F466302

General Info

Members Datasets Scaffolds Average Seq Length
583 302 1166 260

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0035524|Ga0495610_0035524_111_980
Length 289
Sequence LVNSNVCFTTAHSRKNNDKEEAVDTSLVTTEIREGYRVLTLNRPDRLNSFSAAMHAELMAALVAAEADTSCRALLLTGAGRGFCAGQDLADPAVAPDLTPGAKPTDVGNVIERFYKPLALRLRAMPIPVIAAVNGVAAGAGASIALGCDMVIAARSASFIQAFSKIGLVPDAGGTWLLPRLVGRANALALAMTGDKLSADDAQRMGLIWKCVDDAAFTDEVSTTAARLAAMPVKALAATRAVIDASAQLSYADALSLEGEWQSRLSASHDYLEGVAAFLAKRPATFSDR

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
149 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
193 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
288 2643221569 Achromobacter sp. Root565 Isolate Unclassified
289 2643221594 Achromobacter sp. Root170 Isolate Unclassified
290 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
291 2643221609 Acidovorax sp. Root217 Isolate Unclassified
292 2643221611 Acidovorax sp. Root219 Isolate Unclassified
293 2643221621 Achromobacter sp. Root83 Isolate Unclassified
294 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
295 2643221660 Methylibium sp. Root1272 Isolate Unclassified
296 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
297 2816332133 Acidovorax radicis 2721A Isolate Unclassified
298 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
299 2858950400 Achromobacter sp. K91 Isolate Unclassified
300 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
301 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
302 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0.34
Rhizoplane 1.37
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0035524 3300046512 Bacteria 2558
2 rootL2_10011839 3300003322 Bacteria 2378
3 Ga0055529_1000970 3300003763 Bacteria 14586
4 Ga0070676_10004590 3300005328 Bacteria 7280
5 Ga0070676_10009109 3300005328 Bacteria 5369
6 Ga0070676_10060916 3300005328 Bacteria 2242
7 Ga0070676_10104959 3300005328 Bacteria 1751
8 Ga0070676_10236586 3300005328 Bacteria 1213
9 Ga0070683_100170703 3300005329 Bacteria 2064
10 Ga0070690_100216120 3300005330 Bacteria 1341
11 Ga0070670_100003540 3300005331 Bacteria 12986
12 Ga0070670_100030342 3300005331 Bacteria 4656
13 Ga0070670_100039813 3300005331 Bacteria 4041
14 Ga0070670_100078217 3300005331 Bacteria 2841
15 Ga0070670_100154247 3300005331 Bacteria 1988
16 Ga0070670_100574006 3300005331 Bacteria 1008
17 Ga0070677_10009873 3300005333 Bacteria 3250
18 Ga0070677_10071266 3300005333 Bacteria 1463
19 Ga0068869_100058292 3300005334 Bacteria 2823
20 Ga0068869_100103617 3300005334 Bacteria 2156
21 Ga0068869_100215260 3300005334 Bacteria 1520
22 Ga0070666_10060734 3300005335 Bacteria 2558
23 Ga0068868_100023248 3300005338 Bacteria 4690
24 Ga0068868_100064919 3300005338 Bacteria 2899
25 Ga0068868_100075800 3300005338 Bacteria 2688
26 Ga0068868_100185742 3300005338 Bacteria 1727
27 Ga0070687_100099758 3300005343 Bacteria 1623
28 Ga0070661_100119433 3300005344 Bacteria 1973
29 Ga0070661_100301707 3300005344 Bacteria 1247
30 Ga0070668_100004039 3300005347 Bacteria 10856
31 Ga0070668_100010211 3300005347 Bacteria 6964
32 Ga0070668_100096386 3300005347 Bacteria 2338
33 Ga0070668_100269107 3300005347 Bacteria 1420
34 Ga0070669_100009428 3300005353 Bacteria 6951
35 Ga0070669_100040781 3300005353 Bacteria 3375
36 Ga0070669_100045564 3300005353 Bacteria 3196
37 Ga0070669_100073387 3300005353 Bacteria 2535
38 Ga0070675_100000968 3300005354 Bacteria 20525
39 Ga0070675_100051959 3300005354 Bacteria 3368
40 Ga0070675_100053171 3300005354 Bacteria 3330
41 Ga0070671_100003531 3300005355 Bacteria 12223
42 Ga0070671_100049480 3300005355 Bacteria 3497
43 Ga0070671_100077017 3300005355 Bacteria 2787
44 Ga0070674_100011101 3300005356 Bacteria 5470
45 Ga0070674_100015723 3300005356 Bacteria 4731
46 Ga0070674_100043910 3300005356 Bacteria 3043
47 Ga0070674_100052253 3300005356 Bacteria 2818
48 Ga0070674_100052928 3300005356 Bacteria 2801
49 Ga0070673_100003906 3300005364 Bacteria 9368
50 Ga0070673_100004627 3300005364 Bacteria 8724
51 Ga0070673_100163849 3300005364 Bacteria 1892
52 Ga0070673_100283936 3300005364 Bacteria 1453
53 Ga0070659_100075953 3300005366 Bacteria 2679
54 Ga0070659_100212422 3300005366 Bacteria 1595
55 Ga0070667_100033806 3300005367 Bacteria 4277
56 Ga0070667_100050187 3300005367 Bacteria 3516
57 Ga0070667_100052812 3300005367 Bacteria 3430
58 Ga0070667_100058139 3300005367 Bacteria 3269
59 Ga0070667_100086665 3300005367 Bacteria 2687
60 Ga0070667_100195856 3300005367 Bacteria 1791
61 Ga0070667_100369256 3300005367 Bacteria 1301
62 Ga0070667_100717555 3300005367 Bacteria 926
63 Ga0070713_100080286 3300005436 Bacteria 2781
64 Ga0070701_10084876 3300005438 Bacteria 1723
65 Ga0070700_100035579 3300005441 Bacteria 3015
66 Ga0070708_100276277 3300005445 Bacteria 1581
67 Ga0070663_100031220 3300005455 Bacteria 3660
68 Ga0070678_100005397 3300005456 Bacteria 7375
69 Ga0070678_100086435 3300005456 Bacteria 2392
70 Ga0070678_100272185 3300005456 Bacteria 1429
71 Ga0070662_100048626 3300005457 Bacteria 3055
72 Ga0068867_100002610 3300005459 Bacteria 12706
73 Ga0068867_100012813 3300005459 Bacteria 5933
74 Ga0068867_100047752 3300005459 Bacteria 3148
75 Ga0068867_100112111 3300005459 Bacteria 2097
76 Ga0070685_10330626 3300005466 Bacteria 1036
77 Ga0070706_100003542 3300005467 Bacteria 15348
78 Ga0070698_100150529 3300005471 Bacteria 2274
79 Ga0070699_100164192 3300005518 Bacteria 1967
80 Ga0070684_100430777 3300005535 Bacteria 1218
81 Ga0070672_100002849 3300005543 Bacteria 11093
82 Ga0070672_100010466 3300005543 Bacteria 6434
