F466301
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 260 | 582 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0292784|Ga0495651_0292784_194_1051 |
| Length | 285 |
| Sequence | MGSRFDNLRLNRHIMTLTPRYSAVALLFLGLSTGALAMQRGAGLSQFPIPQSRSPYGYVDTTHEFAWSRLQYTPLGGAFGGFGRGASWSRDYPKADITFLAALRRLTRVDARSYQQVVNLGNDDIFNYPFVYAVQVASWTFTEAEAKRLREYLLKGGFLMVDDFHGTADWDSFLRGMRMALPADEYPISDLADGDEIFHVMYDIGQRFQVPGEQFVATGRTYEKDGYVPKWRAIRDGKGRIIVAICHNMHLGDAWEWADSAEYPEPFAAMAFRVGIDYVMYSMTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 151 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 260 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.91 |
| Metatranscriptomes | 2.92 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 95.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10027318 | 3300003659 | Bacteria | 1227 |
| 2 | Ga0058863_11907544 | 3300004799 | Bacteria | 1014 |
| 3 | Ga0058861_11969837 | 3300004800 | Bacteria | 1269 |
| 4 | Ga0058861_12014651 | 3300004800 | Bacteria | 1178 |
| 5 | Ga0058862_12827812 | 3300004803 | Bacteria | 917 |
| 6 | Ga0058862_12854581 | 3300004803 | Bacteria | 1226 |
| 7 | Ga0070658_10006025 | 3300005327 | Bacteria | 9839 |
| 8 | Ga0070658_10146270 | 3300005327 | Unclassified | 1976 |
| 9 | Ga0070658_10261902 | 3300005327 | Bacteria | 1469 |
| 10 | Ga0070658_10319824 | 3300005327 | Bacteria | 1325 |
| 11 | Ga0070676_10018046 | 3300005328 | Bacteria | 3907 |
| 12 | Ga0070683_100000035 | 3300005329 | Bacteria | 122362 |
| 13 | Ga0070683_100187501 | 3300005329 | Bacteria | 1964 |
| 14 | Ga0070670_100010900 | 3300005331 | Bacteria | 7765 |
| 15 | Ga0070677_10077523 | 3300005333 | Bacteria | 1414 |
| 16 | Ga0068869_100062533 | 3300005334 | Bacteria | 2733 |
| 17 | Ga0070666_10025215 | 3300005335 | Bacteria | 3875 |
| 18 | Ga0070666_10054158 | 3300005335 | Bacteria | 2706 |
| 19 | Ga0070680_100018222 | 3300005336 | Bacteria | 5546 |
| 20 | Ga0070680_100028659 | 3300005336 | Bacteria | 4467 |
| 21 | Ga0070680_100190288 | 3300005336 | Bacteria | 1729 |
| 22 | Ga0068868_100015271 | 3300005338 | Bacteria | 5676 |
| 23 | Ga0068868_100309265 | 3300005338 | Bacteria | 1344 |
| 24 | Ga0070660_100019765 | 3300005339 | Bacteria | 4941 |
| 25 | Ga0070691_10099751 | 3300005341 | Bacteria | 1441 |
| 26 | Ga0070691_10206620 | 3300005341 | Bacteria | 1034 |
| 27 | Ga0070661_100135256 | 3300005344 | Bacteria | 1854 |
| 28 | Ga0070668_100035497 | 3300005347 | Bacteria | 3802 |
| 29 | Ga0070668_100094850 | 3300005347 | Bacteria | 2356 |
| 30 | Ga0070668_100155452 | 3300005347 | Bacteria | 1852 |
| 31 | Ga0070675_100012874 | 3300005354 | Bacteria | 6565 |
| 32 | Ga0070671_100007646 | 3300005355 | Bacteria | 8641 |
| 33 | Ga0070671_100222123 | 3300005355 | Bacteria | 1602 |
| 34 | Ga0070673_100023631 | 3300005364 | Bacteria | 4493 |
| 35 | Ga0070667_100030654 | 3300005367 | Bacteria | 4486 |
| 36 | Ga0070714_100000992 | 3300005435 | Bacteria | 20251 |
| 37 | Ga0070714_100069565 | 3300005435 | Bacteria | 3041 |
| 38 | Ga0070714_100092771 | 3300005435 | Bacteria | 2647 |
| 39 | Ga0070713_100002621 | 3300005436 | Bacteria | 11736 |
| 40 | Ga0070713_100170804 | 3300005436 | Bacteria | 1948 |
| 41 | Ga0070713_100409098 | 3300005436 | Unclassified | 1268 |
| 42 | Ga0070713_100434904 | 3300005436 | Unclassified | 1230 |
| 43 | Ga0070713_100500918 | 3300005436 | Bacteria | 1146 |
| 44 | Ga0070711_100123069 | 3300005439 | Bacteria | 1921 |
| 45 | Ga0070663_100138714 | 3300005455 | Bacteria | 1854 |
| 46 | Ga0070662_100086679 | 3300005457 | Bacteria | 2342 |
| 47 | Ga0070681_10009661 | 3300005458 | Bacteria | 9488 |
| 48 | Ga0070681_10053834 | 3300005458 | Bacteria | 4010 |
| 49 | Ga0068867_100289812 | 3300005459 | Bacteria | 1345 |
| 50 | Ga0070698_100001024 | 3300005471 | Bacteria | 30722 |
| 51 | Ga0070699_100033445 | 3300005518 | Bacteria | 4442 |
| 52 | Ga0070699_100186543 | 3300005518 | Unclassified | 1842 |
| 53 | Ga0070699_100337555 | 3300005518 | Bacteria | 1356 |
| 54 | Ga0070679_100000708 | 3300005530 | Bacteria | 28643 |
| 55 | Ga0070679_100008336 | 3300005530 | Bacteria | 9749 |
| 56 | Ga0070679_100033285 | 3300005530 | Bacteria | 5104 |
| 57 | Ga0070679_100039932 | 3300005530 | Bacteria | 4665 |
| 58 | Ga0070679_100051271 | 3300005530 | Bacteria | 4110 |
| 59 | Ga0070684_100000037 | 3300005535 | Bacteria | 95058 |
| 60 | Ga0070684_100021531 | 3300005535 | Bacteria | 5367 |
| 61 | Ga0070684_100133334 | 3300005535 | Bacteria | 2242 |
| 62 | Ga0070697_100065430 | 3300005536 | Bacteria | 2971 |
| 63 | Ga0070697_100503366 | 3300005536 | Unclassified | 1059 |
| 64 | Ga0068853_100114776 | 3300005539 | Bacteria | 2396 |
| 65 | Ga0068853_100138596 | 3300005539 | Bacteria | 2183 |
| 66 | Ga0068853_100340545 | 3300005539 | Bacteria | 1393 |
| 67 | Ga0068853_100733934 | 3300005539 | Bacteria | 943 |
| 68 | Ga0070695_100409310 | 3300005545 | Unclassified | 1030 |
| 69 | Ga0070665_100049583 | 3300005548 | Unclassified | 4212 |
| 70 | Ga0070665_100140419 | 3300005548 | Bacteria | 2419 |
| 71 | Ga0068855_100000283 | 3300005563 | Bacteria | 62643 |
| 72 | Ga0068855_100001444 | 3300005563 | Bacteria | 29612 |
| 73 | Ga0068855_100004621 | 3300005563 | Bacteria | 16801 |
| 74 | Ga0068855_100027490 | 3300005563 | Bacteria | 6803 |
| 75 | Ga0068855_100156781 | 3300005563 | Bacteria | 2586 |
| 76 | Ga0068855_100190655 | 3300005563 | Bacteria | 2312 |
| 77 | Ga0068855_100251772 | 3300005563 | Bacteria | 1970 |
| 78 | Ga0068855_100289880 | 3300005563 | Unclassified | 1815 |
| 79 | Ga0068855_100389553 | 3300005563 | Unclassified | 1529 |
| 80 | Ga0070664_100220689 | 3300005564 | Bacteria | 1696 |
| 81 | Ga0068857_100044294 | 3300005577 | Bacteria | 3947 |
| 82 | Ga0068854_100020329 | 3300005578 | Bacteria | 4490 |
| 83 | Ga0068854_100138693 | 3300005578 | Bacteria | 1864 |
| 84 | Ga0068854_100218669 | 3300005578 | Bacteria | 1506 |
| 85 | Ga0068854_100247589 | 3300005578 | Unclassified | 1422 |
| 86 | Ga0068856_100057784 | 3300005614 | Bacteria | 3830 |
| 87 | Ga0068856_100067983 | 3300005614 | Bacteria | 3521 |
| 88 | Ga0068856_100168132 | 3300005614 | Bacteria | 2204 |
| 89 | Ga0068856_100293081 | 3300005614 | Bacteria | 1644 |
| 90 | Ga0068856_100473622 | 3300005614 | Bacteria | 1273 |
| 91 | Ga0070702_100102935 | 3300005615 | Bacteria | 1755 |
| 92 | Ga0068852_100014996 | 3300005616 | Bacteria | 5989 |
| 93 | Ga0068852_100035373 | 3300005616 | Bacteria | 4166 |
| 94 | Ga0068852_100056039 | 3300005616 | Bacteria | 3405 |
| 95 | Ga0068864_100089227 | 3300005618 | Bacteria | 2716 |
| 96 | Ga0068864_100187672 | 3300005618 | Bacteria | 1893 |
| 97 | Ga0068863_100033107 | 3300005841 | Bacteria | 4924 |
| 98 | Ga0068858_100052541 | 3300005842 | Bacteria | 3770 |
| 99 | Ga0068860_100133307 | 3300005843 | Bacteria | 2385 |
| 100 | Ga0081540_1002265 | 3300005983 | Bacteria | 15829 |
| 101 | Ga0070717_10032582 | 3300006028 | Bacteria | 4200 |
| 102 | Ga0070717_10047098 | 3300006028 | Unclassified | 3531 |
| 103 | Ga0075367_10021715 | 3300006178 | Bacteria | 3591 |
| 104 | Ga0097621_100047075 | 3300006237 | Bacteria | 3492 |
| 105 | Ga0097621_100478606 | 3300006237 | Unclassified | 1125 |
| 106 | Ga0097621_100648306 | 3300006237 | Bacteria | 969 |
| 107 | Ga0068871_100199120 | 3300006358 | Bacteria | 1728 |
| 108 | Ga0068865_100023036 | 3300006881 | Bacteria | 4072 |
| 109 | Ga0075436_100098945 | 3300006914 | Bacteria | 2030 |
| 110 | Ga0075435_100338116 | 3300007076 | Bacteria | 1290 |
| 111 | Ga0099794_10077857 | 3300007265 | Bacteria | 1632 |
| 112 | Ga0099795_10075583 | 3300007788 | Bacteria | 1279 |
| 113 | Ga0105240_10000531 | 3300009093 | Bacteria | 70393 |
| 114 | Ga0105240_10000987 | 3300009093 | Bacteria | 50763 |
| 115 | Ga0105240_10002185 | 3300009093 | Bacteria | 31954 |
| 116 | Ga0105240_10006817 | 3300009093 | Bacteria | 16706 |
| 117 | Ga0105240_10033202 | 3300009093 | Bacteria | 6671 |
| 118 | Ga0105240_10069942 | 3300009093 | Bacteria | 4343 |
| 119 | Ga0105240_10154791 | 3300009093 | Unclassified | 2728 |
| 120 | Ga0105240_10164819 | 3300009093 | Bacteria | 2629 |
| 121 | Ga0105240_10338880 | 3300009093 | Bacteria | 1709 |
| 122 | Ga0105240_10374304 | 3300009093 | Bacteria | 1610 |
| 123 | Ga0105240_10553479 | 3300009093 | Bacteria | 1272 |
| 124 | Ga0105245_10020117 | 3300009098 | Bacteria | 5851 |
| 125 | Ga0105245_10103660 | 3300009098 | Bacteria | 2636 |
| 126 | Ga0105247_10044484 | 3300009101 | Bacteria | 2723 |
| 127 | Ga0105247_10181129 | 3300009101 | Bacteria | 1406 |
| 128 | Ga0105243_10057968 | 3300009148 | Bacteria | 3085 |
| 129 | Ga0105241_10109652 | 3300009174 | Bacteria | 2208 |
| 130 | Ga0105242_10073011 | 3300009176 | Bacteria | 2851 |
| 131 | Ga0105242_10226003 | 3300009176 | Unclassified | 1675 |
| 132 | Ga0105248_10076909 | 3300009177 | Bacteria | 3751 |
| 133 | Ga0105248_10273541 | 3300009177 | Bacteria | 1902 |
| 134 | Ga0105237_10013779 | 3300009545 | Bacteria | 8466 |
| 135 | Ga0105237_10041655 | 3300009545 | Bacteria | 4631 |
| 136 | Ga0105237_10060012 | 3300009545 | Bacteria | 3805 |
| 137 | Ga0105237_10145564 | 3300009545 | Bacteria | 2364 |
| 138 | Ga0105237_10188031 | 3300009545 | Unclassified | 2065 |
| 139 | Ga0105237_10262288 | 3300009545 | Bacteria | 1730 |
| 140 | Ga0105237_10292554 | 3300009545 | Bacteria | 1631 |
| 141 | Ga0105238_10002780 | 3300009551 | Bacteria | 17460 |
| 142 | Ga0105238_10014800 | 3300009551 | Bacteria | 7890 |
| 143 | Ga0105238_10046614 | 3300009551 | Bacteria | 4372 |
| 144 | Ga0105238_10063959 | 3300009551 | Bacteria | 3680 |
| 145 | Ga0105238_10100814 | 3300009551 | Bacteria | 2870 |
| 146 | Ga0105238_10336378 | 3300009551 | Unclassified | 1497 |
| 147 | Ga0105249_10042373 | 3300009553 | Bacteria | 4139 |
| 148 | Ga0105249_10053953 | 3300009553 | Bacteria | 3675 |
| 149 | Ga0099796_10043980 | 3300010159 | Unclassified | 1524 |
| 150 | Ga0105239_10168437 | 3300010375 | Bacteria | 2449 |
| 151 | Ga0157371_10038123 | 3300013102 | Bacteria | 3439 |
| 152 | Ga0157370_10002599 | 3300013104 | Bacteria | 21696 |
