 Ga0495649_0037809 Ga0495649_0037809_1752_2555 254
552 3300046794 Ga0495589_0186306 Ga0495589_0186306_22_825 254
553 3300047315 Ga0495581_0007694 Ga0495581_0007694_5323_6129 254
554 3300047315 Ga0495581_0041552 Ga0495581_0041552_106_915 254
555 3300047317 Ga0495604_0003709 Ga0495604_0003709_4130_4936 254
556 3300047319 Ga0495674_0055844 Ga0495674_0055844_804_1610 254
557 3300047320 Ga0495672_0001628 Ga0495672_0001628_4680_5474 254
558 3300047321 Ga0495676_0018292 Ga0495676_0018292_1600_2406 254
559 3300047322 Ga0495680_0087536 Ga0495680_0087536_105_911 254
560 3300047444 Ga0495675_0001719 Ga0495675_0001719_7036_7842 254
561 3300047445 Ga0495677_0003312 Ga0495677_0003312_4920_5723 254
562 3300047469 Ga0495673_0064222 Ga0495673_0064222_46_849 254
563 3300047471 Ga0495684_0006046 Ga0495684_0006046_1835_2641 254
564 3300047472 Ga0495686_0000006 Ga0495686_0000006_516118_516921 254
565 3300047472 Ga0495686_0002195 Ga0495686_0002195_17731_18534 254
566 3300047472 Ga0495686_0061295 Ga0495686_0061295_778_1581 254
567 3300047673 Ga0495593_0105283 Ga0495593_0105283_105_914 254
568 3300048088 Ga0495602_0186272 Ga0495602_0186272_247_1047 254
569 3300048089 Ga0495614_0003927 Ga0495614_0003927_5323_6129 254
570 3300048907 Ga0496104_0000072 Ga0496104_0000072_62788_63591 254
571 3300048907 Ga0496104_0116459 Ga0496104_0116459_459_1256 254
572 3300048908 Ga0496105_0146883 Ga0496105_0146883_1102_1902 254
573 3300048909 Ga0496106_0059518 Ga0496106_0059518_1332_2129 254
574 3300048916 Ga0496113_0298407 Ga0496113_0298407_369_1166 254
575 3300048917 Ga0496114_0514061 Ga0496114_0514061_238_1035 254
576 3300048918 Ga0496115_0087509 Ga0496115_0087509_363_1160 254
577 3300048918 Ga0496115_0185310 Ga0496115_0185310_272_1072 254
578 3300048922 Ga0496119_0201759 Ga0496119_0201759_66_869 254
579 3300048929 Ga0496126_0000085 Ga0496126_0000085_105935_106738 254
580 3300048929 Ga0496126_0000820 Ga0496126_0000820_28808_29611 254
581 3300048929 Ga0496126_0047495 Ga0496126_0047495_2190_2993 254
582 3300053119 Ga0500595_003197 Ga0500595_003197_2989_3792 254
583 3300055283 Ga0500661_000537 Ga0500661_000537_1925_2728 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

68

283

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7574 44 252
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7477 44 252
1ohp-assembly2.cif.gz_C crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione 0.7377 195 219
7qd2-assembly1.cif.gz_C structure of the orange carotenoid protein from planktothrix agardhii binding canthaxanthin in the p21 space group 0.7341 195 218
5hgr-assembly1.cif.gz_A structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin 0.7269 195 218
ID Description Score Start End Superfamily
4k1uB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7708 195 216 3.10.450.50
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7295 44 252 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7193 44 252 3.40.50.12140
3ir7A07 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.652 94 142 3.40.228.10
af_Q9UBY9_66_163_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6479 198 216 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A257VSL0-F1-model_v4 DUF4159 domain-containing protein 0.933 89 164
AF-A0A2U3L1S4-F1-model_v4 DUF4159 domain-containing protein 0.9097 64 254
AF-A0A7Y2ZFZ7-F1-model_v4 DUF4159 domain-containing protein 0.9053 59 254
AF-A0A2V8GRD5-F1-model_v4 Transmembrane prediction 0.9041 59 254
AF-A0A2N9N5R4-F1-model_v4 DUF4159 domain-containing protein 0.8957 59 254

Feature Viewer

pLDDT pTM Quality
83.23 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map