83 Ga0070672_100036184 3300005543 Bacteria 3759
84 Ga0070672_100092454 3300005543 Bacteria 2442
85 Ga0070672_100113678 3300005543 Bacteria 2209
86 Ga0070696_100003110 3300005546 Bacteria 11041
87 Ga0070665_100006913 3300005548 Bacteria 11529
88 Ga0070665_100025455 3300005548 Bacteria 5961
89 Ga0070665_100389898 3300005548 Bacteria 1400
90 Ga0070665_100771222 3300005548 Bacteria 974
91 Ga0070664_100307214 3300005564 Bacteria 1434
92 Ga0068857_100121642 3300005577 Bacteria 2350
93 Ga0068857_100383297 3300005577 Bacteria 1306
94 Ga0068857_100406967 3300005577 Bacteria 1267
95 Ga0068854_100120914 3300005578 Bacteria 1988
96 Ga0068856_100181045 3300005614 Bacteria 2120
97 Ga0068852_100247236 3300005616 Bacteria 1707
98 Ga0068859_100018309 3300005617 Bacteria 7042
99 Ga0068859_100073756 3300005617 Bacteria 3450
100 Ga0068859_100091539 3300005617 Bacteria 3092
101 Ga0068859_100121002 3300005617 Bacteria 2684
102 Ga0068864_100010268 3300005618 Bacteria 7732
103 Ga0068864_100055639 3300005618 Bacteria 3416
104 Ga0068864_100118256 3300005618 Bacteria 2366
105 Ga0068864_100122304 3300005618 Bacteria 2328
106 Ga0068864_100315586 3300005618 Bacteria 1467
107 Ga0068866_10028786 3300005718 Bacteria 2650
108 Ga0068861_100002798 3300005719 Bacteria 11463
109 Ga0068861_100008169 3300005719 Bacteria 7202
110 Ga0068851_10001307 3300005834 Bacteria 10851
111 Ga0068851_10058040 3300005834 Bacteria 1977
112 Ga0068851_10234962 3300005834 Bacteria 1034
113 Ga0068863_100007247 3300005841 Bacteria 10867
114 Ga0068863_100014591 3300005841 Bacteria 7564
115 Ga0068863_100022212 3300005841 Bacteria 6059
116 Ga0068863_100031218 3300005841 Bacteria 5085
117 Ga0068863_100033017 3300005841 Bacteria 4931
118 Ga0068863_100041906 3300005841 Bacteria 4351
119 Ga0068863_100054240 3300005841 Bacteria 3798
120 Ga0068858_100001501 3300005842 Bacteria 24053
121 Ga0068858_100014852 3300005842 Bacteria 7325
122 Ga0068858_100145986 3300005842 Bacteria 2222
123 Ga0068860_100000887 3300005843 Bacteria 33240
124 Ga0068860_100001383 3300005843 Bacteria 26323
125 Ga0068862_100003804 3300005844 Bacteria 12855
126 Ga0068862_100041402 3300005844 Bacteria 3919
127 Ga0075367_10050285 3300006178 Bacteria 2460
128 Ga0075366_10016865 3300006195 Bacteria 4199
129 Ga0097621_100013309 3300006237 Bacteria 6128
130 Ga0097621_100379163 3300006237 Bacteria 1263
131 Ga0075370_10093959 3300006353 Bacteria 1731
132 Ga0075370_10121926 3300006353 Bacteria 1518
133 Ga0068871_100043036 3300006358 Bacteria 3627
134 Ga0068871_100365582 3300006358 Bacteria 1279
135 Ga0068871_100482833 3300006358 Bacteria 1115
136 Ga0068871_100520716 3300006358 Bacteria 1074
137 Ga0075428_100020551 3300006844 Bacteria 7311
138 Ga0075428_100034174 3300006844 Bacteria 5609
139 Ga0075428_100035932 3300006844 Bacteria 5460
140 Ga0075431_100023575 3300006847 Bacteria 6299
141 Ga0075431_100026802 3300006847 Bacteria 5911
142 Ga0075433_10008299 3300006852 Bacteria 8280
143 Ga0075429_100021214 3300006880 Bacteria 5631
144 Ga0068865_100017925 3300006881 Bacteria 4561
145 Ga0068865_100043261 3300006881 Bacteria 3076
146 Ga0068865_100107372 3300006881 Bacteria 2053
147 Ga0068865_100213184 3300006881 Bacteria 1506
148 Ga0068865_100292811 3300006881 Bacteria 1300
149 Ga0097620_100018309 3300006931 Bacteria 7042
150 Ga0097620_100073756 3300006931 Bacteria 3450
151 Ga0097620_100091538 3300006931 Bacteria 3092
152 Ga0097620_100121007 3300006931 Bacteria 2684
153 Ga0079104_1007715 3300006946 Bacteria 3855
154 Ga0111539_10017029 3300009094 Bacteria 8996
155 Ga0105245_10071927 3300009098 Bacteria 3141
156 Ga0105245_10463696 3300009098 Bacteria 1277
157 Ga0105245_10698287 3300009098 Bacteria 1048
158 Ga0105247_10104332 3300009101 Bacteria 1816
159 Ga0114129_10044298 3300009147 Bacteria 6260
160 Ga0105243_10051938 3300009148 Bacteria 3244
161 Ga0105243_10118602 3300009148 Bacteria 2227
162 Ga0105241_10342665 3300009174 Bacteria 1295
163 Ga0105242_10072383 3300009176 Bacteria 2862
164 Ga0105242_10099151 3300009176 Bacteria 2466
165 Ga0105242_10342584 3300009176 Bacteria 1378
166 Ga0105248_10044692 3300009177 Bacteria 4968
167 Ga0105248_10053979 3300009177 Bacteria 4507
168 Ga0105248_10088842 3300009177 Bacteria 3478
169 Ga0105248_10134212 3300009177 Bacteria 2793
170 Ga0105248_10531267 3300009177 Bacteria 1327
171 Ga0105248_10738669 3300009177 Bacteria 1110
172 Ga0105237_10077421 3300009545 Bacteria 3315
173 Ga0105237_10211855 3300009545 Bacteria 1937
174 Ga0105238_10056685 3300009551 Bacteria 3930
175 Ga0105238_10241694 3300009551 Bacteria 1783
176 Ga0105249_10016954 3300009553 Bacteria 6463
177 Ga0105249_10561140 3300009553 Bacteria 1193
178 Ga0105246_10046791 3300011119 Bacteria 2952
179 Ga0157371_10211600 3300013102 Bacteria 1391
180 Ga0157370_10103811 3300013104 Bacteria 2660
181 Ga0157374_10388059 3300013296 Bacteria 1392
182 Ga0157374_10790492 3300013296 Bacteria 964
183 Ga0157378_10002940 3300013297 Bacteria 15150
184 Ga0157378_10174393 3300013297 Bacteria 2019
185 Ga0157378_10832349 3300013297 Bacteria 950
186 Ga0163162_10009038 3300013306 Bacteria 9685
187 Ga0163162_10156902 3300013306 Bacteria 2396
188 Ga0163162_10172071 3300013306 Bacteria 2290
189 Ga0163162_10348497 3300013306 Bacteria 1614
190 Ga0157375_10045415 3300013308 Bacteria 4275
191 Ga0157375_10077149 3300013308 Bacteria 3361
192 Ga0157375_10113828 3300013308 Bacteria 2807
193 Ga0157375_10273435 3300013308 Bacteria 1852
194 Ga0157375_10291216 3300013308 Bacteria 1796
195 Ga0157375_10814436 3300013308 Bacteria 1082
196 Ga0163163_10144317 3300014325 Bacteria 2423
197 Ga0163163_10246843 3300014325 Bacteria 1835