| 153 | Ga0157370_10006045 | 3300013104 | Bacteria | 13455 |
| 154 | Ga0157370_10026916 | 3300013104 | Bacteria | 5672 |
| 155 | Ga0157370_10062741 | 3300013104 | Bacteria | 3523 |
| 156 | Ga0157370_10165208 | 3300013104 | Unclassified | 2058 |
| 157 | Ga0157370_10242772 | 3300013104 | Unclassified | 1666 |
| 158 | Ga0157369_10036249 | 3300013105 | Bacteria | 5405 |
| 159 | Ga0157369_10040778 | 3300013105 | Bacteria | 5068 |
| 160 | Ga0157369_10042191 | 3300013105 | Bacteria | 4977 |
| 161 | Ga0157369_10048445 | 3300013105 | Bacteria | 4611 |
| 162 | Ga0157369_10056657 | 3300013105 | Bacteria | 4229 |
| 163 | Ga0157369_10132915 | 3300013105 | Bacteria | 2636 |
| 164 | Ga0157369_10234682 | 3300013105 | Bacteria | 1917 |
| 165 | Ga0157369_10271285 | 3300013105 | Unclassified | 1768 |
| 166 | Ga0157374_10000387 | 3300013296 | Bacteria | 40397 |
| 167 | Ga0157374_10003041 | 3300013296 | Bacteria | 14064 |
| 168 | Ga0157374_10097703 | 3300013296 | Bacteria | 2810 |
| 169 | Ga0157374_10175292 | 3300013296 | Bacteria | 2093 |
| 170 | Ga0157374_10178934 | 3300013296 | Bacteria | 2071 |
| 171 | Ga0157374_10457828 | 3300013296 | Bacteria | 1278 |
| 172 | Ga0157378_10003951 | 3300013297 | Bacteria | 13100 |
| 173 | Ga0157378_10006432 | 3300013297 | Bacteria | 10273 |
| 174 | Ga0157378_10334260 | 3300013297 | Bacteria | 1475 |
| 175 | Ga0163162_10385747 | 3300013306 | Bacteria | 1534 |
| 176 | Ga0157372_10010004 | 3300013307 | Bacteria | 10086 |
| 177 | Ga0157372_10013591 | 3300013307 | Bacteria | 8702 |
| 178 | Ga0157372_10014094 | 3300013307 | Bacteria | 8537 |
| 179 | Ga0157372_10019755 | 3300013307 | Bacteria | 7261 |
| 180 | Ga0157372_10257007 | 3300013307 | Bacteria | 2028 |
| 181 | Ga0157372_10542872 | 3300013307 | Bacteria | 1355 |
| 182 | Ga0157375_10145975 | 3300013308 | Bacteria | 2497 |
| 183 | Ga0157375_10769994 | 3300013308 | Unclassified | 1113 |
| 184 | Ga0163163_10001209 | 3300014325 | Bacteria | 21835 |
| 185 | Ga0163163_10092508 | 3300014325 | Bacteria | 3039 |
| 186 | Ga0157377_10073139 | 3300014745 | Bacteria | 1986 |
| 187 | Ga0157379_10060117 | 3300014968 | Bacteria | 3397 |
| 188 | Ga0157379_10153132 | 3300014968 | Bacteria | 2080 |
| 189 | Ga0157376_10050457 | 3300014969 | Bacteria | 3452 |
| 190 | Ga0163161_10207752 | 3300017792 | Bacteria | 1511 |
| 191 | Ga0197907_10508567 | 3300020069 | Bacteria | 1010 |
| 192 | Ga0206356_10135058 | 3300020070 | Bacteria | 1020 |
| 193 | Ga0206351_10143000 | 3300020077 | Bacteria | 2540 |
| 194 | Ga0206352_10850448 | 3300020078 | Bacteria | 1048 |
| 195 | Ga0206352_11098780 | 3300020078 | Bacteria | 954 |
| 196 | Ga0206350_11177540 | 3300020080 | Bacteria | 1250 |
| 197 | Ga0206354_10784727 | 3300020081 | Bacteria | 975 |
| 198 | Ga0154015_1094687 | 3300020610 | Bacteria | 1002 |
| 199 | Ga0154015_1686291 | 3300020610 | Bacteria | 1313 |
| 200 | Ga0213872_10039473 | 3300021361 | Bacteria | 2154 |
| 201 | Ga0209233_1001450 | 3300025261 | Bacteria | 9359 |
| 202 | Ga0207697_10025858 | 3300025315 | Bacteria | 2399 |
| 203 | Ga0207692_10030827 | 3300025898 | Unclassified | 2562 |
| 204 | Ga0207642_10092773 | 3300025899 | Bacteria | 1496 |
| 205 | Ga0207688_10174670 | 3300025901 | Bacteria | 1279 |
| 206 | Ga0207680_10074045 | 3300025903 | Bacteria | 2119 |
| 207 | Ga0207680_10102534 | 3300025903 | Bacteria | 1841 |
| 208 | Ga0207647_10024187 | 3300025904 | Bacteria | 4007 |
| 209 | Ga0207647_10044541 | 3300025904 | Bacteria | 2772 |
| 210 | Ga0207647_10198850 | 3300025904 | Bacteria | 1160 |
| 211 | Ga0207699_10205566 | 3300025906 | Bacteria | 1337 |
| 212 | Ga0207699_10290101 | 3300025906 | Unclassified | 1140 |
| 213 | Ga0207645_10057640 | 3300025907 | Bacteria | 2480 |
| 214 | Ga0207705_10011320 | 3300025909 | Bacteria | 6460 |
| 215 | Ga0207705_10046956 | 3300025909 | Bacteria | 3104 |
| 216 | Ga0207705_10052394 | 3300025909 | Bacteria | 2938 |
| 217 | Ga0207705_10244428 | 3300025909 | Bacteria | 1368 |
| 218 | Ga0207707_10000107 | 3300025912 | Bacteria | 82899 |
| 219 | Ga0207707_10028648 | 3300025912 | Bacteria | 4867 |
| 220 | Ga0207707_10073505 | 3300025912 | Bacteria | 2981 |
| 221 | Ga0207707_10169612 | 3300025912 | Bacteria | 1907 |
| 222 | Ga0207695_10002371 | 3300025913 | Bacteria | 27983 |
| 223 | Ga0207695_10004580 | 3300025913 | Bacteria | 18785 |
| 224 | Ga0207695_10008245 | 3300025913 | Bacteria | 13077 |
| 225 | Ga0207695_10015076 | 3300025913 | Bacteria | 9118 |
| 226 | Ga0207695_10077491 | 3300025913 | Bacteria | 3376 |
| 227 | Ga0207695_10126381 | 3300025913 | Bacteria | 2518 |
| 228 | Ga0207695_10188417 | 3300025913 | Bacteria | 1981 |
| 229 | Ga0207695_10214671 | 3300025913 | Unclassified | 1833 |
| 230 | Ga0207671_10042817 | 3300025914 | Bacteria | 3350 |
| 231 | Ga0207671_10067484 | 3300025914 | Bacteria | 2664 |
| 232 | Ga0207671_10182706 | 3300025914 | Bacteria | 1632 |
| 233 | Ga0207671_10287337 | 3300025914 | Bacteria | 1298 |
| 234 | Ga0207693_10034229 | 3300025915 | Bacteria | 4008 |
| 235 | Ga0207663_10129854 | 3300025916 | Bacteria | 1739 |
| 236 | Ga0207660_10021314 | 3300025917 | Bacteria | 4357 |
| 237 | Ga0207660_10073419 | 3300025917 | Bacteria | 2494 |
| 238 | Ga0207660_10080182 | 3300025917 | Unclassified | 2396 |
| 239 | Ga0207660_10243747 | 3300025917 | Bacteria | 1417 |
| 240 | Ga0207657_10021392 | 3300025919 | Bacteria | 6088 |
| 241 | Ga0207657_10023865 | 3300025919 | Bacteria | 5682 |
| 242 | Ga0207649_10088533 | 3300025920 | Bacteria | 2022 |
| 243 | Ga0207652_10003528 | 3300025921 | Bacteria | 12904 |
| 244 | Ga0207652_10009932 | 3300025921 | Bacteria | 7661 |
| 245 | Ga0207652_10122191 | 3300025921 | Bacteria | 2317 |
| 246 | Ga0207652_10265459 | 3300025921 | Bacteria | 1548 |
| 247 | Ga0207646_10433787 | 3300025922 | Bacteria | 1186 |
| 248 | Ga0207694_10010308 | 3300025924 | Bacteria | 7046 |
| 249 | Ga0207694_10046792 | 3300025924 | Bacteria | 3344 |
| 250 | Ga0207694_10054405 | 3300025924 | Bacteria | 3105 |
| 251 | Ga0207694_10108005 | 3300025924 | Bacteria | 2211 |
| 252 | Ga0207694_10257166 | 3300025924 | Unclassified | 1430 |
| 253 | Ga0207650_10068238 | 3300025925 | Bacteria | 2670 |
| 254 | Ga0207687_10069369 | 3300025927 | Bacteria | 2514 |
| 255 | Ga0207687_10169819 | 3300025927 | Bacteria | 1681 |
| 256 | Ga0207700_10139428 | 3300025928 | Bacteria | 1991 |
| 257 | Ga0207700_10326911 | 3300025928 | Bacteria | 1330 |
| 258 | Ga0207700_10344491 | 3300025928 | Unclassified | 1296 |
| 259 | Ga0207700_10510899 | 3300025928 | Unclassified | 1064 |
| 260 | Ga0207664_10001747 | 3300025929 | Bacteria | 14318 |
| 261 | Ga0207664_10411590 | 3300025929 | Bacteria | 1204 |
| 262 | Ga0207664_10470888 | 3300025929 | Bacteria | 1123 |
| 263 | Ga0207644_10075752 | 3300025931 | Bacteria | 2473 |
| 264 | Ga0207706_10005440 | 3300025933 | Bacteria | 11864 |
| 265 | Ga0207691_10024517 | 3300025940 | Bacteria | 5672 |
| 266 | Ga0207711_10085635 | 3300025941 | Bacteria | 2762 |
| 267 | Ga0207711_10306596 | 3300025941 | Bacteria | 1465 |
| 268 | Ga0207689_10028782 | 3300025942 | Bacteria | 4645 |
| 269 | Ga0207661_10000008 | 3300025944 | Bacteria | 451211 |
| 270 | Ga0207661_10153675 | 3300025944 | Bacteria | 1991 |
| 271 | Ga0207661_10440129 | 3300025944 | Unclassified | 1186 |
| 272 | Ga0207679_10192157 | 3300025945 | Bacteria | 1698 |
| 273 | Ga0207667_10000696 | 3300025949 | Bacteria | 43589 |
| 274 | Ga0207667_10015029 | 3300025949 | Bacteria | 8806 |
| 275 | Ga0207667_10017436 | 3300025949 | Bacteria | 8081 |
| 276 | Ga0207667_10020653 | 3300025949 | Bacteria | 7319 |
| 277 | Ga0207667_10024727 | 3300025949 | Bacteria | 6587 |
| 278 | Ga0207667_10148939 | 3300025949 | Unclassified | 2409 |
| 279 | Ga0207667_10252783 | 3300025949 | Unclassified | 1803 |
| 280 | Ga0207667_10285593 | 3300025949 | Unclassified | 1686 |
| 281 | Ga0207651_10259685 | 3300025960 | Bacteria | 1425 |
| 282 | Ga0207668_10094991 | 3300025972 | Bacteria | 2200 |
| 283 | Ga0207668_10187549 | 3300025972 | Bacteria | 1636 |
| 284 | Ga0207640_10074667 | 3300025981 | Bacteria | 2295 |
| 285 | Ga0207640_10092806 | 3300025981 | Bacteria | 2095 |
| 286 | Ga0207640_10261131 | 3300025981 | Bacteria | 1349 |
| 287 | Ga0207640_10500324 | 3300025981 | Unclassified | 1012 |
| 288 | Ga0207658_10434717 | 3300025986 | Bacteria | 1159 |
| 289 | Ga0207677_10173171 | 3300026023 | Bacteria | 1690 |
| 290 | Ga0207677_10252133 | 3300026023 | Bacteria | 1434 |
| 291 | Ga0207703_10263616 | 3300026035 | Bacteria | 1558 |
| 292 | Ga0207639_10076941 | 3300026041 | Bacteria | 2629 |
| 293 | Ga0207639_10263905 | 3300026041 | Bacteria | 1507 |
| 294 | Ga0207639_10275900 | 3300026041 | Bacteria | 1477 |
| 295 | Ga0207639_10887773 | 3300026041 | Unclassified | 833 |
| 296 | Ga0207678_10047742 | 3300026067 | Bacteria | 3702 |
| 297 | Ga0207678_10116755 | 3300026067 | Bacteria | 2277 |
| 298 | Ga0207702_10134998 | 3300026078 | Bacteria | 2225 |
| 299 | Ga0207702_10463833 | 3300026078 | Bacteria | 1231 |
| 300 | Ga0207702_10502876 | 3300026078 | Bacteria | 1182 |
| 301 | Ga0207702_10558798 | 3300026078 | Bacteria | 1120 |
| 302 | Ga0207641_10005669 | 3300026088 | Bacteria | 10630 |
| 303 | Ga0207641_10076186 | 3300026088 | Bacteria | 2899 |
| 304 | Ga0207676_10045029 | 3300026095 | Bacteria | 3407 |
| 305 | Ga0207676_10248995 | 3300026095 | Bacteria | 1598 |
| 306 | Ga0207674_10036599 | 3300026116 | Bacteria | 5110 |
| 307 | Ga0207675_100349539 | 3300026118 | Bacteria | 1449 |
| 308 | Ga0207683_10003440 | 3300026121 | Bacteria | 13800 |
| 309 | Ga0207698_10191033 | 3300026142 | Unclassified | 1824 |
| 310 | Ga0207698_10311426 | 3300026142 | Bacteria | 1470 |
| 311 | Ga0268266_10001873 | 3300028379 | Bacteria | 23746 |
| 312 | Ga0268266_10070403 | 3300028379 | Bacteria | 3031 |
| 313 | Ga0268266_10127042 | 3300028379 | Bacteria | 2277 |
| 314 | Ga0265319_1000898 | 3300028563 | Bacteria | 18743 |
| 315 | Ga0265318_10000151 | 3300028577 | Bacteria | 62611 |
| 316 | Ga0265318_10016367 | 3300028577 | Unclassified | 3064 |
| 317 | Ga0265336_10061547 | 3300028666 | Bacteria | 1126 |
| 318 | Ga0265338_10007585 | 3300028800 | Bacteria | 13403 |
| 319 | Ga0265338_10031750 | 3300028800 | Bacteria | 5170 |
| 320 | Ga0265338_10135718 | 3300028800 | Bacteria | 1935 |
| 321 | Ga0265338_10162437 | 3300028800 | Bacteria | 1723 |
| 322 | Ga0265338_10194327 | 3300028800 | Bacteria | 1535 |
| 323 | Ga0265338_10233144 | 3300028800 | Bacteria | 1368 |
| 324 | Ga0265763_1001273 | 3300030763 | Bacteria | 1773 |
| 325 | Ga0265760_10042896 | 3300031090 | Bacteria | 1351 |
| 326 | Ga0265760_10055553 | 3300031090 | Bacteria | 1197 |
| 327 | Ga0265330_10011707 | 3300031235 | Unclassified | 4110 |
| 328 | Ga0265332_10002631 | 3300031238 | Bacteria | 9042 |
| 329 | Ga0265320_10000105 | 3300031240 | Bacteria | 72088 |
| 330 | Ga0265325_10001059 | 3300031241 | Bacteria | 19779 |
| 331 | Ga0265325_10006713 | 3300031241 | Bacteria | 6963 |
| 332 | Ga0265325_10017784 | 3300031241 | Bacteria | 3949 |
| 333 | Ga0265325_10153539 | 3300031241 | Bacteria | 1087 |
| 334 | Ga0265325_10178481 | 3300031241 | Bacteria | 990 |
| 335 | Ga0265329_10000054 | 3300031242 | Bacteria | 49499 |
| 336 | Ga0265329_10091027 | 3300031242 | Unclassified | 968 |
| 337 | Ga0265340_10005124 | 3300031247 | Bacteria | 7285 |
| 338 | Ga0265340_10012280 | 3300031247 | Unclassified | 4526 |
| 339 | Ga0265339_10000583 | 3300031249 | Bacteria | 28465 |
| 340 | Ga0265339_10037533 | 3300031249 | Unclassified | 2707 |
| 341 | Ga0265339_10061609 | 3300031249 | Bacteria | 2018 |
| 342 | Ga0265331_10000189 | 3300031250 | Bacteria | 75772 |
| 343 | Ga0265331_10041235 | 3300031250 | Unclassified | 2243 |
| 344 | Ga0265331_10086404 | 3300031250 | Bacteria | 1453 |
| 345 | Ga0265316_10001191 | 3300031344 | Bacteria | 28176 |
| 346 | Ga0265316_10049157 | 3300031344 | Bacteria | 3323 |
| 347 | Ga0265316_10120089 | 3300031344 | Bacteria | 1985 |
| 348 | Ga0265316_10269498 | 3300031344 | Bacteria | 1246 |
| 349 | Ga0265313_10000621 | 3300031595 | Bacteria | 36704 |
| 350 | Ga0265314_10000055 | 3300031711 | Bacteria | 172478 |
| 351 | Ga0265314_10008975 | 3300031711 | Bacteria | 8510 |
| 352 | Ga0265342_10000382 | 3300031712 | Bacteria | 49009 |
| 353 | Ga0265342_10001832 | 3300031712 | Bacteria | 19265 |
| 354 | Ga0265342_10075456 | 3300031712 | Bacteria | 1956 |
| 355 | Ga0307510_10040310 | 3300033180 | Bacteria | 5128 |
| 356 | Ga0307510_10216305 | 3300033180 | Unclassified | 1433 |
| 357 | Ga0373926_0003545 | 3300035083 | Bacteria | 5053 |
| 358 | Ga0373923_0001384 | 3300035111 | Bacteria | 6910 |
| 359 | Ga0373954_0017282 | 3300035118 | Bacteria | 3238 |
| 360 | Ga0373954_0107663 | 3300035118 | Bacteria | 1347 |
| 361 | Ga0373956_0045458 | 3300035119 | Unclassified | 1959 |
| 362 | Ga0373943_0260129 | 3300035170 | Bacteria | 977 |
| 363 | Ga0373935_0005554 | 3300035692 | Bacteria | 7430 |
| 364 | Ga0373935_0016504 | 3300035692 | Bacteria | 4467 |
| 365 | Ga0373935_0296511 | 3300035692 | Bacteria | 1142 |
| 366 | Ga0373935_0378205 | 3300035692 | Bacteria | 1014 |
| 367 | Ga0373933_0000621 | 3300035724 | Bacteria | 22159 |
| 368 | Ga0373933_0012619 | 3300035724 | Bacteria | 4669 |
| 369 | Ga0373937_0001927 | 3300036401 | Bacteria | 17361 |
| 370 | Ga0373937_0001985 | 3300036401 | Bacteria | 17112 |
| 371 | Ga0373937_0033202 | 3300036401 | Bacteria | 4685 |
| 372 | Ga0373937_0106613 | 3300036401 | Bacteria | 2605 |
| 373 | Ga0395898_0755351 | 3300037466 | Bacteria | 914 |
| 374 | Ga0436361_0350943 | 3300039447 | Bacteria | 16088 |
| 375 | Ga0436361_1210201 | 3300039447 | Bacteria | 975 |
| 376 | Ga0436363_0237435 | 3300039450 | Bacteria | 1835 |
| 377 | Ga0466969_0008525 | 3300044656 | Bacteria | 5440 |
| 378 | Ga0466959_0097773 | 3300045049 | Unclassified | 2103 |
| 379 | Ga0466967_0296048 | 3300045976 | Bacteria | 1556 |
| 380 | Ga0495592_0021852 | 3300046454 | Bacteria | 4869 |
| 381 | Ga0495592_0298613 | 3300046454 | Unclassified | 1048 |
| 382 | Ga0495603_0008247 | 3300046455 | Bacteria | 6296 |
| 383 | Ga0495629_0002270 | 3300046459 | Bacteria | 14829 |
| 384 | Ga0495629_0003365 | 3300046459 | Bacteria | 12077 |
| 385 | Ga0495651_0000024 | 3300046462 | Bacteria | 113645 |
| 386 | Ga0495651_0001109 | 3300046462 | Bacteria | 20801 |
| 387 | Ga0495651_0008221 | 3300046462 | Bacteria | 7997 |
| 388 | Ga0495651_0011609 | 3300046462 | Bacteria | 6770 |
| 389 | Ga0495651_0067144 | 3300046462 | Bacteria | 2736 |
| 390 | Ga0495651_0292784 | 3300046462 | Bacteria | 1095 |
| 391 | Ga0495653_0003041 | 3300046463 | Bacteria | 13455 |
| 392 | Ga0495653_0031977 | 3300046463 | Bacteria | 4181 |
| 393 | Ga0495653_0070134 | 3300046463 | Bacteria | 2624 |
| 394 | Ga0495653_0116656 | 3300046463 | Bacteria | 1909 |
| 395 | Ga0495653_0218892 | 3300046463 | Bacteria | 1281 |
| 396 | Ga0495650_0020899 | 3300046471 | Bacteria | 3179 |
| 397 | Ga0495580_0013009 | 3300046472 | Bacteria | 6372 |
| 398 | Ga0495580_0084610 | 3300046472 | Bacteria | 2209 |
| 399 | Ga0495580_0166828 | 3300046472 | Bacteria | 1523 |
| 400 | Ga0495580_0266332 | 3300046472 | Bacteria | 1171 |
| 401 | Ga0495580_0409445 | 3300046472 | Unclassified | 913 |
| 402 | Ga0495582_0012856 | 3300046473 | Bacteria | 4612 |
| 403 | Ga0495582_0027443 | 3300046473 | Bacteria | 3121 |
| 404 | Ga0495582_0174348 | 3300046473 | Bacteria | 1225 |
| 405 | Ga0495639_0004247 | 3300046475 | Bacteria | 6149 |
| 406 | Ga0495662_0044531 | 3300046476 | Bacteria | 2142 |
| 407 | Ga0495664_0001028 | 3300046477 | Bacteria | 14441 |
| 408 | Ga0495664_0004479 | 3300046477 | Bacteria | 7646 |
| 409 | Ga0495664_0044105 | 3300046477 | Bacteria | 2643 |
| 410 | Ga0495664_0105303 | 3300046477 | Bacteria | 1700 |
| 411 | Ga0495664_0115211 | 3300046477 | Bacteria | 1624 |
| 412 | Ga0495664_0194508 | 3300046477 | Unclassified | 1229 |
| 413 | Ga0495594_0000369 | 3300046499 | Bacteria | 22598 |
| 414 | Ga0495594_0002282 | 3300046499 | Bacteria | 9992 |
| 415 | Ga0495594_0147745 | 3300046499 | Bacteria | 1334 |
| 416 | Ga0495583_0022439 | 3300046506 | Bacteria | 3220 |
| 417 | Ga0495583_0028612 | 3300046506 | Unclassified | 2737 |
| 418 | Ga0495608_0006362 | 3300046511 | Bacteria | 8385 |
| 419 | Ga0495608_0008044 | 3300046511 | Bacteria | 7411 |
| 420 | Ga0495608_0117430 | 3300046511 | Bacteria | 1707 |
| 421 | Ga0495608_0158674 | 3300046511 | Bacteria | 1439 |
| 422 | Ga0495608_0210991 | 3300046511 | Unclassified | 1221 |
| 423 | Ga0495618_0005841 | 3300046514 | Bacteria | 7481 |
| 424 | Ga0495628_0001985 | 3300046516 | Bacteria | 18552 |
| 425 | Ga0495628_0003864 | 3300046516 | Bacteria | 13341 |
| 426 | Ga0495628_0117622 | 3300046516 | Unclassified | 2041 |
| 427 | Ga0495630_0001862 | 3300046517 | Bacteria | 14726 |
| 428 | Ga0495630_0012406 | 3300046517 | Bacteria | 6188 |
| 429 | Ga0495630_0015333 | 3300046517 | Bacteria | 5595 |
| 430 | Ga0495631_0058794 | 3300046518 | Bacteria | 1671 |
| 431 | Ga0495644_0000023 | 3300046523 | Bacteria | 79095 |
| 432 | Ga0495666_0003659 | 3300046526 | Bacteria | 7761 |
| 433 | Ga0495666_0125849 | 3300046526 | Bacteria | 1198 |
| 434 | Ga0495642_0129090 | 3300046528 | Bacteria | 1087 |
| 435 | Ga0495652_0006933 | 3300046529 | Bacteria | 10483 |
| 436 | Ga0495652_0015495 | 3300046529 | Bacteria | 6825 |
| 437 | Ga0495652_0039436 | 3300046529 | Bacteria | 4084 |
| 438 | Ga0495652_0089976 | 3300046529 | Bacteria | 2512 |
| 439 | Ga0495652_0134147 | 3300046529 | Bacteria | 1955 |
| 440 | Ga0495665_0006874 | 3300046531 | Bacteria | 6139 |
| 441 | Ga0495665_0035376 | 3300046531 | Bacteria | 2668 |
| 442 | Ga0495665_0070153 | 3300046531 | Bacteria | 1847 |
| 443 | Ga0495640_0038545 | 3300046533 | Bacteria | 3361 |
| 444 | Ga0495640_0057752 | 3300046533 | Unclassified | 2648 |
| 445 | Ga0495586_0040796 | 3300046535 | Bacteria | 2498 |
| 446 | Ga0495587_0000750 | 3300046536 | Bacteria | 21634 |
| 447 | Ga0495587_0008576 | 3300046536 | Bacteria | 6571 |
| 448 | Ga0495587_0093032 | 3300046536 | Bacteria | 1741 |
| 449 | Ga0495587_0139684 | 3300046536 | Unclassified | 1383 |
| 450 | Ga0495645_0007260 | 3300046543 | Bacteria | 7711 |
| 451 | Ga0495645_0015846 | 3300046543 | Bacteria | 5367 |
| 452 | Ga0495645_0027121 | 3300046543 | Bacteria | 4160 |
| 453 | Ga0495645_0142853 | 3300046543 | Bacteria | 1669 |
| 454 | Ga0495622_0198778 | 3300046557 | Bacteria | 894 |
| 455 | Ga0495633_0038163 | 3300046558 | Bacteria | 2296 |
| 456 | Ga0495667_0001411 | 3300046559 | Bacteria | 15799 |
| 457 | Ga0495667_0021672 | 3300046559 | Bacteria | 4336 |
| 458 | Ga0495667_0052135 | 3300046559 | Bacteria | 2696 |
| 459 | Ga0495667_0069306 | 3300046559 | Bacteria | 2302 |
| 460 | Ga0495668_0291491 | 3300046616 | Unclassified | 894 |
| 461 | Ga0495634_0017226 | 3300046642 | Bacteria | 5158 |
| 462 | Ga0495634_0106849 | 3300046642 | Bacteria | 1803 |
| 463 | Ga0495634_0294234 | 3300046642 | Bacteria | 983 |
| 464 | Ga0495625_0000796 | 3300046660 | Bacteria | 43709 |
| 465 | Ga0495625_0053725 | 3300046660 | Bacteria | 2880 |
| 466 | Ga0495625_0083329 | 3300046660 | Unclassified | 2223 |
| 467 | Ga0495635_0030836 | 3300046663 | Bacteria | 3725 |
| 468 | Ga0495657_0003833 | 3300046675 | Bacteria | 12148 |
| 469 | Ga0495657_0019873 | 3300046675 | Bacteria | 4840 |
| 470 | Ga0495657_0225553 | 3300046675 | Unclassified | 1135 |
| 471 | Ga0495599_0036136 | 3300046678 | Bacteria | 3101 |
| 472 | Ga0495623_0002696 | 3300046679 | Bacteria | 11727 |
| 473 | Ga0495623_0002699 | 3300046679 | Bacteria | 11724 |
| 474 | Ga0495623_0007196 | 3300046679 | Bacteria | 7226 |
| 475 | Ga0495623_0007967 | 3300046679 | Bacteria | 6884 |
| 476 | Ga0495623_0152596 | 3300046679 | Bacteria | 1364 |
| 477 | Ga0495646_0007090 | 3300046680 | Bacteria | 7120 |
| 478 | Ga0495646_0101057 | 3300046680 | Bacteria | 1654 |
| 479 | Ga0495669_0002280 | 3300046684 | Bacteria | 7869 |
| 480 | Ga0495669_0076008 | 3300046684 | Bacteria | 1537 |
| 481 | Ga0495613_0007057 | 3300046689 | Bacteria | 8362 |
| 482 | Ga0495613_0021250 | 3300046689 | Bacteria | 4840 |
| 483 | Ga0495613_0051731 | 3300046689 | Bacteria | 3027 |