198 Ga0163163_10913788 3300014325 Bacteria 941
199 Ga0157380_10064520 3300014326 Bacteria 2940
200 Ga0157380_10078021 3300014326 Bacteria 2701
201 Ga0157380_10101086 3300014326 Bacteria 2402
202 Ga0157380_10617269 3300014326 Bacteria 1076
203 Ga0157380_10899910 3300014326 Bacteria 911
204 Ga0157379_10091558 3300014968 Bacteria 2728
205 Ga0157379_10176324 3300014968 Bacteria 1930
206 Ga0157379_10765113 3300014968 Bacteria 910
207 Ga0157376_10018173 3300014969 Bacteria 5382
208 Ga0157376_10048419 3300014969 Bacteria 3514
209 Ga0157376_10064677 3300014969 Bacteria 3086
210 Ga0157376_10099751 3300014969 Bacteria 2534
211 Ga0163161_10032563 3300017792 Bacteria 3723
212 Ga0163161_10181671 3300017792 Bacteria 1613
213 Ga0163161_10256007 3300017792 Bacteria 1366
214 Ga0213876_10102858 3300021384 Bacteria 1514
215 Ga0213871_10009898 3300021441 Bacteria 2148
216 Ga0209455_1000566 3300025272 Bacteria 24635
217 Ga0209676_1009602 3300025292 Bacteria 4152
218 Ga0209050_1005397 3300025298 Bacteria 8070
219 Ga0207697_10076530 3300025315 Bacteria 1406
220 Ga0207656_10004179 3300025321 Bacteria 5026
221 Ga0207682_10000207 3300025893 Bacteria 26681
222 Ga0207682_10034026 3300025893 Bacteria 2053
223 Ga0207688_10048803 3300025901 Bacteria 2365
224 Ga0207647_10141996 3300025904 Bacteria 1407
225 Ga0207645_10001642 3300025907 Bacteria 18222
226 Ga0207645_10003256 3300025907 Bacteria 12402
227 Ga0207645_10012366 3300025907 Bacteria 5791
228 Ga0207645_10031204 3300025907 Bacteria 3430
229 Ga0207645_10306430 3300025907 Bacteria 1058
230 Ga0207705_10206106 3300025909 Bacteria 1491
231 Ga0207684_10021243 3300025910 Bacteria 5542
232 Ga0207695_10026298 3300025913 Bacteria 6496
233 Ga0207662_10030867 3300025918 Bacteria 3113
234 Ga0207657_10208705 3300025919 Bacteria 1568
235 Ga0207646_10073512 3300025922 Bacteria 3054
236 Ga0207681_10043502 3300025923 Bacteria 3006
237 Ga0207681_10121812 3300025923 Bacteria 1914
238 Ga0207650_10003576 3300025925 Bacteria 10659
239 Ga0207650_10009488 3300025925 Bacteria 6650
240 Ga0207650_10043702 3300025925 Bacteria 3290
241 Ga0207650_10045594 3300025925 Bacteria 3226
242 Ga0207650_10629527 3300025925 Bacteria 903
243 Ga0207659_10002431 3300025926 Bacteria 11095
244 Ga0207659_10009509 3300025926 Bacteria 6079
245 Ga0207659_10017151 3300025926 Bacteria 4728
246 Ga0207659_10037827 3300025926 Bacteria 3353
247 Ga0207659_10120428 3300025926 Bacteria 2010
248 Ga0207687_10486668 3300025927 Bacteria 1028
249 Ga0207687_10595296 3300025927 Bacteria 931
250 Ga0207687_10631643 3300025927 Bacteria 905
251 Ga0207644_10001589 3300025931 Bacteria 14679
252 Ga0207644_10027999 3300025931 Bacteria 3897
253 Ga0207690_10184558 3300025932 Bacteria 1573
254 Ga0207706_10001508 3300025933 Bacteria 23112
255 Ga0207706_10032850 3300025933 Bacteria 4617
256 Ga0207686_10161849 3300025934 Bacteria 1569
257 Ga0207686_10350385 3300025934 Bacteria 1111
258 Ga0207686_10357182 3300025934 Bacteria 1102
259 Ga0207709_10073150 3300025935 Bacteria 2183
260 Ga0207709_10376947 3300025935 Bacteria 1078
261 Ga0207669_10023991 3300025937 Bacteria 3270
262 Ga0207669_10029166 3300025937 Bacteria 3047
263 Ga0207669_10036389 3300025937 Bacteria 2812
264 Ga0207669_10039938 3300025937 Bacteria 2717
265 Ga0207669_10044857 3300025937 Bacteria 2601
266 Ga0207704_10002656 3300025938 Bacteria 8071
267 Ga0207704_10451306 3300025938 Bacteria 1026
268 Ga0207704_10487739 3300025938 Bacteria 991
269 Ga0207691_10000127 3300025940 Bacteria 69355
270 Ga0207691_10000846 3300025940 Bacteria 30480
271 Ga0207691_10003752 3300025940 Bacteria 14739
272 Ga0207691_10013729 3300025940 Bacteria 7739
273 Ga0207691_10018677 3300025940 Bacteria 6567
274 Ga0207691_10045169 3300025940 Bacteria 4051
275 Ga0207691_10056758 3300025940 Bacteria 3566
276 Ga0207691_10121274 3300025940 Bacteria 2317
277 Ga0207711_10029923 3300025941 Bacteria 4593
278 Ga0207711_10042409 3300025941 Bacteria 3877
279 Ga0207711_10067651 3300025941 Bacteria 3093
280 Ga0207689_10048147 3300025942 Bacteria 3516
281 Ga0207689_10114295 3300025942 Bacteria 2219
282 Ga0207689_10137975 3300025942 Bacteria 2008
283 Ga0207661_10247635 3300025944 Bacteria 1583
284 Ga0207679_10290667 3300025945 Bacteria 1405
285 Ga0207651_10010844 3300025960 Bacteria 5071
286 Ga0207651_10033176 3300025960 Bacteria 3327
287 Ga0207651_10043856 3300025960 Bacteria 2988
288 Ga0207712_10031620 3300025961 Bacteria 3566
289 Ga0207712_10065389 3300025961 Bacteria 2595
290 Ga0207712_10322642 3300025961 Bacteria 1275
291 Ga0207640_10409670 3300025981 Bacteria 1106
292 Ga0207640_10470205 3300025981 Bacteria 1040
293 Ga0207658_10034200 3300025986 Bacteria 3630
294 Ga0207658_10087441 3300025986 Bacteria 2407
295 Ga0207658_10115526 3300025986 Bacteria 2130
296 Ga0207658_10269876 3300025986 Bacteria 1454
297 Ga0207658_10320471 3300025986 Bacteria 1341
298 Ga0207658_10334252 3300025986 Bacteria 1315
299 Ga0207677_10037715 3300026023 Bacteria 3161
300 Ga0207703_10000318 3300026035 Bacteria 52249
301 Ga0207703_10015668 3300026035 Bacteria 5912
302 Ga0207639_10123454 3300026041 Bacteria 2132
303 Ga0207678_10463234 3300026067 Bacteria 1103
304 Ga0207708_10037978 3300026075 Bacteria 3669
305 Ga0207708_10139170 3300026075 Bacteria 1903
306 Ga0207702_10059528 3300026078 Bacteria 3253
307 Ga0207641_10000721 3300026088 Bacteria 35497
308 Ga0207641_10008611 3300026088 Bacteria 8421
309 Ga0207641_10041711 3300026088 Bacteria 3847
310 Ga0207641_10081807 3300026088 Bacteria 2805
311 Ga0207641_10187746 3300026088 Bacteria 1897
312 Ga0207648_10000799 3300026089 Bacteria 35474
313 Ga0207648_10003102 3300026089 Bacteria 17547
314 Ga0207648_10017634 3300026089 Bacteria 6484
315 Ga0207648_10059758 3300026089 Bacteria 3325
316 Ga0207648_10088738 3300026089 Bacteria 2700
317 Ga0207648_10160206 3300026089 Bacteria 1987
318 Ga0207648_10223184 3300026089 Bacteria 1675
319 Ga0207648_10366587 3300026089 Bacteria 1300
320 Ga0207676_10098527 3300026095 Bacteria 2417
321 Ga0207676_10110071 3300026095 Bacteria 2303
322 Ga0207676_10111808 3300026095 Bacteria 2287
323 Ga0207676_10285128 3300026095 Bacteria 1501
324 Ga0207676_10585059 3300026095 Bacteria 1070
325 Ga0207674_10037482 3300026116 Bacteria 5042
326 Ga0207675_100000205 3300026118 Bacteria 54926
327 Ga0207675_100003220 3300026118 Bacteria 16019
328 Ga0207675_100012363 3300026118 Bacteria 7973
329 Ga0207675_100308285 3300026118 Bacteria 1543
330 Ga0207675_100318722 3300026118 Bacteria 1517
331 Ga0207683_10003804 3300026121 Bacteria 13074
332 Ga0207683_10008294 3300026121 Bacteria 8888
333 Ga0207683_10030377 3300026121 Bacteria 4682
334 Ga0207683_10039136 3300026121 Bacteria 4136
335 Ga0207683_10100452 3300026121 Bacteria 2583
336 Ga0207683_10238570 3300026121 Bacteria 1658
337 Ga0207683_10296538 3300026121 Bacteria 1479
338 Ga0207698_10170172 3300026142 Bacteria 1917
339 Ga0207698_10553696 3300026142 Bacteria 1128
340 Ga0209281_1004875 3300027111 Bacteria 3883
341 Ga0209371_1006575 3300027312 Bacteria 4270
342 Ga0209983_1000057 3300027665 Bacteria 16946
343 Ga0209998_10000641 3300027717 Bacteria 9378
344 Ga0209974_10010235 3300027876 Bacteria 3166
345 Ga0207428_10061282 3300027907 Bacteria 2979
346 Ga0207428_10163081 3300027907 Bacteria 1692
347 Ga0268266_10014568 3300028379 Bacteria 6756
348 Ga0268266_10039553 3300028379 Bacteria 4017
349 Ga0268266_10195253 3300028379 Bacteria 1850
350 Ga0268266_10242918 3300028379 Bacteria 1663
351 Ga0268265_10034022 3300028380 Bacteria 3711
352 Ga0268265_10039450 3300028380 Bacteria 3481
353 Ga0268265_10371914 3300028380 Bacteria 1312
354 Ga0268264_10000373 3300028381 Bacteria 65793
355 Ga0268264_10002625 3300028381 Bacteria 15693
356 Ga0268264_10099782 3300028381 Bacteria 2520
357 Ga0307517_10000052 3300028786 Bacteria 155904
358 Ga0307515_10000358 3300028794 Bacteria 112133
359 Ga0307515_10003504 3300028794 Bacteria 32990
360 Ga0307515_10017024 3300028794 Bacteria 13278
361 Ga0307515_10028554 3300028794 Bacteria 9479
362 Ga0307515_10104667 3300028794 Bacteria 3378
363 Ga0268256_1006625 3300030500 Bacteria 4270
364 Ga0307512_10012320 3300030522 Bacteria 8075
365 Ga0307513_10037344 3300031456 Bacteria 5407
366 Ga0307509_10002117 3300031507 Bacteria 32688
367 Ga0307509_10013408 3300031507 Bacteria 9709
368 Ga0307509_10024236 3300031507 Bacteria 6797
369 Ga0307509_10029302 3300031507 Bacteria 6112
370 Ga0307509_10216644 3300031507 Bacteria 1732
371 Ga0307509_10267057 3300031507 Bacteria 1481
372 Ga0307408_100124380 3300031548 Bacteria 2003
373 Ga0307408_100333935 3300031548 Bacteria 1281
374 Ga0307508_10000053 3300031616 Bacteria 128020
375 Ga0307508_10244006 3300031616 Bacteria 1393
376 Ga0307514_10009268 3300031649 Bacteria 8293
377 Ga0307514_10260914 3300031649 Bacteria 1014
378 Ga0307516_10034119 3300031730 Bacteria 5116
379 Ga0307405_10008662 3300031731 Bacteria 5171
380 Ga0307405_10142693 3300031731 Bacteria 1672
381 Ga0307413_10101936 3300031824 Bacteria 1899
382 Ga0307413_10152944 3300031824 Bacteria 1610
383 Ga0307413_10175090 3300031824 Bacteria 1523
384 Ga0307410_10013807 3300031852 Bacteria 4727
385 Ga0307410_10142019 3300031852 Bacteria 1777
386 Ga0307406_10066072 3300031901 Bacteria 2353
387 Ga0307407_10034564 3300031903 Bacteria 2769
388 Ga0307407_10162104 3300031903 Bacteria 1464
389 Ga0307412_10001167 3300031911 Bacteria 15025
390 Ga0307412_10013973 3300031911 Bacteria 4724
391 Ga0307412_10272645 3300031911 Bacteria 1325
392 Ga0307409_100095983 3300031995 Bacteria 2444
393 Ga0307409_100097537 3300031995 Bacteria 2428
394 Ga0307416_100001303 3300032002 Bacteria 13464
395 Ga0307416_100035126 3300032002 Bacteria 3824
396 Ga0307416_100039700 3300032002 Bacteria 3648
397 Ga0307416_100135747 3300032002 Bacteria 2225
398 Ga0307416_100542778 3300032002 Bacteria 1235
399 Ga0307416_100633299 3300032002 Bacteria 1152
400 Ga0307414_10015531 3300032004 Bacteria 4597
401 Ga0307414_10081091 3300032004 Bacteria 2375
402 Ga0307411_10017113 3300032005 Bacteria 4119
403 Ga0307411_10093622 3300032005 Bacteria 2104
404 Ga0307415_100005445 3300032126 Bacteria 6762
405 Ga0307415_100338432 3300032126 Bacteria 1262
406 Ga0307507_10136927 3300033179 Bacteria 1893
407 Ga0307507_10166568 3300033179 Bacteria 1613
408 Ga0307510_10001123 3300033180 Bacteria 28660
409 Ga0307510_10125131 3300033180 Bacteria 2262
410 Ga0307510_10254894 3300033180 Bacteria 1239
411 Ga0373939_0000239 3300035114 Bacteria 14843
412 Ga0373960_0001500 3300035121 Bacteria 5188
413 Ga0373931_0028290 3300035691 Bacteria 2868
414 Ga0373935_0507337 3300035692 Bacteria 876
415 Ga0373927_0031321 3300035695 Bacteria 3467
416 Ga0373937_0104007 3300036401 Bacteria 2638
417 Ga0373925_0003598 3300037068 Bacteria 11945
418 Ga0373925_0294504 3300037068 Bacteria 1309
419 Ga0395899_0087461 3300037312 Bacteria 2262
420 Ga0395900_0044064 3300037418 Bacteria 4599
421 Ga0395898_0041312 3300037466 Bacteria 4556
422 Ga0395905_0011306 3300037471 Bacteria 8631
423 Ga0436364_0804269 3300037853 Bacteria 3901
424 Ga0436365_0116034 3300039437 Bacteria 3825
425 Ga0436360_0217520 3300039438 Bacteria 3182
426 Ga0436363_0090351 3300039450 Bacteria 4290
427 Ga0436363_0818447 3300039450 Bacteria 743