| 484 | Ga0495613_0054867 | 3300046689 | Bacteria | 2929 |
| 485 | Ga0495613_0235990 | 3300046689 | Bacteria | 1280 |
| 486 | Ga0495624_0002205 | 3300046690 | Bacteria | 14879 |
| 487 | Ga0495624_0002954 | 3300046690 | Bacteria | 12720 |
| 488 | Ga0495624_0032057 | 3300046690 | Bacteria | 3409 |
| 489 | Ga0495624_0469465 | 3300046690 | Unclassified | 754 |
| 490 | Ga0495649_0037809 | 3300046694 | Unclassified | 2649 |
| 491 | Ga0495589_0186306 | 3300046794 | Unclassified | 983 |
| 492 | Ga0495600_0003466 | 3300046809 | Bacteria | 9282 |
| 493 | Ga0495581_0007694 | 3300047315 | Bacteria | 6234 |
| 494 | Ga0495581_0041552 | 3300047315 | Bacteria | 2661 |
| 495 | Ga0495604_0003709 | 3300047317 | Bacteria | 12166 |
| 496 | Ga0495604_0069122 | 3300047317 | Unclassified | 2678 |
| 497 | Ga0495604_0336096 | 3300047317 | Bacteria | 1006 |
| 498 | Ga0495674_0002093 | 3300047319 | Bacteria | 19591 |
| 499 | Ga0495674_0046674 | 3300047319 | Bacteria | 3844 |
| 500 | Ga0495674_0053638 | 3300047319 | Bacteria | 3543 |
| 501 | Ga0495674_0055844 | 3300047319 | Bacteria | 3461 |
| 502 | Ga0495674_0231041 | 3300047319 | Bacteria | 1526 |
| 503 | Ga0495674_0265424 | 3300047319 | Unclassified | 1409 |
| 504 | Ga0495674_0344075 | 3300047319 | Bacteria | 1211 |
| 505 | Ga0495674_0393806 | 3300047319 | Unclassified | 1119 |
| 506 | Ga0495672_0001628 | 3300047320 | Bacteria | 21845 |
| 507 | Ga0495676_0018292 | 3300047321 | Bacteria | 6178 |
| 508 | Ga0495680_0000749 | 3300047322 | Bacteria | 36388 |
| 509 | Ga0495680_0020341 | 3300047322 | Bacteria | 5586 |
| 510 | Ga0495680_0087536 | 3300047322 | Bacteria | 2343 |
| 511 | Ga0495680_0138896 | 3300047322 | Bacteria | 1779 |
| 512 | Ga0495675_0000052 | 3300047444 | Bacteria | 79959 |
| 513 | Ga0495675_0001719 | 3300047444 | Bacteria | 13101 |
| 514 | Ga0495675_0007813 | 3300047444 | Bacteria | 6602 |
| 515 | Ga0495675_0013990 | 3300047444 | Bacteria | 5073 |
| 516 | Ga0495675_0028592 | 3300047444 | Bacteria | 3554 |
| 517 | Ga0495675_0028790 | 3300047444 | Bacteria | 3540 |
| 518 | Ga0495675_0057553 | 3300047444 | Bacteria | 2465 |
| 519 | Ga0495675_0107788 | 3300047444 | Bacteria | 1740 |
| 520 | Ga0495675_0203795 | 3300047444 | Unclassified | 1203 |
| 521 | Ga0495677_0003312 | 3300047445 | Bacteria | 6270 |
| 522 | Ga0495673_0064222 | 3300047469 | Bacteria | 1563 |
| 523 | Ga0495684_0000552 | 3300047471 | Bacteria | 30354 |
| 524 | Ga0495684_0006046 | 3300047471 | Bacteria | 9412 |
| 525 | Ga0495684_0062549 | 3300047471 | Bacteria | 2831 |
| 526 | Ga0495684_0112700 | 3300047471 | Bacteria | 2051 |
| 527 | Ga0495684_0282723 | 3300047471 | Unclassified | 1196 |
| 528 | Ga0495684_0392509 | 3300047471 | Unclassified | 976 |
| 529 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 530 | Ga0495686_0002195 | 3300047472 | Bacteria | 18979 |
| 531 | Ga0495686_0061295 | 3300047472 | Bacteria | 2337 |
| 532 | Ga0495593_0007636 | 3300047673 | Bacteria | 6316 |
| 533 | Ga0495593_0105283 | 3300047673 | Bacteria | 1444 |
| 534 | Ga0495593_0199224 | 3300047673 | Bacteria | 1006 |
| 535 | Ga0495602_0001118 | 3300048088 | Bacteria | 26277 |
| 536 | Ga0495602_0017357 | 3300048088 | Bacteria | 7216 |
| 537 | Ga0495602_0034796 | 3300048088 | Bacteria | 4705 |
| 538 | Ga0495602_0051562 | 3300048088 | Bacteria | 3663 |
| 539 | Ga0495602_0186272 | 3300048088 | Bacteria | 1596 |
| 540 | Ga0495602_0341911 | 3300048088 | Bacteria | 1082 |
| 541 | Ga0495602_0478334 | 3300048088 | Bacteria | 874 |
| 542 | Ga0495614_0003927 | 3300048089 | Bacteria | 6677 |
| 543 | Ga0496104_0000072 | 3300048907 | Bacteria | 106074 |
| 544 | Ga0496104_0116459 | 3300048907 | Bacteria | 2565 |
| 545 | Ga0496105_0146883 | 3300048908 | Bacteria | 1939 |
| 546 | Ga0496106_0059518 | 3300048909 | Bacteria | 2894 |
| 547 | Ga0496112_0060439 | 3300048915 | Bacteria | 3735 |
| 548 | Ga0496113_0298407 | 3300048916 | Bacteria | 1290 |
| 549 | Ga0496114_0514061 | 3300048917 | Bacteria | 1059 |
| 550 | Ga0496115_0087509 | 3300048918 | Bacteria | 2542 |
| 551 | Ga0496115_0115142 | 3300048918 | Bacteria | 2211 |
| 552 | Ga0496115_0185310 | 3300048918 | Bacteria | 1720 |
| 553 | Ga0496119_0201759 | 3300048922 | Bacteria | 1029 |
| 554 | Ga0496125_0110278 | 3300048928 | Bacteria | 1996 |
| 555 | Ga0496126_0000024 | 3300048929 | Bacteria | 462877 |
| 556 | Ga0496126_0000085 | 3300048929 | Bacteria | 216528 |
| 557 | Ga0496126_0000820 | 3300048929 | Bacteria | 55350 |
| 558 | Ga0496126_0006879 | 3300048929 | Bacteria | 12601 |
| 559 | Ga0496126_0011765 | 3300048929 | Bacteria | 9011 |
| 560 | Ga0496126_0047495 | 3300048929 | Bacteria | 3930 |
| 561 | Ga0501031_0182605 | 3300049568 | Bacteria | 1370 |
| 562 | Ga0501032_0011478 | 3300049569 | Bacteria | 6364 |
| 563 | Ga0501032_0096213 | 3300049569 | Bacteria | 1963 |
| 564 | Ga0501033_0000876 | 3300049570 | Bacteria | 27523 |
| 565 | Ga0501034_0049026 | 3300049571 | Bacteria | 4262 |
| 566 | Ga0501036_0011178 | 3300049572 | Bacteria | 7428 |
| 567 | Ga0501037_0050673 | 3300049573 | Bacteria | 3038 |
| 568 | Ga0501037_0164211 | 3300049573 | Bacteria | 1582 |
| 569 | Ga0501038_0003247 | 3300049574 | Bacteria | 15159 |
| 570 | Ga0501039_0099582 | 3300049575 | Bacteria | 2268 |
| 571 | Ga0501043_0010410 | 3300049579 | Bacteria | 7287 |
| 572 | Ga0501046_0000265 | 3300049580 | Bacteria | 53355 |
| 573 | Ga0501047_0003679 | 3300049581 | Bacteria | 14454 |
| 574 | Ga0501070_0162859 | 3300049586 | Bacteria | 1839 |
| 575 | Ga0501070_0231448 | 3300049586 | Bacteria | 1514 |
| 576 | Ga0501073_0122790 | 3300049589 | Bacteria | 1800 |
| 577 | Ga0501035_0002898 | 3300049822 | Bacteria | 16521 |
| 578 | Ga0501044_0006355 | 3300049823 | Bacteria | 13062 |
| 579 | nmdc:mga06z11_57538_c1 | 3300050494 | Unclassified | 2014 |
| 580 | nmdc:mga0rr50_377528_c1 | 3300050513 | Bacteria | 1195 |
| 581 | Ga0500595_003197 | 3300053119 | Bacteria | 7749 |
| 582 | Ga0500661_000537 | 3300055283 | Bacteria | 7054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_377528_c1 | nmdc:mga0rr50_377528_c1_410_1135 | 217 |
| 2 | 3300028800 | Ga0265338_10135718 | Ga0265338_101357181 | 218 |
| 3 | 3300031241 | Ga0265325_10017784 | Ga0265325_100177842 | 218 |
| 4 | 3300035118 | Ga0373954_0017282 | Ga0373954_0017282_2278_3066 | 219 |
| 5 | 3300035692 | Ga0373935_0005554 | Ga0373935_0005554_4974_5762 | 219 |
| 6 | 3300046462 | Ga0495651_0067144 | Ga0495651_0067144_1617_2405 | 219 |
| 7 | 3300046463 | Ga0495653_0003041 | Ga0495653_0003041_10981_11769 | 219 |
| 8 | 3300046472 | Ga0495580_0013009 | Ga0495580_0013009_3145_3933 | 219 |
| 9 | 3300046477 | Ga0495664_0115211 | Ga0495664_0115211_812_1600 | 219 |
| 10 | 3300046511 | Ga0495608_0008044 | Ga0495608_0008044_1757_2545 | 219 |
| 11 | 3300046517 | Ga0495630_0015333 | Ga0495630_0015333_1027_1815 | 219 |
| 12 | 3300046543 | Ga0495645_0142853 | Ga0495645_0142853_141_929 | 219 |
| 13 | 3300046675 | Ga0495657_0003833 | Ga0495657_0003833_9613_10401 | 219 |
| 14 | 3300046679 | Ga0495623_0002699 | Ga0495623_0002699_9452_10240 | 219 |
| 15 | 3300046680 | Ga0495646_0007090 | Ga0495646_0007090_1455_2243 | 219 |
| 16 | 3300046690 | Ga0495624_0002954 | Ga0495624_0002954_1391_2179 | 219 |
| 17 | 3300047317 | Ga0495604_0336096 | Ga0495604_0336096_14_802 | 219 |
| 18 | 3300047319 | Ga0495674_0344075 | Ga0495674_0344075_19_807 | 219 |
| 19 | 3300047444 | Ga0495675_0007813 | Ga0495675_0007813_1783_2571 | 219 |
| 20 | 3300047471 | Ga0495684_0112700 | Ga0495684_0112700_102_890 | 219 |
| 21 | 3300047673 | Ga0495593_0007636 | Ga0495593_0007636_4828_5616 | 219 |
| 22 | 3300048088 | Ga0495602_0017357 | Ga0495602_0017357_1532_2320 | 219 |
| 23 | 3300013104 | Ga0157370_10062741 | Ga0157370_100627413 | 221 |
| 24 | 3300013105 | Ga0157369_10040778 | Ga0157369_100407784 | 221 |
| 25 | 3300046690 | Ga0495624_0469465 | Ga0495624_0469465_17_739 | 224 |
| 26 | 3300048088 | Ga0495602_0478334 | Ga0495602_0478334_82_852 | 227 |
| 27 | 3300005455 | Ga0070663_100138714 | Ga0070663_1001387143 | 228 |
| 28 | 3300005563 | Ga0068855_100004621 | Ga0068855_1000046218 | 228 |
| 29 | 3300005578 | Ga0068854_100218669 | Ga0068854_1002186692 | 228 |
| 30 | 3300025949 | Ga0207667_10020653 | Ga0207667_100206534 | 228 |
| 31 | 3300026067 | Ga0207678_10116755 | Ga0207678_101167552 | 228 |
| 32 | 3300028379 | Ga0268266_10127042 | Ga0268266_101270422 | 229 |
| 33 | 3300046517 | Ga0495630_0001862 | Ga0495630_0001862_13190_14017 | 233 |
| 34 | 3300048088 | Ga0495602_0341911 | Ga0495602_0341911_126_953 | 233 |
| 35 | 3300035083 | Ga0373926_0003545 | Ga0373926_0003545_56_886 | 234 |
| 36 | 3300035111 | Ga0373923_0001384 | Ga0373923_0001384_446_1276 | 234 |
| 37 | 3300035692 | Ga0373935_0016504 | Ga0373935_0016504_1856_2686 | 234 |
| 38 | 3300035724 | Ga0373933_0012619 | Ga0373933_0012619_3757_4587 | 234 |
| 39 | 3300036401 | Ga0373937_0033202 | Ga0373937_0033202_1451_2281 | 234 |
| 40 | 3300046454 | Ga0495592_0021852 | Ga0495592_0021852_1127_1957 | 234 |
| 41 | 3300046462 | Ga0495651_0000024 | Ga0495651_0000024_24227_25057 | 234 |
| 42 | 3300046462 | Ga0495651_0011609 | Ga0495651_0011609_4367_5197 | 234 |
| 43 | 3300046463 | Ga0495653_0031977 | Ga0495653_0031977_2349_3179 | 234 |
| 44 | 3300046472 | Ga0495580_0084610 | Ga0495580_0084610_241_1071 | 234 |
| 45 | 3300046511 | Ga0495608_0006362 | Ga0495608_0006362_7405_8235 | 234 |
| 46 | 3300046511 | Ga0495608_0117430 | Ga0495608_0117430_612_1442 | 234 |
| 47 | 3300046526 | Ga0495666_0125849 | Ga0495666_0125849_13_843 | 234 |
| 48 | 3300046529 | Ga0495652_0039436 | Ga0495652_0039436_2043_2873 | 234 |
| 49 | 3300046531 | Ga0495665_0006874 | Ga0495665_0006874_773_1603 | 234 |
| 50 | 3300046559 | Ga0495667_0001411 | Ga0495667_0001411_998_1828 | 234 |
| 51 | 3300046642 | Ga0495634_0294234 | Ga0495634_0294234_92_922 | 234 |
| 52 | 3300046679 | Ga0495623_0002696 | Ga0495623_0002696_5161_5991 | 234 |
| 53 | 3300046690 | Ga0495624_0032057 | Ga0495624_0032057_1198_2028 | 234 |
| 54 | 3300047319 | Ga0495674_0046674 | Ga0495674_0046674_874_1704 | 234 |