428 Ga0439433_0014717 3300041999 Bacteria 1724
429 Ga0439442_005368 3300042002 Bacteria 2564
430 Ga0439445_0006810 3300042004 Bacteria 2635
431 Ga0439432_002542 3300042006 Bacteria 6875
432 Ga0439449_0006606 3300042007 Bacteria 4435
433 Ga0439452_008154 3300042010 Bacteria 3168
434 Ga0439462_0007813 3300042015 Bacteria 2684
435 Ga0450923_004013 3300042125 Bacteria 2278
436 Ga0450895_004569 3300042132 Bacteria 1095
437 Ga0450896_002017 3300042133 Bacteria 2585
438 Ga0439446_0021365 3300042156 Bacteria 1829
439 Ga0439434_0005056 3300042435 Bacteria 3856
440 Ga0439434_0095636 3300042435 Bacteria 953
441 Ga0439444_0004016 3300042437 Bacteria 2111
442 Ga0439460_0041366 3300042461 Bacteria 1354
443 Ga0451577_0003401 3300042876 Bacteria 17770
444 Ga0451577_0083821 3300042876 Bacteria 2844
445 Ga0451577_0397719 3300042876 Bacteria 1250
446 Ga0451576_0212818 3300045051 Bacteria 2018
447 Ga0451576_0259420 3300045051 Bacteria 1816
448 Ga0495592_0000370 3300046454 Bacteria 35460
449 Ga0495590_0018473 3300046457 Bacteria 2496
450 Ga0495590_0077918 3300046457 Bacteria 1166
451 Ga0495629_0133852 3300046459 Bacteria 1726
452 Ga0495641_0154252 3300046461 Bacteria 1027
453 Ga0495650_0004943 3300046471 Bacteria 8892
454 Ga0495606_0042220 3300046507 Bacteria 3052
455 Ga0495630_0226860 3300046517 Bacteria 1426
456 Ga0495632_0120244 3300046519 Bacteria 1228
457 Ga0495598_0015509 3300046537 Bacteria 1926
458 Ga0495621_0017012 3300046539 Bacteria 2343
459 Ga0495621_0129707 3300046539 Bacteria 980
460 Ga0495668_0120190 3300046616 Bacteria 1437
461 Ga0495658_0021511 3300046683 Bacteria 3401
462 Ga0495658_0046760 3300046683 Bacteria 2434
463 Ga0495624_0057406 3300046690 Bacteria 2447
464 Ga0495660_0087825 3300046810 Bacteria 1621
465 Ga0495674_0283840 3300047319 Bacteria 1356
466 Ga0495672_0033634 3300047320 Bacteria 3175
467 Ga0495676_0037805 3300047321 Bacteria 4014
468 Ga0495687_007340 3300047443 Bacteria 6515
469 Ga0495681_0134308 3300047470 Bacteria 1051
470 Ga0495684_0084233 3300047471 Bacteria 2412
471 Ga0495686_0013777 3300047472 Bacteria 5602
472 Ga0495593_0025281 3300047673 Bacteria 3286
473 Ga0495614_0087608 3300048089 Bacteria 1352
474 Ga0495614_0127394 3300048089 Bacteria 1125
475 Ga0496100_0259363 3300048903 Bacteria 1289
476 Ga0496102_0445177 3300048905 Bacteria 1215
477 Ga0496103_0161945 3300048906 Bacteria 1435
478 Ga0496108_0489606 3300048911 Bacteria 1074
479 Ga0496110_0026602 3300048913 Bacteria 4953
480 Ga0496114_0226734 3300048917 Bacteria 1641
481 Ga0496114_1049779 3300048917 Bacteria 699
482 Ga0496116_0008170 3300048919 Bacteria 9134
483 Ga0496116_0030720 3300048919 Bacteria 3855
484 Ga0496117_0022859 3300048920 Bacteria 5007
485 Ga0496118_0005781 3300048921 Bacteria 13889
486 Ga0496118_0032451 3300048921 Bacteria 4301
487 Ga0496119_0018081 3300048922 Bacteria 5266
488 Ga0496120_0063561 3300048923 Bacteria 2052
489 Ga0496121_0000314 3300048924 Bacteria 100909
490 Ga0496121_0025188 3300048924 Bacteria 5657
491 Ga0496122_0000046 3300048925 Bacteria 274640
492 Ga0496122_0038261 3300048925 Bacteria 3847
493 Ga0496123_0000082 3300048926 Bacteria 188909
494 Ga0496124_0254698 3300048927 Bacteria 1295
495 Ga0496125_0000028 3300048928 Bacteria 387222
496 Ga0496125_0000854 3300048928 Bacteria 48916
497 Ga0496125_0009558 3300048928 Bacteria 9941
498 Ga0496126_0021467 3300048929 Bacteria 6305
499 Ga0496126_0031548 3300048929 Bacteria 5004
500 Ga0496126_0035484 3300048929 Bacteria 4674
501 Ga0501032_0294285 3300049569 Bacteria 1050
502 Ga0501033_0022359 3300049570 Bacteria 4771
503 Ga0501034_0147189 3300049571 Bacteria 2332
504 Ga0501036_0001323 3300049572 Bacteria 19023
505 Ga0501038_0023395 3300049574 Bacteria 5524
506 Ga0501038_0031829 3300049574 Bacteria 4659
507 Ga0501039_0001406 3300049575 Bacteria 17703
508 Ga0501039_0032244 3300049575 Bacteria 4039
509 Ga0501040_0126635 3300049576 Bacteria 1794
510 Ga0501042_0007611 3300049578 Bacteria 7107
511 Ga0501043_0711032 3300049579 Bacteria 733
512 Ga0501046_0030231 3300049580 Bacteria 4398
513 Ga0501046_0172036 3300049580 Bacteria 1625
514 Ga0501047_0002464 3300049581 Bacteria 17651
515 Ga0501048_0017159 3300049582 Bacteria 5336
516 Ga0501068_0005693 3300049584 Bacteria 6824
517 Ga0501071_0026671 3300049587 Bacteria 4058
518 Ga0501074_0206344 3300049590 Bacteria 1400
519 Ga0501076_0003858 3300049592 Bacteria 10557
520 Ga0501076_0102992 3300049592 Bacteria 2302
521 Ga0501079_0295658 3300049741 Bacteria 1267
522 Ga0501081_0017702 3300049743 Bacteria 4722
523 Ga0501035_0008851 3300049822 Bacteria 9366
524 Ga0501035_0019386 3300049822 Bacteria 6256
525 Ga0501035_0029433 3300049822 Bacteria 5008
526 Ga0501044_0000022 3300049823 Bacteria 201689
527 Ga0501044_0040830 3300049823 Bacteria 4833
528 Ga0501044_0059324 3300049823 Bacteria 3920
529 Ga0501045_0012264 3300049824 Bacteria 6036
530 nmdc:mga06z11_252922_c1 3300050494 Bacteria 1038
531 nmdc:mga07m45_79236_c1 3300050496 Bacteria 1875
532 nmdc:mga05p37_43331_c1 3300050507 Bacteria 5536
533 nmdc:mga05p37_835647_c1 3300050507 Bacteria 1002
534 nmdc:mga09592_43177_c1 3300050508 Bacteria 3794
535 nmdc:mga06r32_102907_c1 3300050510 Bacteria 2804
536 nmdc:mga06r32_32080_c1 3300050510 Bacteria 4939
537 nmdc:mga08y16_222889_c1 3300050511 Bacteria 1952
538 nmdc:mga08y16_85784_c1 3300050511 Bacteria 3282
539 nmdc:mga0n895_2463_c1 3300050512 Bacteria 14477
540 nmdc:mga08x19_176731_c1 3300050514 Bacteria 1456
541 nmdc:mga0a205_2569_c1 3300050515 Bacteria 16006
542 Ga0500578_0011753 3300053086 Bacteria 5654
543 Ga0500643_000258 3300053087 Bacteria 47298