| 55 | 3300047322 | Ga0495680_0000749 | Ga0495680_0000749_22461_23291 | 234 |
| 56 | 3300047444 | Ga0495675_0013990 | Ga0495675_0013990_1954_2784 | 234 |
| 57 | 3300047444 | Ga0495675_0028790 | Ga0495675_0028790_2348_3178 | 234 |
| 58 | 3300047673 | Ga0495593_0199224 | Ga0495593_0199224_26_856 | 234 |
| 59 | 3300048088 | Ga0495602_0034796 | Ga0495602_0034796_1845_2675 | 234 |
| 60 | 3300009093 | Ga0105240_10000531 | Ga0105240_1000053128 | 235 |
| 61 | 3300025913 | Ga0207695_10002371 | Ga0207695_100023716 | 235 |
| 62 | 3300031090 | Ga0265760_10055553 | Ga0265760_100555531 | 235 |
| 63 | 3300046557 | Ga0495622_0198778 | Ga0495622_0198778_97_849 | 235 |
| 64 | 3300009093 | Ga0105240_10000987 | Ga0105240_1000098740 | 236 |
| 65 | 3300009545 | Ga0105237_10013779 | Ga0105237_100137796 | 236 |
| 66 | 3300009551 | Ga0105238_10063959 | Ga0105238_100639592 | 236 |
| 67 | 3300013296 | Ga0157374_10457828 | Ga0157374_104578282 | 236 |
| 68 | 3300013307 | Ga0157372_10257007 | Ga0157372_102570072 | 236 |
| 69 | 3300026078 | Ga0207702_10463833 | Ga0207702_104638332 | 236 |
| 70 | 3300030763 | Ga0265763_1001273 | Ga0265763_10012731 | 236 |
| 71 | 3300046517 | Ga0495630_0012406 | Ga0495630_0012406_5005_5790 | 236 |
| 72 | 3300025921 | Ga0207652_10265459 | Ga0207652_102654592 | 237 |
| 73 | 3300009545 | Ga0105237_10292554 | Ga0105237_102925541 | 240 |
| 74 | 3300048918 | Ga0496115_0115142 | Ga0496115_0115142_1216_2022 | 240 |
| 75 | 3300050494 | nmdc:mga06z11_57538_c1 | nmdc:mga06z11_57538_c1_65_898 | 240 |
| 76 | 3300028800 | Ga0265338_10031750 | Ga0265338_100317503 | 241 |
| 77 | 3300028800 | Ga0265338_10194327 | Ga0265338_101943271 | 241 |
| 78 | 3300031242 | Ga0265329_10091027 | Ga0265329_100910271 | 241 |
| 79 | 3300031247 | Ga0265340_10012280 | Ga0265340_100122802 | 241 |
| 80 | 3300031250 | Ga0265331_10041235 | Ga0265331_100412352 | 241 |
| 81 | 3300031344 | Ga0265316_10120089 | Ga0265316_101200892 | 241 |
| 82 | 3300031712 | Ga0265342_10075456 | Ga0265342_100754561 | 241 |
| 83 | 3300013105 | Ga0157369_10042191 | Ga0157369_100421913 | 242 |
| 84 | 3300005518 | Ga0070699_100033445 | Ga0070699_1000334452 | 243 |
| 85 | 3300005518 | Ga0070699_100186543 | Ga0070699_1001865432 | 243 |
| 86 | 3300005536 | Ga0070697_100065430 | Ga0070697_1000654302 | 243 |
| 87 | 3300005545 | Ga0070695_100409310 | Ga0070695_1004093101 | 243 |
| 88 | 3300005548 | Ga0070665_100140419 | Ga0070665_1001404192 | 243 |
| 89 | 3300005563 | Ga0068855_100000283 | Ga0068855_10000028326 | 243 |
| 90 | 3300005614 | Ga0068856_100473622 | Ga0068856_1004736222 | 243 |
| 91 | 3300006914 | Ga0075436_100098945 | Ga0075436_1000989452 | 243 |
| 92 | 3300007076 | Ga0075435_100338116 | Ga0075435_1003381161 | 243 |
| 93 | 3300009093 | Ga0105240_10033202 | Ga0105240_100332024 | 243 |
| 94 | 3300025906 | Ga0207699_10205566 | Ga0207699_102055662 | 243 |
| 95 | 3300025913 | Ga0207695_10015076 | Ga0207695_100150762 | 243 |
| 96 | 3300025913 | Ga0207695_10077491 | Ga0207695_100774912 | 243 |
| 97 | 3300025914 | Ga0207671_10042817 | Ga0207671_100428172 | 243 |
| 98 | 3300025922 | Ga0207646_10433787 | Ga0207646_104337872 | 243 |
| 99 | 3300025949 | Ga0207667_10000696 | Ga0207667_1000069614 | 243 |
| 100 | 3300049568 | Ga0501031_0182605 | Ga0501031_0182605_58_864 | 243 |
| 101 | 3300049569 | Ga0501032_0011478 | Ga0501032_0011478_1355_2161 | 243 |
| 102 | 3300049570 | Ga0501033_0000876 | Ga0501033_0000876_22863_23669 | 243 |
| 103 | 3300049571 | Ga0501034_0049026 | Ga0501034_0049026_2866_3672 | 243 |
| 104 | 3300049572 | Ga0501036_0011178 | Ga0501036_0011178_4133_4939 | 243 |
| 105 | 3300049573 | Ga0501037_0050673 | Ga0501037_0050673_430_1236 | 243 |
| 106 | 3300049574 | Ga0501038_0003247 | Ga0501038_0003247_11175_11981 | 243 |
| 107 | 3300049575 | Ga0501039_0099582 | Ga0501039_0099582_865_1671 | 243 |
| 108 | 3300049579 | Ga0501043_0010410 | Ga0501043_0010410_6268_7074 | 243 |
| 109 | 3300049580 | Ga0501046_0000265 | Ga0501046_0000265_29978_30784 | 243 |
| 110 | 3300049581 | Ga0501047_0003679 | Ga0501047_0003679_3128_3934 | 243 |
| 111 | 3300049586 | Ga0501070_0162859 | Ga0501070_0162859_127_933 | 243 |
| 112 | 3300049589 | Ga0501073_0122790 | Ga0501073_0122790_75_881 | 243 |
| 113 | 3300049822 | Ga0501035_0002898 | Ga0501035_0002898_2710_3516 | 243 |
| 114 | 3300049823 | Ga0501044_0006355 | Ga0501044_0006355_8984_9790 | 243 |
| 115 | 3300005530 | Ga0070679_100000708 | Ga0070679_10000070811 | 244 |
| 116 | 3300005563 | Ga0068855_100001444 | Ga0068855_10000144411 | 244 |
| 117 | 3300005563 | Ga0068855_100190655 | Ga0068855_1001906552 | 244 |
| 118 | 3300005578 | Ga0068854_100138693 | Ga0068854_1001386932 | 244 |
| 119 | 3300006178 | Ga0075367_10021715 | Ga0075367_100217152 | 244 |
| 120 | 3300009093 | Ga0105240_10002185 | Ga0105240_1000218515 | 244 |
| 121 | 3300009093 | Ga0105240_10006817 | Ga0105240_100068178 | 244 |
| 122 | 3300009101 | Ga0105247_10044484 | Ga0105247_100444842 | 244 |
| 123 | 3300009551 | Ga0105238_10002780 | Ga0105238_100027809 | 244 |
| 124 | 3300013104 | Ga0157370_10006045 | Ga0157370_1000604511 | 244 |
| 125 | 3300013105 | Ga0157369_10048445 | Ga0157369_100484452 | 244 |
| 126 | 3300025912 | Ga0207707_10000107 | Ga0207707_100001074 | 244 |
| 127 | 3300025913 | Ga0207695_10004580 | Ga0207695_100045809 | 244 |
| 128 | 3300025917 | Ga0207660_10021314 | Ga0207660_100213142 | 244 |
| 129 | 3300025921 | Ga0207652_10003528 | Ga0207652_1000352812 | 244 |
| 130 | 3300025924 | Ga0207694_10010308 | Ga0207694_100103081 | 244 |
| 131 | 3300025949 | Ga0207667_10015029 | Ga0207667_100150291 | 244 |
| 132 | 3300025981 | Ga0207640_10074667 | Ga0207640_100746672 | 244 |
| 133 | 3300026078 | Ga0207702_10558798 | Ga0207702_105587982 | 244 |
| 134 | 3300044656 | Ga0466969_0008525 | Ga0466969_0008525_3946_4758 | 244 |
| 135 | 3300045049 | Ga0466959_0097773 | Ga0466959_0097773_1157_1966 | 244 |
| 136 | 3300047471 | Ga0495684_0392509 | Ga0495684_0392509_35_814 | 244 |
| 137 | 3300028800 | Ga0265338_10233144 | Ga0265338_102331441 | 245 |
| 138 | 3300005336 | Ga0070680_100028659 | Ga0070680_1000286592 | 247 |
| 139 | 3300005530 | Ga0070679_100051271 | Ga0070679_1000512712 | 247 |
| 140 | 3300005535 | Ga0070684_100021531 | Ga0070684_1000215312 | 247 |
| 141 | 3300009545 | Ga0105237_10188031 | Ga0105237_101880311 | 247 |
| 142 | 3300013104 | Ga0157370_10165208 | Ga0157370_101652082 | 247 |
| 143 | 3300014325 | Ga0163163_10092508 | Ga0163163_100925082 | 247 |
| 144 | 3300025912 | Ga0207707_10073505 | Ga0207707_100735052 | 247 |
| 145 | 3300025914 | Ga0207671_10182706 | Ga0207671_101827061 | 247 |
| 146 | 3300025917 | Ga0207660_10080182 | Ga0207660_100801822 | 247 |
| 147 | 3300025944 | Ga0207661_10440129 | Ga0207661_104401292 | 247 |
| 148 | 3300026142 | Ga0207698_10191033 | Ga0207698_101910331 | 247 |
| 149 | 3300028379 | Ga0268266_10001873 | Ga0268266_1000187311 | 247 |
| 150 | 3300028563 | Ga0265319_1000898 | Ga0265319_10008984 | 247 |
| 151 | 3300028577 | Ga0265318_10000151 | Ga0265318_1000015139 | 247 |
| 152 | 3300031238 | Ga0265332_10002631 | Ga0265332_100026311 | 247 |
| 153 | 3300031240 | Ga0265320_10000105 | Ga0265320_1000010515 | 247 |
| 154 | 3300031241 | Ga0265325_10153539 | Ga0265325_101535391 | 247 |
| 155 | 3300031242 | Ga0265329_10000054 | Ga0265329_1000005429 | 247 |
| 156 | 3300031247 | Ga0265340_10005124 | Ga0265340_100051244 | 247 |
| 157 | 3300031249 | Ga0265339_10000583 | Ga0265339_1000058315 | 247 |
| 158 | 3300031250 | Ga0265331_10000189 | Ga0265331_1000018952 | 247 |
| 159 | 3300031344 | Ga0265316_10001191 | Ga0265316_1000119115 | 247 |
| 160 | 3300031595 | Ga0265313_10000621 | Ga0265313_1000062118 | 247 |
| 161 | 3300031711 | Ga0265314_10008975 | Ga0265314_100089752 | 247 |
| 162 | 3300031712 | Ga0265342_10000382 | Ga0265342_1000038229 | 247 |
| 163 | 3300046462 | Ga0495651_0292784 | Ga0495651_0292784_194_1051 | 247 |
| 164 | 3300048928 | Ga0496125_0110278 | Ga0496125_0110278_143_976 | 247 |
| 165 | 3300048929 | Ga0496126_0000024 | Ga0496126_0000024_47838_48641 | 247 |
| 166 | 3300048929 | Ga0496126_0011765 | Ga0496126_0011765_515_1348 | 247 |
| 167 | 3300049569 | Ga0501032_0096213 | Ga0501032_0096213_616_1425 | 247 |
| 168 | 3300049573 | Ga0501037_0164211 | Ga0501037_0164211_200_1009 | 247 |
| 169 | 3300049586 | Ga0501070_0231448 | Ga0501070_0231448_369_1178 | 247 |
| 170 | 3300005336 | Ga0070680_100190288 | Ga0070680_1001902882 | 248 |
| 171 | 3300005439 | Ga0070711_100123069 | Ga0070711_1001230692 | 248 |
| 172 | 3300005458 | Ga0070681_10053834 | Ga0070681_100538343 | 248 |
| 173 | 3300005530 | Ga0070679_100033285 | Ga0070679_1000332852 | 248 |
| 174 | 3300005563 | Ga0068855_100251772 | Ga0068855_1002517722 | 248 |
| 175 | 3300007265 | Ga0099794_10077857 | Ga0099794_100778572 | 248 |
| 176 | 3300025906 | Ga0207699_10290101 | Ga0207699_102901011 | 248 |
| 177 | 3300025912 | Ga0207707_10028648 | Ga0207707_100286484 | 248 |
| 178 | 3300025917 | Ga0207660_10243747 | Ga0207660_102437472 | 248 |
| 179 | 3300025921 | Ga0207652_10122191 | Ga0207652_101221912 | 248 |
| 180 | 3300035118 | Ga0373954_0107663 | Ga0373954_0107663_351_1187 | 248 |
| 181 | 3300047471 | Ga0495684_0000552 | Ga0495684_0000552_3871_4707 | 248 |
| 182 | iso_pu_bacteria | 2884215851 | 2884216310 | 248 |
| 183 | 3300005518 | Ga0070699_100337555 | Ga0070699_1003375551 | 249 |
| 184 | 3300005563 | Ga0068855_100289880 | Ga0068855_1002898802 | 249 |
| 185 | 3300005614 | Ga0068856_100293081 | Ga0068856_1002930812 | 249 |
| 186 | 3300007788 | Ga0099795_10075583 | Ga0099795_100755832 | 249 |
| 187 | 3300009545 | Ga0105237_10060012 | Ga0105237_100600122 | 249 |
| 188 | 3300009553 | Ga0105249_10042373 | Ga0105249_100423732 | 249 |
| 189 | 3300014968 | Ga0157379_10153132 | Ga0157379_101531322 | 249 |
| 190 | 3300025913 | Ga0207695_10126381 | Ga0207695_101263811 | 249 |
| 191 | 3300025949 | Ga0207667_10252783 | Ga0207667_102527832 | 249 |
| 192 | 3300026078 | Ga0207702_10502876 | Ga0207702_105028761 | 249 |
| 193 | 3300046462 | Ga0495651_0008221 | Ga0495651_0008221_502_1311 | 249 |
| 194 | 3300046463 | Ga0495653_0116656 | Ga0495653_0116656_492_1301 | 249 |
| 195 | 3300046476 | Ga0495662_0044531 | Ga0495662_0044531_1167_1976 | 249 |
| 196 | 3300046477 | Ga0495664_0004479 | Ga0495664_0004479_2556_3365 | 249 |
| 197 | 3300046529 | Ga0495652_0134147 | Ga0495652_0134147_861_1670 | 249 |
| 198 | 3300046536 | Ga0495587_0093032 | Ga0495587_0093032_501_1310 | 249 |
| 199 | 3300046642 | Ga0495634_0106849 | Ga0495634_0106849_653_1462 | 249 |
| 200 | 3300046689 | Ga0495613_0054867 | Ga0495613_0054867_286_1095 | 249 |
| 201 | 3300047319 | Ga0495674_0231041 | Ga0495674_0231041_367_1176 | 249 |
| 202 | 3300047444 | Ga0495675_0028592 | Ga0495675_0028592_1050_1859 | 249 |
| 203 | 3300005327 | Ga0070658_10006025 | Ga0070658_100060252 | 250 |
| 204 | 3300005327 | Ga0070658_10146270 | Ga0070658_101462702 | 250 |
| 205 | 3300005327 | Ga0070658_10319824 | Ga0070658_103198242 | 250 |
| 206 | 3300005338 | Ga0068868_100309265 | Ga0068868_1003092651 | 250 |
| 207 | 3300005435 | Ga0070714_100069565 | Ga0070714_1000695652 | 250 |
| 208 | 3300005436 | Ga0070713_100170804 | Ga0070713_1001708041 | 250 |
| 209 | 3300005539 | Ga0068853_100138596 | Ga0068853_1001385961 | 250 |
| 210 | 3300005563 | Ga0068855_100389553 | Ga0068855_1003895531 | 250 |
| 211 | 3300005578 | Ga0068854_100247589 | Ga0068854_1002475891 | 250 |
| 212 | 3300005616 | Ga0068852_100035373 | Ga0068852_1000353735 | 250 |
| 213 | 3300006237 | Ga0097621_100648306 | Ga0097621_1006483061 | 250 |
| 214 | 3300009093 | Ga0105240_10374304 | Ga0105240_103743041 | 250 |
| 215 | 3300009098 | Ga0105245_10103660 | Ga0105245_101036603 | 250 |
| 216 | 3300009101 | Ga0105247_10181129 | Ga0105247_101811292 | 250 |
| 217 | 3300009551 | Ga0105238_10336378 | Ga0105238_103363782 | 250 |
| 218 | 3300010159 | Ga0099796_10043980 | Ga0099796_100439802 | 250 |
| 219 | 3300013104 | Ga0157370_10242772 | Ga0157370_102427722 | 250 |
| 220 | 3300013105 | Ga0157369_10132915 | Ga0157369_101329152 | 250 |
| 221 | 3300013105 | Ga0157369_10271285 | Ga0157369_102712851 | 250 |
| 222 | 3300013296 | Ga0157374_10003041 | Ga0157374_100030414 | 250 |
| 223 | 3300013297 | Ga0157378_10003951 | Ga0157378_100039512 | 250 |
| 224 | 3300013307 | Ga0157372_10014094 | Ga0157372_100140945 | 250 |
| 225 | 3300013307 | Ga0157372_10542872 | Ga0157372_105428721 | 250 |
| 226 | 3300013308 | Ga0157375_10769994 | Ga0157375_107699941 | 250 |
| 227 | 3300014745 | Ga0157377_10073139 | Ga0157377_100731392 | 250 |
| 228 | 3300025909 | Ga0207705_10011320 | Ga0207705_100113201 | 250 |
| 229 | 3300025909 | Ga0207705_10046956 | Ga0207705_100469562 | 250 |
| 230 | 3300025909 | Ga0207705_10244428 | Ga0207705_102444281 | 250 |
| 231 | 3300025924 | Ga0207694_10046792 | Ga0207694_100467922 | 250 |
| 232 | 3300025924 | Ga0207694_10257166 | Ga0207694_102571661 | 250 |
| 233 | 3300025927 | Ga0207687_10169819 | Ga0207687_101698192 | 250 |
| 234 | 3300025949 | Ga0207667_10148939 | Ga0207667_101489393 | 250 |
| 235 | 3300025949 | Ga0207667_10285593 | Ga0207667_102855932 | 250 |
| 236 | 3300025981 | Ga0207640_10500324 | Ga0207640_105003241 | 250 |
| 237 | 3300026023 | Ga0207677_10252133 | Ga0207677_102521331 | 250 |
| 238 | 3300026041 | Ga0207639_10076941 | Ga0207639_100769412 | 250 |
| 239 | 3300035170 | Ga0373943_0260129 | Ga0373943_0260129_164_964 | 250 |
| 240 | 3300039447 | Ga0436361_1210201 | Ga0436361_1210201_127_927 | 250 |
| 241 | 3300045976 | Ga0466967_0296048 | Ga0466967_0296048_583_1422 | 250 |
| 242 | 3300046454 | Ga0495592_0298613 | Ga0495592_0298613_106_936 | 250 |
| 243 | 3300046477 | Ga0495664_0194508 | Ga0495664_0194508_308_1132 | 250 |
| 244 | 3300046499 | Ga0495594_0147745 | Ga0495594_0147745_312_1142 | 250 |
| 245 | 3300046511 | Ga0495608_0210991 | Ga0495608_0210991_401_1210 | 250 |
| 246 | 3300046514 | Ga0495618_0005841 | Ga0495618_0005841_92_916 | 250 |
| 247 | 3300046516 | Ga0495628_0001985 | Ga0495628_0001985_93_917 | 250 |
| 248 | 3300046529 | Ga0495652_0006933 | Ga0495652_0006933_1286_2110 | 250 |
| 249 | 3300046533 | Ga0495640_0038545 | Ga0495640_0038545_1841_2650 | 250 |
| 250 | 3300046533 | Ga0495640_0057752 | Ga0495640_0057752_97_921 | 250 |
| 251 | 3300046536 | Ga0495587_0000750 | Ga0495587_0000750_15897_16721 | 250 |
| 252 | 3300046559 | Ga0495667_0021672 | Ga0495667_0021672_3398_4222 | 250 |
| 253 | 3300046559 | Ga0495667_0069306 | Ga0495667_0069306_70_900 | 250 |
| 254 | 3300046663 | Ga0495635_0030836 | Ga0495635_0030836_543_1367 | 250 |
| 255 | 3300046675 | Ga0495657_0019873 | Ga0495657_0019873_942_1766 | 250 |
| 256 | 3300046675 | Ga0495657_0225553 | Ga0495657_0225553_174_1004 | 250 |
| 257 | 3300046689 | Ga0495613_0051731 | Ga0495613_0051731_877_1707 | 250 |
| 258 | 3300046809 | Ga0495600_0003466 | Ga0495600_0003466_50_874 | 250 |
| 259 | 3300047319 | Ga0495674_0265424 | Ga0495674_0265424_41_865 | 250 |
| 260 | 3300047322 | Ga0495680_0020341 | Ga0495680_0020341_4712_5536 | 250 |
| 261 | 3300047444 | Ga0495675_0000052 | Ga0495675_0000052_64_888 | 250 |
| 262 | 3300047444 | Ga0495675_0107788 | Ga0495675_0107788_828_1637 | 250 |
| 263 | 3300047471 | Ga0495684_0062549 | Ga0495684_0062549_558_1367 | 250 |
| 264 | 3300047471 | Ga0495684_0282723 | Ga0495684_0282723_110_934 | 250 |
| 265 | 3300048088 | Ga0495602_0051562 | Ga0495602_0051562_2797_3621 | 250 |
| 266 | 3300048915 | Ga0496112_0060439 | Ga0496112_0060439_706_1536 | 250 |
| 267 | 3300005329 | Ga0070683_100000035 | Ga0070683_10000003555 | 251 |
| 268 | 3300005535 | Ga0070684_100000037 | Ga0070684_10000003731 | 251 |
| 269 | 3300009176 | Ga0105242_10073011 | Ga0105242_100730112 | 251 |
| 270 | 3300013297 | Ga0157378_10334260 | Ga0157378_103342602 | 251 |
| 271 | 3300025929 | Ga0207664_10470888 | Ga0207664_104708882 | 251 |
| 272 | 3300025944 | Ga0207661_10000008 | Ga0207661_10000008335 | 251 |
| 273 | 3300046472 | Ga0495580_0266332 | Ga0495580_0266332_347_1156 | 251 |
| 274 | 3300046477 | Ga0495664_0105303 | Ga0495664_0105303_545_1351 | 251 |
| 275 | 3300046516 | Ga0495628_0117622 | Ga0495628_0117622_610_1416 | 251 |
| 276 | 3300047317 | Ga0495604_0069122 | Ga0495604_0069122_1683_2486 | 251 |
| 277 | 3300047319 | Ga0495674_0002093 | Ga0495674_0002093_11485_12291 | 251 |
| 278 | 3300047319 | Ga0495674_0053638 | Ga0495674_0053638_475_1278 | 251 |
| 279 | 3300047319 | Ga0495674_0393806 | Ga0495674_0393806_31_837 | 251 |
| 280 | 3300047322 | Ga0495680_0138896 | Ga0495680_0138896_29_835 | 251 |
| 281 | 3300047444 | Ga0495675_0057553 | Ga0495675_0057553_32_835 | 251 |
| 282 | 3300047444 | Ga0495675_0203795 | Ga0495675_0203795_122_928 | 251 |
| 283 | 3300005347 | Ga0070668_100094850 | Ga0070668_1000948501 | 252 |
| 284 | 3300009093 | Ga0105240_10164819 | Ga0105240_101648192 | 252 |
| 285 | 3300009545 | Ga0105237_10262288 | Ga0105237_102622882 | 252 |
| 286 | 3300025261 | Ga0209233_1001450 | Ga0209233_10014503 | 252 |
| 287 | 3300025904 | Ga0207647_10198850 | Ga0207647_101988501 | 252 |
| 288 | 3300025914 | Ga0207671_10287337 | Ga0207671_102873372 | 252 |
| 289 | 3300033180 | Ga0307510_10216305 | Ga0307510_102163052 | 252 |
| 290 | 3300046528 | Ga0495642_0129090 | Ga0495642_0129090_137_940 | 252 |
| 291 | 3300005471 | Ga0070698_100001024 | Ga0070698_10000102411 | 253 |
| 292 | 3300006028 | Ga0070717_10047098 | Ga0070717_100470982 | 253 |
| 293 | 3300025915 | Ga0207693_10034229 | Ga0207693_100342293 | 253 |
| 294 | 3300035119 | Ga0373956_0045458 | Ga0373956_0045458_567_1409 | 253 |
| 295 | 3300035724 | Ga0373933_0000621 | Ga0373933_0000621_5244_6086 | 253 |
| 296 | 3300036401 | Ga0373937_0001927 | Ga0373937_0001927_2879_3721 | 253 |
| 297 | 3300046462 | Ga0495651_0001109 | Ga0495651_0001109_6055_6897 | 253 |
| 298 | 3300046463 | Ga0495653_0070134 | Ga0495653_0070134_1385_2227 | 253 |
| 299 | 3300046536 | Ga0495587_0008576 | Ga0495587_0008576_3686_4528 | 253 |
| 300 | 3300046679 | Ga0495623_0007196 | Ga0495623_0007196_95_937 | 253 |
| 301 | 3300048088 | Ga0495602_0001118 | Ga0495602_0001118_16017_16859 | 253 |
| 302 | 3300048929 | Ga0496126_0006879 | Ga0496126_0006879_7777_8595 | 253 |
| 303 | 3300003659 | JGI25404J52841_10027318 | JGI25404J52841_100273181 | 254 |
| 304 | 3300004799 | Ga0058863_11907544 | Ga0058863_119075441 | 254 |
| 305 | 3300004800 | Ga0058861_11969837 | Ga0058861_119698372 | 254 |
| 306 | 3300004800 | Ga0058861_12014651 | Ga0058861_120146511 | 254 |
| 307 | 3300004803 | Ga0058862_12827812 | Ga0058862_128278121 | 254 |
| 308 | 3300004803 | Ga0058862_12854581 | Ga0058862_128545812 | 254 |
| 309 | 3300005327 | Ga0070658_10261902 | Ga0070658_102619021 | 254 |
| 310 | 3300005328 | Ga0070676_10018046 | Ga0070676_100180462 | 254 |
| 311 | 3300005329 | Ga0070683_100187501 | Ga0070683_1001875012 | 254 |
| 312 | 3300005331 | Ga0070670_100010900 | Ga0070670_1000109002 | 254 |
| 313 | 3300005333 | Ga0070677_10077523 | Ga0070677_100775232 | 254 |
| 314 | 3300005334 | Ga0068869_100062533 | Ga0068869_1000625332 | 254 |
| 315 | 3300005335 | Ga0070666_10025215 | Ga0070666_100252152 | 254 |
| 316 | 3300005335 | Ga0070666_10054158 | Ga0070666_100541582 | 254 |
| 317 | 3300005336 | Ga0070680_100018222 | Ga0070680_1000182223 | 254 |
| 318 | 3300005338 | Ga0068868_100015271 | Ga0068868_1000152713 | 254 |
| 319 | 3300005339 | Ga0070660_100019765 | Ga0070660_1000197652 | 254 |
| 320 | 3300005341 | Ga0070691_10099751 | Ga0070691_100997512 | 254 |
| 321 | 3300005341 | Ga0070691_10206620 | Ga0070691_102066202 | 254 |
| 322 | 3300005344 | Ga0070661_100135256 | Ga0070661_1001352562 | 254 |
| 323 | 3300005347 | Ga0070668_100035497 | Ga0070668_1000354974 | 254 |
| 324 | 3300005347 | Ga0070668_100155452 | Ga0070668_1001554522 | 254 |
| 325 | 3300005354 | Ga0070675_100012874 | Ga0070675_1000128745 | 254 |
| 326 | 3300005355 | Ga0070671_100007646 | Ga0070671_1000076467 | 254 |
| 327 | 3300005355 | Ga0070671_100222123 | Ga0070671_1002221232 | 254 |
| 328 | 3300005364 | Ga0070673_100023631 | Ga0070673_1000236312 | 254 |
| 329 | 3300005367 | Ga0070667_100030654 | Ga0070667_1000306543 | 254 |
| 330 | 3300005435 | Ga0070714_100000992 | Ga0070714_10000099210 | 254 |