544 Ga0500651_0067977 3300053093 Bacteria 2219
545 Ga0500641_0000180 3300053096 Bacteria 23776
546 Ga0500650_0101848 3300053098 Bacteria 1343
547 Ga0500556_0010134 3300053104 Bacteria 2757
548 Ga0500557_058593 3300053105 Bacteria 1247
549 Ga0500607_071221 3300053121 Bacteria 1795
550 Ga0500652_074936 3300053131 Bacteria 1406
551 Ga0500652_077904 3300053131 Bacteria 1379
552 Ga0500658_0003162 3300053134 Bacteria 6280
553 Ga0500559_0000041 3300053136 Bacteria 104877
554 Ga0500568_0039618 3300053139 Bacteria 1901
555 Ga0500568_0089800 3300053139 Bacteria 1159
556 Ga0500616_0005445 3300053153 Bacteria 8637
557 Ga0500616_0008837 3300053153 Bacteria 6196
558 Ga0500622_0003555 3300053156 Bacteria 10302
559 Ga0500622_0003593 3300053156 Bacteria 10221
560 Ga0500622_0005836 3300053156 Bacteria 7292
561 Ga0500645_000789 3300053730 Bacteria 19068
562 Ga0500645_001374 3300053730 Bacteria 12490
563 Ga0500645_016606 3300053730 Bacteria 2316
564 Ga0501082_0005387 3300060353 Bacteria 11102
565 Ga0501082_0026969 3300060353 Bacteria 4949
566 Ga0501082_0414680 3300060353 Bacteria 1176
567 Ga0530510_0051497 3300061734 Bacteria 2975
568 2599906434 2599185292 Bacteria 6290804
569 2643862699 2643221569 Bacteria 6064337
570 2643980295 2643221594 Bacteria 5811388
571 2644028815 2643221603 Bacteria 6147767
572 2644061596 2643221609 Bacteria 6756331
573 2644075128 2643221611 Bacteria 6820941
574 2644121925 2643221621 Bacteria 6212786
575 2644304470 2643221654 Bacteria 5273570
576 2644341317 2643221660 Bacteria 4208257
577 2809032392 2808606395 Bacteria 6020352
578 2816473870 2816332133 Bacteria 7249298
579 2857542470 2857537821 Bacteria 5248181
580 2858952817 2858950400 Bacteria 6783797
581 2885195308 2885192300 Bacteria 5882526
582 2928116268 2928115317 Bacteria 6477646
583 2941485192
584 Ga0495610_0035524
585 rootL2_10011839
586 Ga0055529_1000970
587 Ga0070676_10004590
588 Ga0070676_10009109
589 Ga0070676_10060916
590 Ga0070676_10104959
591 Ga0070676_10236586
592 Ga0070683_100170703
593 Ga0070690_100216120
594 Ga0070670_100003540
595 Ga0070670_100030342
596 Ga0070670_100039813
597 Ga0070670_100078217
598 Ga0070670_100154247
599 Ga0070670_100574006
600 Ga0070677_10009873
601 Ga0070677_10071266
602 Ga0068869_100058292
603 Ga0068869_100103617
604 Ga0068869_100215260
605 Ga0070666_10060734
606 Ga0068868_100023248
607 Ga0068868_100064919
608 Ga0068868_100075800
609 Ga0068868_100185742
610 Ga0070687_100099758
611 Ga0070661_100119433
612 Ga0070661_100301707
613 Ga0070668_100004039
614 Ga0070668_100010211
615 Ga0070668_100096386
616 Ga0070668_100269107
617 Ga0070669_100009428
618 Ga0070669_100040781
619 Ga0070669_100045564
620 Ga0070669_100073387
621 Ga0070675_100000968
622 Ga0070675_100051959
623 Ga0070675_100053171
624 Ga0070671_100003531
625 Ga0070671_100049480
626 Ga0070671_100077017
627 Ga0070674_100011101
628 Ga0070674_100015723
629 Ga0070674_100043910
630 Ga0070674_100052253
631 Ga0070674_100052928
632 Ga0070673_100003906
633 Ga0070673_100004627
634 Ga0070673_100163849
635 Ga0070673_100283936
636 Ga0070659_100075953
637 Ga0070659_100212422
638 Ga0070667_100033806
639 Ga0070667_100050187
640 Ga0070667_100052812
641 Ga0070667_100058139
642 Ga0070667_100086665
643 Ga0070667_100195856
644 Ga0070667_100369256
645 Ga0070667_100717555
646 Ga0070713_100080286
647 Ga0070701_10084876
648 Ga0070700_100035579
649 Ga0070708_100276277
650 Ga0070663_100031220
651 Ga0070678_100005397
652 Ga0070678_100086435
653 Ga0070678_100272185
654 Ga0070662_100048626
655 Ga0068867_100002610
656 Ga0068867_100012813
657 Ga0068867_100047752
658 Ga0068867_100112111
659 Ga0070685_10330626
660 Ga0070706_100003542
661 Ga0070698_100150529
662 Ga0070699_100164192
663 Ga0070684_100430777
664 Ga0070672_100002849
665 Ga0070672_100010466
666 Ga0070672_100036184
667 Ga0070672_100092454
668 Ga0070672_100113678
669 Ga0070696_100003110
670 Ga0070665_100006913
671 Ga0070665_100025455
672 Ga0070665_100389898
673 Ga0070665_100771222
674 Ga0070664_100307214
675 Ga0068857_100121642
676 Ga0068857_100383297
677 Ga0068857_100406967
678 Ga0068854_100120914
679 Ga0068856_100181045
680 Ga0068852_100247236
681 Ga0068859_100018309
682 Ga0068859_100073756
683 Ga0068859_100091539
684 Ga0068859_100121002
685 Ga0068864_100010268
686 Ga0068864_100055639
687 Ga0068864_100118256
688 Ga0068864_100122304
689 Ga0068864_100315586
690 Ga0068866_10028786
691 Ga0068861_100002798
692 Ga0068861_100008169
693 Ga0068851_10001307
694 Ga0068851_10058040
695 Ga0068851_10234962
696 Ga0068863_100007247
697 Ga0068863_100014591
698 Ga0068863_100022212
699 Ga0068863_100031218
700 Ga0068863_100033017
701 Ga0068863_100041906
702 Ga0068863_100054240
703 Ga0068858_100001501
704 Ga0068858_100014852
705 Ga0068858_100145986
706 Ga0068860_100000887
707 Ga0068860_100001383
708 Ga0068862_100003804
709 Ga0068862_100041402
710 Ga0075367_10050285
711 Ga0075366_10016865
712 Ga0097621_100013309
713 Ga0097621_100379163
714 Ga0075370_10093959
715 Ga0075370_10121926
716 Ga0068871_100043036
717 Ga0068871_100365582
718 Ga0068871_100482833
719 Ga0068871_100520716
720 Ga0075428_100020551
721 Ga0075428_100034174
722 Ga0075428_100035932
723 Ga0075431_100023575
724 Ga0075431_100026802
725 Ga0075433_10008299
726 Ga0075429_100021214
727 Ga0068865_100017925
728 Ga0068865_100043261
729 Ga0068865_100107372
730 Ga0068865_100213184
731 Ga0068865_100292811
732 Ga0097620_100018309
733 Ga0097620_100073756
734 Ga0097620_100091538
735 Ga0097620_100121007
736 Ga0079104_1007715
737 Ga0111539_10017029
738 Ga0105245_10071927
739 Ga0105245_10463696
740 Ga0105245_10698287
741 Ga0105247_10104332
742 Ga0114129_10044298
743 Ga0105243_10051938
744 Ga0105243_10118602
745 Ga0105241_10342665
746 Ga0105242_10072383
747 Ga0105242_10099151
748 Ga0105242_10342584
749 Ga0105248_10044692
750 Ga0105248_10053979
751 Ga0105248_10088842
752 Ga0105248_10134212
753 Ga0105248_10531267
754 Ga0105248_10738669
755 Ga0105237_10077421
756 Ga0105237_10211855
757 Ga0105238_10056685
758 Ga0105238_10241694
759 Ga0105249_10016954
760 Ga0105249_10561140
761 Ga0105246_10046791
762 Ga0157371_10211600
763 Ga0157370_10103811
764 Ga0157374_10388059
765 Ga0157374_10790492
766 Ga0157378_10002940
767 Ga0157378_10174393
768 Ga0157378_10832349
769 Ga0163162_10009038
770 Ga0163162_10156902
771 Ga0163162_10172071
772 Ga0163162_10348497
773 Ga0157375_10045415
774 Ga0157375_10077149
775 Ga0157375_10113828
776 Ga0157375_10273435
777 Ga0157375_10291216
778 Ga0157375_10814436
779 Ga0163163_10144317
780 Ga0163163_10246843
781 Ga0163163_10913788
782 Ga0157380_10064520
783 Ga0157380_10078021
784 Ga0157380_10101086
785 Ga0157380_10617269
786 Ga0157380_10899910
787 Ga0157379_10091558
788 Ga0157379_10176324
789 Ga0157379_10765113
790 Ga0157376_10018173
791 Ga0157376_10048419
792 Ga0157376_10064677
793 Ga0157376_10099751
794 Ga0163161_10032563
795 Ga0163161_10181671
796 Ga0163161_10256007
797 Ga0213876_10102858
798 Ga0213871_10009898
799 Ga0209455_1000566
800 Ga0209676_1009602
801 Ga0209050_1005397
802 Ga0207697_10076530
803 Ga0207656_10004179
804 Ga0207682_10000207
805 Ga0207682_10034026
806 Ga0207688_10048803
807 Ga0207647_10141996
808 Ga0207645_10001642
809 Ga0207645_10003256
810 Ga0207645_10012366
811 Ga0207645_10031204
812 Ga0207645_10306430
813 Ga0207705_10206106
814 Ga0207684_10021243
815 Ga0207695_10026298
816 Ga0207662_10030867
817 Ga0207657_10208705
818 Ga0207646_10073512
819 Ga0207681_10043502
820 Ga0207681_10121812
821 Ga0207650_10003576
822 Ga0207650_10009488
823 Ga0207650_10043702
824 Ga0207650_10045594
825 Ga0207650_10629527
826 Ga0207659_10002431
827 Ga0207659_10009509
828 Ga0207659_10017151
829 Ga0207659_10037827
830 Ga0207659_10120428
831 Ga0207687_10486668
832 Ga0207687_10595296
833 Ga0207687_10631643
834 Ga0207644_10001589
835 Ga0207644_10027999
836 Ga0207690_10184558
837 Ga0207706_10001508
838 Ga0207706_10032850
839 Ga0207686_10161849
840 Ga0207686_10350385
841 Ga0207686_10357182
842 Ga0207709_10073150
843 Ga0207709_10376947
844 Ga0207669_10023991
845 Ga0207669_10029166
846 Ga0207669_10036389
847 Ga0207669_10039938
848 Ga0207669_10044857
849 Ga0207704_10002656
850 Ga0207704_10451306
851 Ga0207704_10487739
852 Ga0207691_10000127
853 Ga0207691_10000846
854 Ga0207691_10003752
855 Ga0207691_10013729
856 Ga0207691_10018677
857 Ga0207691_10045169
858 Ga0207691_10056758
859 Ga0207691_10121274
860 Ga0207711_10029923
861 Ga0207711_10042409
862 Ga0207711_10067651
863 Ga0207689_10048147
864 Ga0207689_10114295
865 Ga0207689_10137975
866 Ga0207661_10247635
867 Ga0207679_10290667
868 Ga0207651_10010844
869 Ga0207651_10033176
870 Ga0207651_10043856
871 Ga0207712_10031620
872 Ga0207712_10065389
873 Ga0207712_10322642
874 Ga0207640_10409670
875 Ga0207640_10470205
876 Ga0207658_10034200
877 Ga0207658_10087441
878 Ga0207658_10115526
879 Ga0207658_10269876
880 Ga0207658_10320471
881 Ga0207658_10334252
882 Ga0207677_10037715
883 Ga0207703_10000318
884 Ga0207703_10015668
885 Ga0207639_10123454
886 Ga0207678_10463234
887 Ga0207708_10037978
888 Ga0207708_10139170
889 Ga0207702_10059528
890 Ga0207641_10000721
891 Ga0207641_10008611
892 Ga0207641_10041711
893 Ga0207641_10081807
894 Ga0207641_10187746
895 Ga0207648_10000799
896 Ga0207648_10003102
897 Ga0207648_10017634
898 Ga0207648_10059758
899 Ga0207648_10088738
900 Ga0207648_10160206
901 Ga0207648_10223184
902 Ga0207648_10366587
903 Ga0207676_10098527
904 Ga0207676_10110071
905 Ga0207676_10111808
906 Ga0207676_10285128
907 Ga0207676_10585059
908 Ga0207674_10037482
909 Ga0207675_100000205
910 Ga0207675_100003220
911 Ga0207675_100012363
912 Ga0207675_100308285
913 Ga0207675_100318722
914 Ga0207683_10003804
915 Ga0207683_10008294
916 Ga0207683_10030377
917 Ga0207683_10039136
918 Ga0207683_10100452
919 Ga0207683_10238570
920 Ga0207683_10296538
921 Ga0207698_10170172
922 Ga0207698_10553696
923 Ga0209281_1004875
924 Ga0209371_1006575
925 Ga0209983_1000057
926 Ga0209998_10000641
927 Ga0209974_10010235
928 Ga0207428_10061282
929 Ga0207428_10163081
930 Ga0268266_10014568
931 Ga0268266_10039553
932 Ga0268266_10195253
933 Ga0268266_10242918
934 Ga0268265_10034022
935 Ga0268265_10039450
936 Ga0268265_10371914
937 Ga0268264_10000373
938 Ga0268264_10002625
939 Ga0268264_10099782
940 Ga0307517_10000052
941 Ga0307515_10000358
942 Ga0307515_10003504
943 Ga0307515_10017024
944 Ga0307515_10028554
945 Ga0307515_10104667
946 Ga0268256_1006625
947 Ga0307512_10012320
948 Ga0307513_10037344
949 Ga0307509_10002117
950 Ga0307509_10013408
951 Ga0307509_10024236
952 Ga0307509_10029302
953 Ga0307509_10216644
954 Ga0307509_10267057
955 Ga0307408_100124380
956 Ga0307408_100333935
957 Ga0307508_10000053
958 Ga0307508_10244006
959 Ga0307514_10009268
960 Ga0307514_10260914
961 Ga0307516_10034119
962 Ga0307405_10008662
963 Ga0307405_10142693
964 Ga0307413_10101936
965 Ga0307413_10152944
966 Ga0307413_10175090
967 Ga0307410_10013807
968 Ga0307410_10142019
969 Ga0307406_10066072
970 Ga0307407_10034564
971 Ga0307407_10162104
972 Ga0307412_10001167
973 Ga0307412_10013973
974 Ga0307412_10272645
975 Ga0307409_100095983
976 Ga0307409_100097537
977 Ga0307416_100001303
978 Ga0307416_100035126
979 Ga0307416_100039700
980 Ga0307416_100135747
981 Ga0307416_100542778