| 331 | 3300005435 | Ga0070714_100092771 | Ga0070714_1000927711 | 254 |
| 332 | 3300005436 | Ga0070713_100002621 | Ga0070713_1000026212 | 254 |
| 333 | 3300005436 | Ga0070713_100409098 | Ga0070713_1004090982 | 254 |
| 334 | 3300005436 | Ga0070713_100434904 | Ga0070713_1004349041 | 254 |
| 335 | 3300005436 | Ga0070713_100500918 | Ga0070713_1005009181 | 254 |
| 336 | 3300005457 | Ga0070662_100086679 | Ga0070662_1000866792 | 254 |
| 337 | 3300005458 | Ga0070681_10009661 | Ga0070681_100096616 | 254 |
| 338 | 3300005459 | Ga0068867_100289812 | Ga0068867_1002898121 | 254 |
| 339 | 3300005530 | Ga0070679_100008336 | Ga0070679_1000083366 | 254 |
| 340 | 3300005530 | Ga0070679_100039932 | Ga0070679_1000399322 | 254 |
| 341 | 3300005535 | Ga0070684_100133334 | Ga0070684_1001333342 | 254 |
| 342 | 3300005536 | Ga0070697_100503366 | Ga0070697_1005033661 | 254 |
| 343 | 3300005539 | Ga0068853_100114776 | Ga0068853_1001147762 | 254 |
| 344 | 3300005539 | Ga0068853_100340545 | Ga0068853_1003405451 | 254 |
| 345 | 3300005539 | Ga0068853_100733934 | Ga0068853_1007339341 | 254 |
| 346 | 3300005548 | Ga0070665_100049583 | Ga0070665_1000495832 | 254 |
| 347 | 3300005563 | Ga0068855_100027490 | Ga0068855_1000274905 | 254 |
| 348 | 3300005563 | Ga0068855_100156781 | Ga0068855_1001567812 | 254 |
| 349 | 3300005564 | Ga0070664_100220689 | Ga0070664_1002206891 | 254 |
| 350 | 3300005577 | Ga0068857_100044294 | Ga0068857_1000442942 | 254 |
| 351 | 3300005578 | Ga0068854_100020329 | Ga0068854_1000203294 | 254 |
| 352 | 3300005614 | Ga0068856_100057784 | Ga0068856_1000577842 | 254 |
| 353 | 3300005614 | Ga0068856_100067983 | Ga0068856_1000679833 | 254 |
| 354 | 3300005614 | Ga0068856_100168132 | Ga0068856_1001681322 | 254 |
| 355 | 3300005615 | Ga0070702_100102935 | Ga0070702_1001029352 | 254 |
| 356 | 3300005616 | Ga0068852_100014996 | Ga0068852_1000149963 | 254 |
| 357 | 3300005616 | Ga0068852_100056039 | Ga0068852_1000560391 | 254 |
| 358 | 3300005618 | Ga0068864_100089227 | Ga0068864_1000892272 | 254 |
| 359 | 3300005618 | Ga0068864_100187672 | Ga0068864_1001876722 | 254 |
| 360 | 3300005841 | Ga0068863_100033107 | Ga0068863_1000331073 | 254 |
| 361 | 3300005842 | Ga0068858_100052541 | Ga0068858_1000525412 | 254 |
| 362 | 3300005843 | Ga0068860_100133307 | Ga0068860_1001333072 | 254 |
| 363 | 3300005983 | Ga0081540_1002265 | Ga0081540_10022655 | 254 |
| 364 | 3300006028 | Ga0070717_10032582 | Ga0070717_100325822 | 254 |
| 365 | 3300006237 | Ga0097621_100047075 | Ga0097621_1000470752 | 254 |
| 366 | 3300006237 | Ga0097621_100478606 | Ga0097621_1004786062 | 254 |
| 367 | 3300006358 | Ga0068871_100199120 | Ga0068871_1001991201 | 254 |
| 368 | 3300006881 | Ga0068865_100023036 | Ga0068865_1000230362 | 254 |
| 369 | 3300009093 | Ga0105240_10069942 | Ga0105240_100699423 | 254 |
| 370 | 3300009093 | Ga0105240_10154791 | Ga0105240_101547912 | 254 |
| 371 | 3300009093 | Ga0105240_10338880 | Ga0105240_103388802 | 254 |
| 372 | 3300009093 | Ga0105240_10553479 | Ga0105240_105534792 | 254 |
| 373 | 3300009098 | Ga0105245_10020117 | Ga0105245_100201173 | 254 |
| 374 | 3300009148 | Ga0105243_10057968 | Ga0105243_100579681 | 254 |
| 375 | 3300009174 | Ga0105241_10109652 | Ga0105241_101096522 | 254 |
| 376 | 3300009176 | Ga0105242_10226003 | Ga0105242_102260032 | 254 |
| 377 | 3300009177 | Ga0105248_10076909 | Ga0105248_100769092 | 254 |
| 378 | 3300009177 | Ga0105248_10273541 | Ga0105248_102735412 | 254 |
| 379 | 3300009545 | Ga0105237_10041655 | Ga0105237_100416552 | 254 |
| 380 | 3300009545 | Ga0105237_10145564 | Ga0105237_101455642 | 254 |
| 381 | 3300009551 | Ga0105238_10014800 | Ga0105238_100148005 | 254 |
| 382 | 3300009551 | Ga0105238_10046614 | Ga0105238_100466143 | 254 |
| 383 | 3300009551 | Ga0105238_10100814 | Ga0105238_101008142 | 254 |
| 384 | 3300009553 | Ga0105249_10053953 | Ga0105249_100539532 | 254 |
| 385 | 3300010375 | Ga0105239_10168437 | Ga0105239_101684372 | 254 |
| 386 | 3300013102 | Ga0157371_10038123 | Ga0157371_100381232 | 254 |
| 387 | 3300013104 | Ga0157370_10002599 | Ga0157370_100025995 | 254 |
| 388 | 3300013104 | Ga0157370_10026916 | Ga0157370_100269164 | 254 |
| 389 | 3300013105 | Ga0157369_10036249 | Ga0157369_100362492 | 254 |
| 390 | 3300013105 | Ga0157369_10056657 | Ga0157369_100566572 | 254 |
| 391 | 3300013105 | Ga0157369_10234682 | Ga0157369_102346822 | 254 |
| 392 | 3300013296 | Ga0157374_10000387 | Ga0157374_1000038716 | 254 |
| 393 | 3300013296 | Ga0157374_10097703 | Ga0157374_100977032 | 254 |
| 394 | 3300013296 | Ga0157374_10175292 | Ga0157374_101752922 | 254 |
| 395 | 3300013296 | Ga0157374_10178934 | Ga0157374_101789342 | 254 |
| 396 | 3300013297 | Ga0157378_10006432 | Ga0157378_100064323 | 254 |
| 397 | 3300013306 | Ga0163162_10385747 | Ga0163162_103857472 | 254 |
| 398 | 3300013307 | Ga0157372_10010004 | Ga0157372_100100043 | 254 |
| 399 | 3300013307 | Ga0157372_10013591 | Ga0157372_100135915 | 254 |
| 400 | 3300013307 | Ga0157372_10019755 | Ga0157372_100197552 | 254 |
| 401 | 3300013308 | Ga0157375_10145975 | Ga0157375_101459752 | 254 |
| 402 | 3300014325 | Ga0163163_10001209 | Ga0163163_100012094 | 254 |
| 403 | 3300014968 | Ga0157379_10060117 | Ga0157379_100601173 | 254 |
| 404 | 3300014969 | Ga0157376_10050457 | Ga0157376_100504572 | 254 |
| 405 | 3300017792 | Ga0163161_10207752 | Ga0163161_102077521 | 254 |
| 406 | 3300020069 | Ga0197907_10508567 | Ga0197907_105085672 | 254 |
| 407 | 3300020070 | Ga0206356_10135058 | Ga0206356_101350582 | 254 |
| 408 | 3300020077 | Ga0206351_10143000 | Ga0206351_101430001 | 254 |
| 409 | 3300020078 | Ga0206352_10850448 | Ga0206352_108504482 | 254 |
| 410 | 3300020078 | Ga0206352_11098780 | Ga0206352_110987802 | 254 |
| 411 | 3300020080 | Ga0206350_11177540 | Ga0206350_111775401 | 254 |
| 412 | 3300020081 | Ga0206354_10784727 | Ga0206354_107847272 | 254 |
| 413 | 3300020610 | Ga0154015_1094687 | Ga0154015_10946872 | 254 |
| 414 | 3300020610 | Ga0154015_1686291 | Ga0154015_16862911 | 254 |
| 415 | 3300021361 | Ga0213872_10039473 | Ga0213872_100394732 | 254 |
| 416 | 3300025315 | Ga0207697_10025858 | Ga0207697_100258582 | 254 |
| 417 | 3300025898 | Ga0207692_10030827 | Ga0207692_100308272 | 254 |
| 418 | 3300025899 | Ga0207642_10092773 | Ga0207642_100927732 | 254 |
| 419 | 3300025901 | Ga0207688_10174670 | Ga0207688_101746701 | 254 |
| 420 | 3300025903 | Ga0207680_10074045 | Ga0207680_100740452 | 254 |
| 421 | 3300025903 | Ga0207680_10102534 | Ga0207680_101025341 | 254 |
| 422 | 3300025904 | Ga0207647_10024187 | Ga0207647_100241871 | 254 |
| 423 | 3300025904 | Ga0207647_10044541 | Ga0207647_100445412 | 254 |
| 424 | 3300025907 | Ga0207645_10057640 | Ga0207645_100576401 | 254 |
| 425 | 3300025909 | Ga0207705_10052394 | Ga0207705_100523942 | 254 |
| 426 | 3300025912 | Ga0207707_10169612 | Ga0207707_101696122 | 254 |
| 427 | 3300025913 | Ga0207695_10008245 | Ga0207695_1000824512 | 254 |
| 428 | 3300025913 | Ga0207695_10188417 | Ga0207695_101884172 | 254 |
| 429 | 3300025913 | Ga0207695_10214671 | Ga0207695_102146712 | 254 |
| 430 | 3300025914 | Ga0207671_10067484 | Ga0207671_100674841 | 254 |
| 431 | 3300025916 | Ga0207663_10129854 | Ga0207663_101298542 | 254 |
| 432 | 3300025917 | Ga0207660_10073419 | Ga0207660_100734193 | 254 |
| 433 | 3300025919 | Ga0207657_10021392 | Ga0207657_100213922 | 254 |
| 434 | 3300025919 | Ga0207657_10023865 | Ga0207657_100238653 | 254 |
| 435 | 3300025920 | Ga0207649_10088533 | Ga0207649_100885331 | 254 |
| 436 | 3300025921 | Ga0207652_10009932 | Ga0207652_100099322 | 254 |
| 437 | 3300025924 | Ga0207694_10054405 | Ga0207694_100544052 | 254 |
| 438 | 3300025924 | Ga0207694_10108005 | Ga0207694_101080051 | 254 |
| 439 | 3300025925 | Ga0207650_10068238 | Ga0207650_100682382 | 254 |
| 440 | 3300025927 | Ga0207687_10069369 | Ga0207687_100693691 | 254 |
| 441 | 3300025928 | Ga0207700_10139428 | Ga0207700_101394282 | 254 |
| 442 | 3300025928 | Ga0207700_10326911 | Ga0207700_103269112 | 254 |
| 443 | 3300025928 | Ga0207700_10344491 | Ga0207700_103444912 | 254 |
| 444 | 3300025928 | Ga0207700_10510899 | Ga0207700_105108991 | 254 |
| 445 | 3300025929 | Ga0207664_10001747 | Ga0207664_100017477 | 254 |
| 446 | 3300025929 | Ga0207664_10411590 | Ga0207664_104115901 | 254 |
| 447 | 3300025931 | Ga0207644_10075752 | Ga0207644_100757522 | 254 |
| 448 | 3300025933 | Ga0207706_10005440 | Ga0207706_100054402 | 254 |
| 449 | 3300025940 | Ga0207691_10024517 | Ga0207691_100245174 | 254 |
| 450 | 3300025941 | Ga0207711_10085635 | Ga0207711_100856352 | 254 |
| 451 | 3300025941 | Ga0207711_10306596 | Ga0207711_103065962 | 254 |
| 452 | 3300025942 | Ga0207689_10028782 | Ga0207689_100287822 | 254 |
| 453 | 3300025944 | Ga0207661_10153675 | Ga0207661_101536751 | 254 |
| 454 | 3300025945 | Ga0207679_10192157 | Ga0207679_101921571 | 254 |
| 455 | 3300025949 | Ga0207667_10017436 | Ga0207667_100174365 | 254 |
| 456 | 3300025949 | Ga0207667_10024727 | Ga0207667_100247272 | 254 |
| 457 | 3300025960 | Ga0207651_10259685 | Ga0207651_102596851 | 254 |
| 458 | 3300025972 | Ga0207668_10094991 | Ga0207668_100949912 | 254 |
| 459 | 3300025972 | Ga0207668_10187549 | Ga0207668_101875492 | 254 |
| 460 | 3300025981 | Ga0207640_10092806 | Ga0207640_100928062 | 254 |
| 461 | 3300025981 | Ga0207640_10261131 | Ga0207640_102611312 | 254 |
| 462 | 3300025986 | Ga0207658_10434717 | Ga0207658_104347171 | 254 |
| 463 | 3300026023 | Ga0207677_10173171 | Ga0207677_101731712 | 254 |
| 464 | 3300026035 | Ga0207703_10263616 | Ga0207703_102636162 | 254 |
| 465 | 3300026041 | Ga0207639_10263905 | Ga0207639_102639052 | 254 |
| 466 | 3300026041 | Ga0207639_10275900 | Ga0207639_102759001 | 254 |
| 467 | 3300026041 | Ga0207639_10887773 | Ga0207639_108877731 | 254 |
| 468 | 3300026067 | Ga0207678_10047742 | Ga0207678_100477422 | 254 |
| 469 | 3300026078 | Ga0207702_10134998 | Ga0207702_101349982 | 254 |
| 470 | 3300026088 | Ga0207641_10005669 | Ga0207641_100056693 | 254 |
| 471 | 3300026088 | Ga0207641_10076186 | Ga0207641_100761862 | 254 |