982 Ga0307416_100633299
983 Ga0307414_10015531
984 Ga0307414_10081091
985 Ga0307411_10017113
986 Ga0307411_10093622
987 Ga0307415_100005445
988 Ga0307415_100338432
989 Ga0307507_10136927
990 Ga0307507_10166568
991 Ga0307510_10001123
992 Ga0307510_10125131
993 Ga0307510_10254894
994 Ga0373939_0000239
995 Ga0373960_0001500
996 Ga0373931_0028290
997 Ga0373935_0507337
998 Ga0373927_0031321
999 Ga0373937_0104007
1000 Ga0373925_0003598
1001 Ga0373925_0294504
1002 Ga0395899_0087461
1003 Ga0395900_0044064
1004 Ga0395898_0041312
1005 Ga0395905_0011306
1006 Ga0436364_0804269
1007 Ga0436365_0116034
1008 Ga0436360_0217520
1009 Ga0436363_0090351
1010 Ga0436363_0818447
1011 Ga0439433_0014717
1012 Ga0439442_005368
1013 Ga0439445_0006810
1014 Ga0439432_002542
1015 Ga0439449_0006606
1016 Ga0439452_008154
1017 Ga0439462_0007813
1018 Ga0450923_004013
1019 Ga0450895_004569
1020 Ga0450896_002017
1021 Ga0439446_0021365
1022 Ga0439434_0005056
1023 Ga0439434_0095636
1024 Ga0439444_0004016
1025 Ga0439460_0041366
1026 Ga0451577_0003401
1027 Ga0451577_0083821
1028 Ga0451577_0397719
1029 Ga0451576_0212818
1030 Ga0451576_0259420
1031 Ga0495592_0000370
1032 Ga0495590_0018473
1033 Ga0495590_0077918
1034 Ga0495629_0133852
1035 Ga0495641_0154252
1036 Ga0495650_0004943
1037 Ga0495606_0042220
1038 Ga0495630_0226860
1039 Ga0495632_0120244
1040 Ga0495598_0015509
1041 Ga0495621_0017012
1042 Ga0495621_0129707
1043 Ga0495668_0120190
1044 Ga0495658_0021511
1045 Ga0495658_0046760
1046 Ga0495624_0057406
1047 Ga0495660_0087825
1048 Ga0495674_0283840
1049 Ga0495672_0033634
1050 Ga0495676_0037805
1051 Ga0495687_007340
1052 Ga0495681_0134308
1053 Ga0495684_0084233
1054 Ga0495686_0013777
1055 Ga0495593_0025281
1056 Ga0495614_0087608
1057 Ga0495614_0127394
1058 Ga0496100_0259363
1059 Ga0496102_0445177
1060 Ga0496103_0161945
1061 Ga0496108_0489606
1062 Ga0496110_0026602
1063 Ga0496114_0226734
1064 Ga0496114_1049779
1065 Ga0496116_0008170
1066 Ga0496116_0030720
1067 Ga0496117_0022859
1068 Ga0496118_0005781
1069 Ga0496118_0032451
1070 Ga0496119_0018081
1071 Ga0496120_0063561
1072 Ga0496121_0000314
1073 Ga0496121_0025188
1074 Ga0496122_0000046
1075 Ga0496122_0038261
1076 Ga0496123_0000082
1077 Ga0496124_0254698
1078 Ga0496125_0000028
1079 Ga0496125_0000854
1080 Ga0496125_0009558
1081 Ga0496126_0021467
1082 Ga0496126_0031548
1083 Ga0496126_0035484
1084 Ga0501032_0294285
1085 Ga0501033_0022359
1086 Ga0501034_0147189
1087 Ga0501036_0001323
1088 Ga0501038_0023395
1089 Ga0501038_0031829
1090 Ga0501039_0001406
1091 Ga0501039_0032244
1092 Ga0501040_0126635
1093 Ga0501042_0007611
1094 Ga0501043_0711032
1095 Ga0501046_0030231
1096 Ga0501046_0172036
1097 Ga0501047_0002464
1098 Ga0501048_0017159
1099 Ga0501068_0005693
1100 Ga0501071_0026671
1101 Ga0501074_0206344
1102 Ga0501076_0003858
1103 Ga0501076_0102992
1104 Ga0501079_0295658
1105 Ga0501081_0017702
1106 Ga0501035_0008851
1107 Ga0501035_0019386
1108 Ga0501035_0029433
1109 Ga0501044_0000022
1110 Ga0501044_0040830
1111 Ga0501044_0059324
1112 Ga0501045_0012264
1113 nmdc:mga06z11_252922_c1
1114 nmdc:mga07m45_79236_c1
1115 nmdc:mga05p37_43331_c1
1116 nmdc:mga05p37_835647_c1
1117 nmdc:mga09592_43177_c1
1118 nmdc:mga06r32_102907_c1
1119 nmdc:mga06r32_32080_c1
1120 nmdc:mga08y16_222889_c1
1121 nmdc:mga08y16_85784_c1
1122 nmdc:mga0n895_2463_c1
1123 nmdc:mga08x19_176731_c1
1124 nmdc:mga0a205_2569_c1
1125 Ga0500578_0011753
1126 Ga0500643_000258
1127 Ga0500651_0067977
1128 Ga0500641_0000180
1129 Ga0500650_0101848
1130 Ga0500556_0010134
1131 Ga0500557_058593
1132 Ga0500607_071221
1133 Ga0500652_074936
1134 Ga0500652_077904
1135 Ga0500658_0003162
1136 Ga0500559_0000041
1137 Ga0500568_0039618
1138 Ga0500568_0089800
1139 Ga0500616_0005445
1140 Ga0500616_0008837
1141 Ga0500622_0003555
1142 Ga0500622_0003593
1143 Ga0500622_0005836
1144 Ga0500645_000789
1145 Ga0500645_001374
1146 Ga0500645_016606
1147 Ga0501082_0005387
1148 Ga0501082_0026969
1149 Ga0501082_0414680
1150 Ga0530510_0051497
1151 2599906434
1152 2643862699
1153 2643980295
1154 2644028815
1155 2644061596
1156 2644075128
1157 2644121925
1158 2644304470
1159 2644341317
1160 2809032392
1161 2816473870
1162 2857542470
1163 2858952817
1164 2885195308
1165 2928116268
1166 2941485192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

289

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9757 8 267
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9753 8 267
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9681 8 267
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9676 8 267
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9672 8 267
ID Description Score Start End Superfamily
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.979 6 209 3.90.226.10
4fzwD01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9785 8 207 3.90.226.10
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9676 214 267 1.10.12.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9669 7 63 3.30.300.220
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.964 6 209 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2M8WYE0-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9926 5 267 GO:0016853
AF-A0A257LKI2-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 4.2.1.17) 0.9894 5 267 GO:0004300
GO:0016853
AF-A0A382IFT0-F1-model_v4 Enoyl-CoA hydratase 0.9843 7 267 GO:0006635
GO:0010124
GO:0016829
AF-A0A2S5GP16-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.983 6 267 GO:0016853
AF-A0A6J4SVT8-F1-model_v4 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18) 0.9826 6 267 GO:0010124
GO:0016853

Map