| 472 | 3300026095 | Ga0207676_10045029 | Ga0207676_100450292 | 254 |
| 473 | 3300026095 | Ga0207676_10248995 | Ga0207676_102489952 | 254 |
| 474 | 3300026116 | Ga0207674_10036599 | Ga0207674_100365992 | 254 |
| 475 | 3300026118 | Ga0207675_100349539 | Ga0207675_1003495392 | 254 |
| 476 | 3300026121 | Ga0207683_10003440 | Ga0207683_100034405 | 254 |
| 477 | 3300026142 | Ga0207698_10311426 | Ga0207698_103114261 | 254 |
| 478 | 3300028379 | Ga0268266_10070403 | Ga0268266_100704032 | 254 |
| 479 | 3300028577 | Ga0265318_10016367 | Ga0265318_100163672 | 254 |
| 480 | 3300028666 | Ga0265336_10061547 | Ga0265336_100615471 | 254 |
| 481 | 3300028800 | Ga0265338_10007585 | Ga0265338_100075858 | 254 |
| 482 | 3300028800 | Ga0265338_10162437 | Ga0265338_101624372 | 254 |
| 483 | 3300031090 | Ga0265760_10042896 | Ga0265760_100428962 | 254 |
| 484 | 3300031235 | Ga0265330_10011707 | Ga0265330_100117072 | 254 |
| 485 | 3300031241 | Ga0265325_10001059 | Ga0265325_100010598 | 254 |
| 486 | 3300031241 | Ga0265325_10006713 | Ga0265325_100067134 | 254 |
| 487 | 3300031241 | Ga0265325_10178481 | Ga0265325_101784811 | 254 |
| 488 | 3300031249 | Ga0265339_10037533 | Ga0265339_100375333 | 254 |
| 489 | 3300031249 | Ga0265339_10061609 | Ga0265339_100616092 | 254 |
| 490 | 3300031250 | Ga0265331_10086404 | Ga0265331_100864042 | 254 |
| 491 | 3300031344 | Ga0265316_10049157 | Ga0265316_100491572 | 254 |
| 492 | 3300031344 | Ga0265316_10269498 | Ga0265316_102694981 | 254 |
| 493 | 3300031711 | Ga0265314_10000055 | Ga0265314_10000055118 | 254 |
| 494 | 3300031712 | Ga0265342_10001832 | Ga0265342_1000183210 | 254 |
| 495 | 3300033180 | Ga0307510_10040310 | Ga0307510_100403102 | 254 |
| 496 | 3300035692 | Ga0373935_0296511 | Ga0373935_0296511_73_879 | 254 |
| 497 | 3300035692 | Ga0373935_0378205 | Ga0373935_0378205_110_910 | 254 |
| 498 | 3300036401 | Ga0373937_0001985 | Ga0373937_0001985_11772_12572 | 254 |
| 499 | 3300036401 | Ga0373937_0106613 | Ga0373937_0106613_1531_2331 | 254 |
| 500 | 3300037466 | Ga0395898_0755351 | Ga0395898_0755351_35_832 | 254 |
| 501 | 3300039447 | Ga0436361_0350943 | Ga0436361_0350943_3442_4245 | 254 |
| 502 | 3300039450 | Ga0436363_0237435 | Ga0436363_0237435_642_1448 | 254 |
| 503 | 3300046455 | Ga0495603_0008247 | Ga0495603_0008247_49_855 | 254 |
| 504 | 3300046459 | Ga0495629_0002270 | Ga0495629_0002270_10078_10878 | 254 |
| 505 | 3300046459 | Ga0495629_0003365 | Ga0495629_0003365_4012_4818 | 254 |
| 506 | 3300046463 | Ga0495653_0218892 | Ga0495653_0218892_465_1265 | 254 |
| 507 | 3300046471 | Ga0495650_0020899 | Ga0495650_0020899_1583_2386 | 254 |
| 508 | 3300046472 | Ga0495580_0166828 | Ga0495580_0166828_44_841 | 254 |
| 509 | 3300046472 | Ga0495580_0409445 | Ga0495580_0409445_53_856 | 254 |
| 510 | 3300046473 | Ga0495582_0012856 | Ga0495582_0012856_81_887 | 254 |
| 511 | 3300046473 | Ga0495582_0027443 | Ga0495582_0027443_2162_2971 | 254 |
| 512 | 3300046473 | Ga0495582_0174348 | Ga0495582_0174348_373_1173 | 254 |
| 513 | 3300046475 | Ga0495639_0004247 | Ga0495639_0004247_1352_2158 | 254 |
| 514 | 3300046477 | Ga0495664_0001028 | Ga0495664_0001028_6637_7443 | 254 |
| 515 | 3300046477 | Ga0495664_0044105 | Ga0495664_0044105_761_1564 | 254 |
| 516 | 3300046499 | Ga0495594_0000369 | Ga0495594_0000369_4216_5019 | 254 |
| 517 | 3300046499 | Ga0495594_0002282 | Ga0495594_0002282_2011_2820 | 254 |
| 518 | 3300046506 | Ga0495583_0022439 | Ga0495583_0022439_384_1187 | 254 |
| 519 | 3300046506 | Ga0495583_0028612 | Ga0495583_0028612_669_1472 | 254 |
| 520 | 3300046511 | Ga0495608_0158674 | Ga0495608_0158674_207_1016 | 254 |
| 521 | 3300046516 | Ga0495628_0003864 | Ga0495628_0003864_12017_12823 | 254 |
| 522 | 3300046518 | Ga0495631_0058794 | Ga0495631_0058794_622_1425 | 254 |
| 523 | 3300046523 | Ga0495644_0000023 | Ga0495644_0000023_73279_74082 | 254 |
| 524 | 3300046526 | Ga0495666_0003659 | Ga0495666_0003659_29_835 | 254 |
| 525 | 3300046529 | Ga0495652_0015495 | Ga0495652_0015495_697_1503 | 254 |
| 526 | 3300046529 | Ga0495652_0089976 | Ga0495652_0089976_1148_1948 | 254 |
| 527 | 3300046531 | Ga0495665_0035376 | Ga0495665_0035376_231_1037 | 254 |
| 528 | 3300046531 | Ga0495665_0070153 | Ga0495665_0070153_167_967 | 254 |
| 529 | 3300046535 | Ga0495586_0040796 | Ga0495586_0040796_692_1498 | 254 |
| 530 | 3300046536 | Ga0495587_0139684 | Ga0495587_0139684_519_1319 | 254 |
| 531 | 3300046543 | Ga0495645_0007260 | Ga0495645_0007260_4889_5692 | 254 |
| 532 | 3300046543 | Ga0495645_0015846 | Ga0495645_0015846_465_1271 | 254 |
| 533 | 3300046543 | Ga0495645_0027121 | Ga0495645_0027121_234_1034 | 254 |
| 534 | 3300046558 | Ga0495633_0038163 | Ga0495633_0038163_933_1736 | 254 |
| 535 | 3300046559 | Ga0495667_0052135 | Ga0495667_0052135_1872_2678 | 254 |
| 536 | 3300046616 | Ga0495668_0291491 | Ga0495668_0291491_55_858 | 254 |
| 537 | 3300046642 | Ga0495634_0017226 | Ga0495634_0017226_462_1268 | 254 |
| 538 | 3300046660 | Ga0495625_0000796 | Ga0495625_0000796_21021_21824 | 254 |
| 539 | 3300046660 | Ga0495625_0053725 | Ga0495625_0053725_487_1290 | 254 |
| 540 | 3300046660 | Ga0495625_0083329 | Ga0495625_0083329_497_1300 | 254 |
| 541 | 3300046678 | Ga0495599_0036136 | Ga0495599_0036136_1794_2600 | 254 |
| 542 | 3300046679 | Ga0495623_0007967 | Ga0495623_0007967_502_1308 | 254 |
| 543 | 3300046679 | Ga0495623_0152596 | Ga0495623_0152596_415_1218 | 254 |
| 544 | 3300046680 | Ga0495646_0101057 | Ga0495646_0101057_802_1602 | 254 |
| 545 | 3300046684 | Ga0495669_0002280 | Ga0495669_0002280_5893_6696 | 254 |
| 546 | 3300046684 | Ga0495669_0076008 | Ga0495669_0076008_338_1135 | 254 |
| 547 | 3300046689 | Ga0495613_0007057 | Ga0495613_0007057_7451_8257 | 254 |
| 548 | 3300046689 | Ga0495613_0021250 | Ga0495613_0021250_3926_4735 | 254 |
| 549 | 3300046689 | Ga0495613_0235990 | Ga0495613_0235990_254_1051 | 254 |
| 550 | 3300046690 | Ga0495624_0002205 | Ga0495624_0002205_8355_9161 | 254 |
| 551 | 3300046694 | Ga0495649_0037809 | Ga0495649_0037809_1752_2555 | 254 |
| 552 | 3300046794 | Ga0495589_0186306 | Ga0495589_0186306_22_825 | 254 |
| 553 | 3300047315 | Ga0495581_0007694 | Ga0495581_0007694_5323_6129 | 254 |
| 554 | 3300047315 | Ga0495581_0041552 | Ga0495581_0041552_106_915 | 254 |
| 555 | 3300047317 | Ga0495604_0003709 | Ga0495604_0003709_4130_4936 | 254 |
| 556 | 3300047319 | Ga0495674_0055844 | Ga0495674_0055844_804_1610 | 254 |
| 557 | 3300047320 | Ga0495672_0001628 | Ga0495672_0001628_4680_5474 | 254 |
| 558 | 3300047321 | Ga0495676_0018292 | Ga0495676_0018292_1600_2406 | 254 |
| 559 | 3300047322 | Ga0495680_0087536 | Ga0495680_0087536_105_911 | 254 |
| 560 | 3300047444 | Ga0495675_0001719 | Ga0495675_0001719_7036_7842 | 254 |
| 561 | 3300047445 | Ga0495677_0003312 | Ga0495677_0003312_4920_5723 | 254 |
| 562 | 3300047469 | Ga0495673_0064222 | Ga0495673_0064222_46_849 | 254 |
| 563 | 3300047471 | Ga0495684_0006046 | Ga0495684_0006046_1835_2641 | 254 |
| 564 | 3300047472 | Ga0495686_0000006 | Ga0495686_0000006_516118_516921 | 254 |
| 565 | 3300047472 | Ga0495686_0002195 | Ga0495686_0002195_17731_18534 | 254 |
| 566 | 3300047472 | Ga0495686_0061295 | Ga0495686_0061295_778_1581 | 254 |
| 567 | 3300047673 | Ga0495593_0105283 | Ga0495593_0105283_105_914 | 254 |
| 568 | 3300048088 | Ga0495602_0186272 | Ga0495602_0186272_247_1047 | 254 |
| 569 | 3300048089 | Ga0495614_0003927 | Ga0495614_0003927_5323_6129 | 254 |
| 570 | 3300048907 | Ga0496104_0000072 | Ga0496104_0000072_62788_63591 | 254 |
| 571 | 3300048907 | Ga0496104_0116459 | Ga0496104_0116459_459_1256 | 254 |
| 572 | 3300048908 | Ga0496105_0146883 | Ga0496105_0146883_1102_1902 | 254 |
| 573 | 3300048909 | Ga0496106_0059518 | Ga0496106_0059518_1332_2129 | 254 |
| 574 | 3300048916 | Ga0496113_0298407 | Ga0496113_0298407_369_1166 | 254 |
| 575 | 3300048917 | Ga0496114_0514061 | Ga0496114_0514061_238_1035 | 254 |
| 576 | 3300048918 | Ga0496115_0087509 | Ga0496115_0087509_363_1160 | 254 |
| 577 | 3300048918 | Ga0496115_0185310 | Ga0496115_0185310_272_1072 | 254 |
| 578 | 3300048922 | Ga0496119_0201759 | Ga0496119_0201759_66_869 | 254 |
| 579 | 3300048929 | Ga0496126_0000085 | Ga0496126_0000085_105935_106738 | 254 |
| 580 | 3300048929 | Ga0496126_0000820 | Ga0496126_0000820_28808_29611 | 254 |
| 581 | 3300048929 | Ga0496126_0047495 | Ga0496126_0047495_2190_2993 | 254 |
| 582 | 3300053119 | Ga0500595_003197 | Ga0500595_003197_2989_3792 | 254 |
| 583 | 3300055283 | Ga0500661_000537 | Ga0500661_000537_1925_2728 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.7574 | 44 | 252 |
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.7477 | 44 | 252 |
| 1ohp-assembly2.cif.gz_C | crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione | 0.7377 | 195 | 219 |
| 7qd2-assembly1.cif.gz_C | structure of the orange carotenoid protein from planktothrix agardhii binding canthaxanthin in the p21 space group | 0.7341 | 195 | 218 |
| 5hgr-assembly1.cif.gz_A | structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin | 0.7269 | 195 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4k1uB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7708 | 195 | 216 | 3.10.450.50 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.7295 | 44 | 252 | 3.40.50.12140 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.7193 | 44 | 252 | 3.40.50.12140 |
| 3ir7A07 | Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 | 0.652 | 94 | 142 | 3.40.228.10 |
| af_Q9UBY9_66_163_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6479 | 198 | 216 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257VSL0-F1-model_v4 | DUF4159 domain-containing protein | 0.933 | 89 | 164 |
|
| AF-A0A2U3L1S4-F1-model_v4 | DUF4159 domain-containing protein | 0.9097 | 64 | 254 |
|
| AF-A0A7Y2ZFZ7-F1-model_v4 | DUF4159 domain-containing protein | 0.9053 | 59 | 254 |
|
| AF-A0A2V8GRD5-F1-model_v4 | Transmembrane prediction | 0.9041 | 59 | 254 |
|
| AF-A0A2N9N5R4-F1-model_v4 | DUF4159 domain-containing protein | 0.8957 | 59 | 254 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar