F466309

General Info

Members Datasets Scaffolds Average Seq Length
583 211 559 419

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_005064|Ga0495687_005064_6829_8139
Length 436
Sequence MPRQAWTASCVALRRHRQKTMHKPDQTDQAIPATTGPVLHPGITSSALAVMLAALAMLGPFAVDTYLPAFPDIQATLNASAIQVQQTLTAYMLSFGIMTLWHGALSDAYGRRNIILISLAAFAVATLACASVHSVEYLWIFRVMQGMSAGAGVVIGRAIIRDLYAGAPAARLLSLVTMIFSVAPAIAPIIGGWIVKLANWRAIFIVLFVYTTMLLWYCYRRLPESLPPEKRQPFNPSHLWQSYRSVFRSQLFHLEAGTIAFNFAGLFLYVSSAPVFITRHLKLGADQFAWQFVPSVAGIFFGALAVNRLAGRYSIQRQARIGFTLLLGAAGANLLYHLLLPPALPWSVLPLFFYTFGMSMVAPGATLLVLDLFPDIRGIVASCQSCAMTVLASAVSGLVAPLLWDSVPKLAAGQLALTGIALAMWLRAGHLRQRIG

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
5 2643221556 Massilia sp. Root1485 Isolate Unclassified
6 2643221638 Duganella sp. Root336D2 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2821131069 Duganella sp. 1224 Isolate Unclassified
18 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
22 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
23 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
211 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0
Rhizoplane 2.92
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001630 3300002739 Bacteria 3869
2 JGI25152J39213_1000096 3300002773 Bacteria 62223
3 JGI25152J39213_1013387 3300002773 Bacteria 1712
4 JGI25150J39212_1000930 3300002774 Bacteria 9477
5 JGI25159J45721_1007904 3300002987 Bacteria 2984
6 JGI25159J45721_1008079 3300002987 Bacteria 2930
7 JGI25159J45721_1008728 3300002987 Bacteria 2753
8 JGI25153J46596_10007462 3300003215 Bacteria 5373
9 rootL2_10063110 3300003322 Bacteria 2386
10 rootL2_10067089 3300003322 Bacteria 2881
11 rootL2_10067098 3300003322 Bacteria 1763
12 JGI25160J50197_1008949 3300003354 Bacteria 3761
13 JGI25161J50226_1001618 3300003374 Bacteria 6541
14 JGI25161J50226_1002147 3300003374 Bacteria 5292
15 Ga0055529_1000133 3300003763 Bacteria 104484
16 Ga0055526_1000063 3300003771 Bacteria 103612
17 Ga0055526_1005578 3300003771 Bacteria 7177
18 Ga0055537_1009231 3300003773 Bacteria 2196
19 Ga0055524_1000849 3300003775 Bacteria 20030
20 Ga0055524_1004013 3300003775 Bacteria 6942
21 Ga0055534_1001824 3300003784 Bacteria 7969
22 Ga0055530_10016687 3300003791 Bacteria 2332
23 Ga0055543_1002138 3300004625 Bacteria 6833
24 Ga0055543_1006156 3300004625 Bacteria 2944
25 Ga0065165_1000067 3300005262 Bacteria 170811
26 Ga0065165_1005745 3300005262 Bacteria 6815
27 Ga0070660_100045504 3300005339 Bacteria 3360
28 Ga0070661_100086434 3300005344 Bacteria 2318
29 Ga0070659_100060948 3300005366 Bacteria 2981
30 Ga0070659_100201045 3300005366 Bacteria 1640
31 Ga0070664_100126189 3300005564 Bacteria 2245
32 Ga0105244_10007118 3300009036 Bacteria 7149
33 Ga0105244_10091378 3300009036 Bacteria 1496
34 Ga0105241_10030652 3300009174 Bacteria 4022
35 Ga0105242_10126744 3300009176 Bacteria 2198
36 Ga0105246_10103592 3300011119 Bacteria 2077
37 Ga0157373_10089898 3300013100 Bacteria 2163
38 Ga0157371_10000064 3300013102 Bacteria 169056
39 Ga0157374_10031989 3300013296 Bacteria 4787
40 Ga0157372_10091094 3300013307 Bacteria 3468
41 Ga0157372_10146306 3300013307 Bacteria 2725
42 Ga0182008_10004486 3300014497 Bacteria 8155
43 Ga0182006_1000010 3300015261 Bacteria 413414
44 Ga0182007_10000021 3300015262 Bacteria 193408
45 Ga0182005_1000009 3300015265 Bacteria 455334
46 Ga0213872_10005292 3300021361 Bacteria 6665
47 Ga0213872_10013663 3300021361 Bacteria 3801
48 Ga0213872_10019858 3300021361 Bacteria 3094
49 Ga0209436_103941 3300025208 Bacteria 3783
50 Ga0209436_103947 3300025208 Bacteria 3777
51 Ga0209436_105191 3300025208 Bacteria 3041
52 Ga0209563_100015 3300025230 Bacteria 879901
53 Ga0207425_1000006 3300025245 Bacteria 808854
54 Ga0207425_1000120 3300025245 Bacteria 73895
55 Ga0207425_1000360 3300025245 Bacteria 31520
56 Ga0209646_1000114 3300025246 Bacteria 152958
57 Ga0209677_101670 3300025253 Bacteria 9309
58 Ga0209148_1000552 3300025254 Bacteria 35546
59 Ga0209129_1000009 3300025258 Bacteria 633100
60 Ga0209129_1003889 3300025258 Bacteria 6213
61 Ga0209565_1000897 3300025263 Bacteria 16179
62 Ga0209565_1004840 3300025263 Bacteria 4021
63 Ga0209455_1000063 3300025272 Bacteria 333019
64 Ga0209673_1003343 3300025273 Bacteria 9596
65 Ga0209130_1001240 3300025284 Bacteria 17919
66 Ga0209130_1001773 3300025284 Bacteria 12735
67 Ga0209130_1005746 3300025284 Bacteria 4206
68 Ga0209675_1000963 3300025291 Bacteria 18223
69 Ga0209675_1001184 3300025291 Bacteria 15836
70 Ga0209564_1000006 3300025295 Bacteria 1100927
71 Ga0209564_1000026 3300025295 Bacteria 519154
72 Ga0209564_1000098 3300025295 Bacteria 228906
73 Ga0209564_1012609 3300025295 Bacteria 3668
74 Ga0209758_1000071 3300025297 Bacteria 283749
75 Ga0209758_1000372 3300025297 Bacteria 78825
76 Ga0209050_1000533 3300025298 Bacteria 63043
77 Ga0209050_1000580 3300025298 Bacteria 59233
78 Ga0209050_1004901 3300025298 Bacteria 8756
79 Ga0209256_1000364 3300025299 Bacteria 73338
80 Ga0209256_1000372 3300025299 Bacteria 71907
81 Ga0207426_1012125 3300025302 Bacteria 3252
82 Ga0209257_1000010 3300025304 Bacteria 1158682
83 Ga0207705_10009664 3300025909 Bacteria 7015
84 Ga0207654_10010900 3300025911 Bacteria 4627
85 Ga0207660_10032202 3300025917 Bacteria 3618
86 Ga0207657_10013850 3300025919 Bacteria 7891
87 Ga0207657_10083400 3300025919 Bacteria 2681
88 Ga0207690_10077699 3300025932 Bacteria 2308
89 Ga0207686_10036705 3300025934 Bacteria 2953
90 Ga0207698_10022054 3300026142 Bacteria 4417
91 Ga0265332_10000026 3300031238 Bacteria 193153
92 Ga0265332_10011599 3300031238 Bacteria 3915
93 Ga0307408_100000815 3300031548 Bacteria 24822
94 Ga0307408_100062441 3300031548 Bacteria 2722
95 Ga0307416_100006441 3300032002 Bacteria 7355
96 Ga0307414_10045060 3300032004 Bacteria 3018
97 Ga0395899_0050864 3300037312 Bacteria 3075
98 Ga0395900_0006351 3300037418 Bacteria 12323
99 Ga0395900_0011570 3300037418 Bacteria 9030
100 Ga0395900_0135904 3300037418 Bacteria 2518
101 Ga0395900_0362139 3300037418 Bacteria 1421
102 Ga0395898_0192825 3300037466 Bacteria 1947
103 Ga0395905_0107549 3300037471 Bacteria 2618
104 Ga0395905_0129691 3300037471 Bacteria 2371
105 Ga0395901_0000387 3300038443 Bacteria 52634
106 Ga0395901_0021161 3300038443 Bacteria 6662
107 Ga0395901_0101473 3300038443 Bacteria 3019
108 Ga0395901_0301444 3300038443 Bacteria 1661
109 Ga0395901_0402819 3300038443 Bacteria 1405
110 Ga0436361_0066547 3300039447 Bacteria 1838
111 Ga0436361_0415054 3300039447 Bacteria 7516
112 Ga0439450_002931 3300042008 Bacteria 2756
113 Ga0439455_0008760 3300042012 Bacteria 2176
114 Ga0466969_0002843 3300044656 Bacteria 9252
115 Ga0466972_0049644 3300044658 Bacteria 2027
116 Ga0466965_0004171 3300044683 Bacteria 6421
117 Ga0466965_0007512 3300044683 Bacteria 5008
118 Ga0466965_0013802 3300044683 Bacteria 3816
119 Ga0466965_0016021 3300044683 Bacteria 3562
120 Ga0466966_0014551 3300044684 Bacteria 5207
121 Ga0466966_0053264 3300044684 Bacteria 2567
122 Ga0466966_0075343 3300044684 Bacteria 2108
123 Ga0466961_0000218 3300044693 Bacteria 38766
124 Ga0466961_0097351 3300044693 Bacteria 1855
125 Ga0466963_0065407 3300044694 Bacteria 2438
126 Ga0466964_0002855 3300044706 Bacteria 6234
127 Ga0466964_0013187 3300044706 Bacteria 3133
128 Ga0466964_0023097 3300044706 Bacteria 2416
129 Ga0466971_0023642 3300044719 Bacteria 2739
130 Ga0466968_0000137 3300044735 Bacteria 21714
131 Ga0466968_0001681 3300044735 Bacteria 7969
132 Ga0466970_0143871 3300044765 Bacteria 1314
133 Ga0466957_0001441 3300044842 Bacteria 12433
134 Ga0466957_0004280 3300044842 Bacteria 7914
135 Ga0466957_0031056 3300044842 Bacteria 3191
136 Ga0466957_0143852 3300044842 Bacteria 1538
137 Ga0466959_0003051 3300045049 Bacteria 10830
138 Ga0466959_0043250 3300045049 Bacteria 3321
139 Ga0451576_0030325 3300045051 Bacteria 5780
140 Ga0466958_0018456 3300045836 Bacteria 4048
141 Ga0466967_0011693 3300045976 Bacteria 6671
142 Ga0466967_0146695 3300045976 Bacteria 2201
143 Ga0495617_000139 3300046452 Bacteria 47951
144 Ga0495617_002033 3300046452 Bacteria 8405
145 Ga0495627_001512 3300046453 Bacteria 13367
146 Ga0495627_019018 3300046453 Bacteria 2308
147 Ga0495603_0014495 3300046455 Bacteria 4767
148 Ga0495590_0000436 3300046457 Bacteria 20760
149 Ga0495590_0001044 3300046457 Bacteria 12237
150 Ga0495591_000439 3300046458 Bacteria 33866
151 Ga0495629_0008053 3300046459 Bacteria 7758
152 Ga0495629_0053327 3300046459 Bacteria 2830
153 Ga0495629_0064677 3300046459 Bacteria 2553
154 Ga0495638_0003406 3300046460 Bacteria 12529
155 Ga0495638_0027319 3300046460 Bacteria 3695
156 Ga0495638_0047679 3300046460 Bacteria 2685
157 Ga0495638_0102509 3300046460 Bacteria 1710
158 Ga0495653_0000018 3300046463 Bacteria 185787
159 Ga0495653_0022260 3300046463 Bacteria 5129
160 Ga0495653_0074754 3300046463 Bacteria 2523
161 Ga0495653_0103998 3300046463 Bacteria 2052
162 Ga0495650_0000173 3300046471 Bacteria 142734
163 Ga0495650_0000305 3300046471 Bacteria 88924
164 Ga0495650_0000471 3300046471 Bacteria 62035
165 Ga0495650_0000499 3300046471 Bacteria 59360
166 Ga0495650_0003610 3300046471 Bacteria 11149
167 Ga0495650_0004033 3300046471 Bacteria 10294
168 Ga0495580_0055621 3300046472 Bacteria 2787
169 Ga0495582_0003088 3300046473 Bacteria 9336
170 Ga0495582_0005236 3300046473 Bacteria 7252
171 Ga0495582_0021208 3300046473 Bacteria 3557
172 Ga0495582_0036853 3300046473 Bacteria 2690
173 Ga0495605_0000005 3300046474 Bacteria 376973
174 Ga0495605_0000317 3300046474 Bacteria 50604
175 Ga0495605_0000351 3300046474 Bacteria 44529
176 Ga0495605_0013403 3300046474 Bacteria 4518
177 Ga0495605_0110727 3300046474 Bacteria 1253
178 Ga0495664_0060213 3300046477 Bacteria 2261
179 Ga0495584_0001019 3300046491 Bacteria 17502
180 Ga0495584_0001567 3300046491 Bacteria 13526
181 Ga0495584_0003368 3300046491 Bacteria 8832
182 Ga0495584_0004556 3300046491 Bacteria 7434
183 Ga0495584_0005686 3300046491 Bacteria 6587
184 Ga0495584_0013605 3300046491 Bacteria 4152
185 Ga0495584_0018742 3300046491 Bacteria 3518
186 Ga0495584_0041717 3300046491 Bacteria 2316
187 Ga0495584_0058026 3300046491 Bacteria 1947
188 Ga0495584_0073973 3300046491 Bacteria 1712
189 Ga0495584_0078556 3300046491 Bacteria 1660
190 Ga0495585_0000418 3300046492 Bacteria 40978
191 Ga0495585_0000886 3300046492 Bacteria 25363
192 Ga0495585_0002670 3300046492 Bacteria 12492
193 Ga0495585_0002940 3300046492 Bacteria 11787
194 Ga0495585_0003837 3300046492 Bacteria 9998
195 Ga0495585_0006663 3300046492 Bacteria 7136
196 Ga0495585_0014231 3300046492 Bacteria 4639
197 Ga0495585_0015089 3300046492 Bacteria 4489
198 Ga0495585_0022692 3300046492 Bacteria 3602
199 Ga0495585_0028949 3300046492 Bacteria 3156
200 Ga0495585_0056638 3300046492 Bacteria 2164
201 Ga0495585_0083901 3300046492 Bacteria 1723
202 Ga0495585_0094104 3300046492 Bacteria 1610
203 Ga0495594_0001677 3300046499 Bacteria 11512
204 Ga0495594_0008003 3300046499 Bacteria 5435
205 Ga0495594_0020073 3300046499 Bacteria 3557
206 Ga0495594_0028817 3300046499 Bacteria 2997
207 Ga0495596_0001463 3300046500 Bacteria 13524
208 Ga0495596_0003850 3300046500 Bacteria 7454
209 Ga0495596_0007371 3300046500 Bacteria 4965
210 Ga0495596_0010358 3300046500 Bacteria 4061
211 Ga0495596_0013270 3300046500 Bacteria 3500
212 Ga0495596_0024401 3300046500 Bacteria 2447
213 Ga0495596_0030370 3300046500 Bacteria 2163
214 Ga0495607_0000409 3300046501 Bacteria 43547
215 Ga0495607_0000927 3300046501 Bacteria 27347
216 Ga0495607_0005945 3300046501 Bacteria 8654
217 Ga0495607_0011237 3300046501 Bacteria 5973
218 Ga0495607_0012586 3300046501 Bacteria 5576
219 Ga0495607_0018901 3300046501 Bacteria 4383
220 Ga0495607_0051792 3300046501 Bacteria 2381
221 Ga0495607_0063156 3300046501 Bacteria 2096
222 Ga0495583_0000268 3300046506 Bacteria 85709
223 Ga0495583_0000590 3300046506 Bacteria 49812
224 Ga0495583_0003724 3300046506 Bacteria 11340
225 Ga0495583_0010322 3300046506 Bacteria 5457
226 Ga0495583_0021550 3300046506 Bacteria 3312
227 Ga0495583_0023339 3300046506 Bacteria 3131
228 Ga0495583_0039690 3300046506 Bacteria 2215
229 Ga0495583_0090235 3300046506 Bacteria 1320
230 Ga0495606_0000158 3300046507 Bacteria 118616
231 Ga0495606_0000547 3300046507 Bacteria 60321
232 Ga0495606_0001026 3300046507 Bacteria 40508
233 Ga0495606_0008570 3300046507 Bacteria 8847
234 Ga0495606_0014187 3300046507 Bacteria 6236
235 Ga0495606_0018180 3300046507 Bacteria 5282
236 Ga0495606_0022891 3300046507 Bacteria 4540
237 Ga0495610_0000021 3300046512 Bacteria 336300
238 Ga0495610_0004029 3300046512 Bacteria 11073
239 Ga0495610_0006450 3300046512 Bacteria 8066
240 Ga0495610_0016680 3300046512 Bacteria 4218
241 Ga0495610_0018723 3300046512 Bacteria 3898
242 Ga0495616_0000052 3300046513 Bacteria 105258
243 Ga0495616_0004974 3300046513 Bacteria 8291
244 Ga0495616_0009112 3300046513 Bacteria 5822
245 Ga0495616_0009223 3300046513 Bacteria 5785
246 Ga0495616_0009470 3300046513 Bacteria 5692
247 Ga0495616_0014880 3300046513 Bacteria 4340
248 Ga0495616_0016899 3300046513 Bacteria 4029
249 Ga0495616_0018827 3300046513 Bacteria 3777
250 Ga0495616_0043258 3300046513 Bacteria 2288
251 Ga0495616_0057865 3300046513 Bacteria 1910
252 Ga0495616_0061367 3300046513 Bacteria 1843
253 Ga0495616_0074038 3300046513 Bacteria 1642
254 Ga0495616_0098107 3300046513 Bacteria 1377
255 Ga0495620_0001372 3300046515 Bacteria 14707
256 Ga0495630_0010240 3300046517 Bacteria 6764
257 Ga0495631_0001914 3300046518 Bacteria 12265
258 Ga0495631_0004798 3300046518 Bacteria 7126
259 Ga0495631_0013050 3300046518 Bacteria 4041
260 Ga0495631_0045229 3300046518 Bacteria 1938
261 Ga0495631_0047101 3300046518 Bacteria 1894
262 Ga0495632_0000260 3300046519 Bacteria 52561
263 Ga0495632_0000289 3300046519 Bacteria 49001
264 Ga0495632_0000625 3300046519 Bacteria 32717
265 Ga0495632_0010491 3300046519 Bacteria 5480
266 Ga0495632_0045181 3300046519 Bacteria 2195
267 Ga0495637_0000014 3300046520 Bacteria 228956
268 Ga0495637_0000057 3300046520 Bacteria 97433
269 Ga0495637_0002195 3300046520 Bacteria 10914
270 Ga0495637_0048349 3300046520 Bacteria 1791
271 Ga0495643_0000569 3300046522 Bacteria 45560
272 Ga0495643_0003240 3300046522 Bacteria 12056
273 Ga0495643_0003517 3300046522 Bacteria 11389
274 Ga0495643_0005048 3300046522 Bacteria 9038
275 Ga0495643_0016136 3300046522 Bacteria 4394
276 Ga0495643_0030355 3300046522 Bacteria 3019
277 Ga0495643_0040532 3300046522 Bacteria 2543
278 Ga0495643_0042957 3300046522 Bacteria 2461
279 Ga0495644_0009441 3300046523 Bacteria 3761
280 Ga0495644_0021280 3300046523 Bacteria 2474
281 Ga0495644_0032052 3300046523 Bacteria 1986
282 Ga0495648_0000117 3300046524 Bacteria 97341
283 Ga0495648_0008325 3300046524 Bacteria 8175
284 Ga0495648_0017529 3300046524 Bacteria 5115
285 Ga0495648_0029249 3300046524 Bacteria 3659
286 Ga0495648_0056834 3300046524 Bacteria 2351
287 Ga0495666_0021452 3300046526 Bacteria 3197
288 Ga0495666_0032654 3300046526 Bacteria 2546
289 Ga0495666_0068104 3300046526 Bacteria 1695
290 Ga0495642_0000211 3300046528 Bacteria 34127
291 Ga0495642_0000512 3300046528 Bacteria 19986
292 Ga0495642_0001174 3300046528 Bacteria 12026
293 Ga0495642_0007490 3300046528 Bacteria 4181
294 Ga0495642_0010579 3300046528 Bacteria 3532
295 Ga0495642_0017587 3300046528 Bacteria 2794
296 Ga0495642_0020533 3300046528 Bacteria 2595
297 Ga0495642_0020764 3300046528 Bacteria 2582
298 Ga0495642_0024984 3300046528 Bacteria 2365
299 Ga0495642_0065078 3300046528 Bacteria 1517
300 Ga0495652_0046571 3300046529 Bacteria 3722
301 Ga0495652_0114262 3300046529 Bacteria 2166
302 Ga0495654_0000005 3300046530 Bacteria 491381
303 Ga0495654_0009150 3300046530 Bacteria 5431
304 Ga0495654_0015707 3300046530 Bacteria 4018
305 Ga0495654_0037432 3300046530 Bacteria 2432
306 Ga0495665_0019295 3300046531 Bacteria 3665
307 Ga0495665_0022282 3300046531 Bacteria 3404
308 Ga0495665_0023645 3300046531 Bacteria 3300
309 Ga0495665_0081218 3300046531 Bacteria 1704
310 Ga0495640_0039492 3300046533 Bacteria 3311
311 Ga0495640_0061287 3300046533 Bacteria 2556
312 Ga0495586_0048702 3300046535 Bacteria 2290
313 Ga0495587_0016261 3300046536 Bacteria 4631
314 Ga0495587_0031609 3300046536 Bacteria 3203
315 Ga0495609_0000028 3300046538 Bacteria 219908
316 Ga0495609_0000663 3300046538 Bacteria 26718
317 Ga0495609_0001184 3300046538 Bacteria 17995
318 Ga0495609_0002622 3300046538 Bacteria 10918
319 Ga0495609_0007655 3300046538 Bacteria 5366
320 Ga0495609_0009236 3300046538 Bacteria 4778
321 Ga0495609_0030766 3300046538 Bacteria 2443
322 Ga0495609_0064651 3300046538 Bacteria 1613
323 Ga0495597_0000908 3300046542 Bacteria 22977
324 Ga0495597_0001649 3300046542 Bacteria 15587
325 Ga0495597_0001913 3300046542 Bacteria 14108
326 Ga0495597_0002414 3300046542 Bacteria 11892
327 Ga0495597_0006518 3300046542 Bacteria 6025
328 Ga0495597_0027877 3300046542 Bacteria 2588
329 Ga0495622_0030806 3300046557 Bacteria 2507
330 Ga0495622_0058124 3300046557 Bacteria 1791
331 Ga0495622_0063429 3300046557 Bacteria 1709
332 Ga0495633_0000128 3300046558 Bacteria 101213
333 Ga0495633_0001360 3300046558 Bacteria 19136
334 Ga0495633_0011167 3300046558 Bacteria 4864
335 Ga0495633_0012302 3300046558 Bacteria 4560
336 Ga0495633_0013096 3300046558 Bacteria 4384
337 Ga0495633_0015191 3300046558 Bacteria 4000
338 Ga0495633_0018665 3300046558 Bacteria 3519
339 Ga0495633_0026058 3300046558 Bacteria 2871
340 Ga0495633_0030398 3300046558 Bacteria 2623
341 Ga0495633_0031556 3300046558 Bacteria 2567
342 Ga0495633_0039722 3300046558 Bacteria 2244
343 Ga0495633_0064691 3300046558 Bacteria 1709
344 Ga0495656_0015846 3300046615 Bacteria 2852
345 Ga0495656_0020293 3300046615 Bacteria 2576
346 Ga0495656_0052805 3300046615 Bacteria 1744
347 Ga0495668_0000008 3300046616 Bacteria 498364
348 Ga0495668_0000482 3300046616 Bacteria 50037
349 Ga0495668_0000508 3300046616 Bacteria 48561
350 Ga0495668_0000877 3300046616 Bacteria 33901
351 Ga0495668_0002382 3300046616 Bacteria 15593
352 Ga0495668_0006425 3300046616 Bacteria 7698
353 Ga0495668_0008854 3300046616 Bacteria 6237
354 Ga0495668_0009043 3300046616 Bacteria 6150
355 Ga0495668_0011066 3300046616 Bacteria 5423
356 Ga0495668_0019720 3300046616 Bacteria 3883
357 Ga0495668_0026679 3300046616 Bacteria 3276
358 Ga0495634_0006065 3300046642 Bacteria 9219
359 Ga0495634_0022247 3300046642 Bacteria 4468
360 Ga0495611_0000320 3300046648 Bacteria 32126
361 Ga0495611_0006456 3300046648 Bacteria 4997
362 Ga0495611_0006713 3300046648 Bacteria 4896
363 Ga0495611_0016039 3300046648 Bacteria 3203
364 Ga0495611_0026976 3300046648 Bacteria 2508
365 Ga0495611_0032084 3300046648 Bacteria 2315
366 Ga0495625_0001216 3300046660 Bacteria 32654
367 Ga0495625_0002285 3300046660 Bacteria 21024
368 Ga0495625_0006157 3300046660 Bacteria 10747
369 Ga0495625_0006717 3300046660 Bacteria 10199
370 Ga0495625_0009146 3300046660 Bacteria 8336
371 Ga0495625_0012440 3300046660 Bacteria 6895
372 Ga0495625_0019958 3300046660 Bacteria 5183
373 Ga0495625_0105397 3300046660 Bacteria 1931
374 Ga0495659_0000015 3300046664 Bacteria 76146
375 Ga0495659_0000607 3300046664 Bacteria 13200
376 Ga0495659_0008358 3300046664 Bacteria 3293
377 Ga0495661_0000641 3300046665 Bacteria 35477
378 Ga0495661_0001197 3300046665 Bacteria 22521
379 Ga0495661_0003654 3300046665 Bacteria 11307
380 Ga0495661_0005796 3300046665 Bacteria 8733
381 Ga0495661_0007519 3300046665 Bacteria 7595
382 Ga0495661_0009379 3300046665 Bacteria 6718
383 Ga0495661_0010125 3300046665 Bacteria 6445
384 Ga0495661_0015757 3300046665 Bacteria 5034
385 Ga0495661_0016165 3300046665 Bacteria 4955
386 Ga0495661_0017567 3300046665 Bacteria 4721
387 Ga0495661_0047104 3300046665 Bacteria 2627
388 Ga0495661_0051226 3300046665 Bacteria 2494
389 Ga0495661_0066028 3300046665 Bacteria 2130
390 Ga0495661_0073028 3300046665 Bacteria 1999
391 Ga0495661_0077277 3300046665 Bacteria 1929
392 Ga0495588_0000438 3300046674 Bacteria 21238
393 Ga0495588_0023124 3300046674 Bacteria 3074
394 Ga0495646_0010340 3300046680 Bacteria 5934
395 Ga0495669_0000756 3300046684 Bacteria 13891
396 Ga0495669_0001014 3300046684 Bacteria 11730
397 Ga0495669_0007957 3300046684 Bacteria 4447
398 Ga0495669_0012146 3300046684 Bacteria 3662
399 Ga0495624_0071573 3300046690 Bacteria 2157
400 Ga0495624_0111930 3300046690 Bacteria 1678
401 Ga0495670_0002581 3300046691 Bacteria 8951
402 Ga0495670_0003328 3300046691 Bacteria 7916
403 Ga0495670_0006407 3300046691 Bacteria 5781
404 Ga0495670_0007683 3300046691 Bacteria 5300
405 Ga0495670_0012036 3300046691 Bacteria 4258
406 Ga0495670_0035041 3300046691 Bacteria 2500
407 Ga0495670_0048541 3300046691 Bacteria 2123
408 Ga0495670_0098233 3300046691 Bacteria 1505
409 Ga0495671_0000024 3300046692 Bacteria 246812
410 Ga0495671_0000550 3300046692 Bacteria 28086
411 Ga0495671_0001227 3300046692 Bacteria 17546
412 Ga0495671_0036807 3300046692 Bacteria 2478
413 Ga0495649_0000094 3300046694 Bacteria 76592
414 Ga0495649_0006217 3300046694 Bacteria 7451
415 Ga0495649_0012185 3300046694 Bacteria 5015
416 Ga0495649_0014759 3300046694 Bacteria 4465
417 Ga0495649_0034751 3300046694 Bacteria 2773
418 Ga0495589_0000113 3300046794 Bacteria 76949
419 Ga0495589_0000178 3300046794 Bacteria 56371
420 Ga0495589_0007144 3300046794 Bacteria 5852
421 Ga0495589_0013053 3300046794 Bacteria 4290
422 Ga0495589_0013136 3300046794 Bacteria 4274
423 Ga0495589_0015167 3300046794 Bacteria 3966
424 Ga0495589_0017723 3300046794 Bacteria 3654
425 Ga0495589_0032332 3300046794 Bacteria 2630
426 Ga0495589_0034833 3300046794 Bacteria 2525
427 Ga0495600_0021253 3300046809 Bacteria 4153
428 Ga0495600_0047082 3300046809 Bacteria 2813
429 Ga0495660_0001650 3300046810 Bacteria 14965
430 Ga0495660_0001922 3300046810 Bacteria 13552
431 Ga0495660_0036166 3300046810 Bacteria 2755
432 Ga0495660_0042211 3300046810 Bacteria 2521
433 Ga0495660_0063837 3300046810 Bacteria 1970
434 Ga0495660_0063968 3300046810 Bacteria 1967
435 Ga0495581_0001885 3300047315 Bacteria 11734
436 Ga0495581_0005986 3300047315 Bacteria 7046
437 Ga0495581_0021534 3300047315 Bacteria 3735
438 Ga0495581_0031588 3300047315 Bacteria 3067
439 Ga0495604_0005712 3300047317 Bacteria 9867
440 Ga0495604_0016197 3300047317 Bacteria 5956
441 Ga0495604_0025748 3300047317 Bacteria 4685
442 Ga0495636_0000231 3300047318 Bacteria 21961
443 Ga0495674_0003592 3300047319 Bacteria 15080
444 Ga0495672_0000140 3300047320 Bacteria 106637
445 Ga0495672_0000471 3300047320 Bacteria 47689
446 Ga0495672_0000521 3300047320 Bacteria 43978
447 Ga0495672_0001747 3300047320 Bacteria 21001
448 Ga0495672_0011053 3300047320 Bacteria 6392
449 Ga0495672_0016520 3300047320 Bacteria 4968
450 Ga0495672_0067346 3300047320 Bacteria 2040
451 Ga0495672_0093733 3300047320 Bacteria 1643
452 Ga0495676_0000180 3300047321 Bacteria 49779
453 Ga0495676_0016225 3300047321 Bacteria 6615
454 Ga0495676_0033872 3300047321 Bacteria 4293
455 Ga0495680_0004699 3300047322 Bacteria 13005
456 Ga0495680_0177601 3300047322 Bacteria 1539
457 Ga0495683_0000275 3300047323 Bacteria 45085
458 Ga0495683_0001831 3300047323 Bacteria 13360
459 Ga0495683_0006505 3300047323 Bacteria 6381
460 Ga0495683_0011814 3300047323 Bacteria 4591
461 Ga0495683_0013933 3300047323 Bacteria 4192
462 Ga0495683_0017864 3300047323 Bacteria 3672
463 Ga0495687_000054 3300047443 Bacteria 194607
464 Ga0495687_000060 3300047443 Bacteria 179124
465 Ga0495687_000487 3300047443 Bacteria 48069
466 Ga0495687_000759 3300047443 Bacteria 34915
467 Ga0495687_001790 3300047443 Bacteria 18972
468 Ga0495687_005064 3300047443 Bacteria 8564
469 Ga0495687_007428 3300047443 Bacteria 6453
470 Ga0495687_034503 3300047443 Bacteria 2285
471 Ga0495675_0001798 3300047444 Bacteria 12778
472 Ga0495675_0096489 3300047444 Bacteria 1853
473 Ga0495677_0000084 3300047445 Bacteria 48271
474 Ga0495677_0000153 3300047445 Bacteria 32929
475 Ga0495677_0001191 3300047445 Bacteria 10398
476 Ga0495677_0001337 3300047445 Bacteria 9852
477 Ga0495677_0002830 3300047445 Bacteria 6758
478 Ga0495677_0004612 3300047445 Bacteria 5260
479 Ga0495677_0005513 3300047445 Bacteria 4798
480 Ga0495677_0005852 3300047445 Bacteria 4654
481 Ga0495677_0012567 3300047445 Bacteria 3087
482 Ga0495677_0013561 3300047445 Bacteria 2966
483 Ga0495677_0019351 3300047445 Bacteria 2469
484 Ga0495677_0037064 3300047445 Bacteria 1781
485 Ga0495677_0056876 3300047445 Bacteria 1445
486 Ga0495679_009077 3300047446 Bacteria 4007
487 Ga0495679_017515 3300047446 Bacteria 2562
488 Ga0495679_018374 3300047446 Bacteria 2483
489 Ga0495685_000132 3300047447 Bacteria 25959
490 Ga0495673_0000033 3300047469 Bacteria 354152
491 Ga0495673_0000034 3300047469 Bacteria 326920
492 Ga0495673_0000120 3300047469 Bacteria 144972
493 Ga0495673_0012118 3300047469 Bacteria 4590
494 Ga0495681_0004186 3300047470 Bacteria 9905
495 Ga0495681_0010114 3300047470 Bacteria 5738
496 Ga0495681_0016302 3300047470 Bacteria 4170
497 Ga0495681_0021452 3300047470 Bacteria 3479
498 Ga0495681_0051011 3300047470 Bacteria 1947
499 Ga0495686_0000778 3300047472 Bacteria 41882
500 Ga0495686_0024963 3300047472 Bacteria 3920
501 Ga0495593_0002068 3300047673 Bacteria 11989
502 Ga0495593_0012240 3300047673 Bacteria 4903
503 Ga0495593_0023976 3300047673 Bacteria 3385
504 Ga0495602_0098508 3300048088 Bacteria 2405
505 Ga0495614_0008781 3300048089 Bacteria 4487
506 Ga0495626_0000036 3300048091 Bacteria 180464
507 Ga0495626_0000044 3300048091 Bacteria 165533
508 Ga0495626_0003205 3300048091 Bacteria 10622
509 Ga0495626_0005156 3300048091 Bacteria 7747
510 Ga0495626_0007295 3300048091 Bacteria 6166
511 Ga0495626_0013428 3300048091 Bacteria 4256
512 Ga0495626_0013652 3300048091 Bacteria 4215
513 Ga0495626_0016398 3300048091 Bacteria 3762
514 Ga0495626_0078403 3300048091 Bacteria 1471
515 Ga0496100_0179965 3300048903 Bacteria 1528
516 Ga0496101_0186426 3300048904 Bacteria 1599
517 Ga0496102_0000192 3300048905 Bacteria 83166
518 Ga0496102_0000422 3300048905 Bacteria 48884
519 Ga0496102_0036852 3300048905 Bacteria 4408
520 Ga0496102_0048912 3300048905 Bacteria 3845
521 Ga0496102_0152570 3300048905 Bacteria 2171
522 Ga0496103_0052626 3300048906 Bacteria 2521
523 Ga0496106_0030819 3300048909 Bacteria 3998
524 Ga0496109_0012456 3300048912 Bacteria 7342
525 Ga0496109_0134233 3300048912 Bacteria 2312
526 Ga0496110_0000734 3300048913 Bacteria 22649
527 Ga0496110_0095287 3300048913 Bacteria 2665
528 Ga0496113_0064613 3300048916 Bacteria 2767
529 Ga0496114_0028311 3300048917 Bacteria 4597
530 Ga0496114_0067420 3300048917 Bacteria 3002
531 Ga0496117_0000010 3300048920 Bacteria 611954
532 Ga0496118_0000009 3300048921 Bacteria 611954
533 Ga0496121_0012762 3300048924 Bacteria 9100
534 Ga0496121_0088534 3300048924 Bacteria 2427
535 Ga0496122_0000890 3300048925 Bacteria 55628
536 Ga0496122_0018994 3300048925 Bacteria 6306
537 Ga0496122_0042474 3300048925 Bacteria 3576
538 Ga0496122_0079062 3300048925 Bacteria 2300
539 Ga0496123_0000780 3300048926 Bacteria 51494
540 Ga0496123_0003373 3300048926 Bacteria 18056
541 Ga0496123_0007610 3300048926 Bacteria 10142
542 Ga0496123_0012751 3300048926 Bacteria 7128
543 Ga0496124_0018686 3300048927 Bacteria 6484
544 Ga0496124_0023423 3300048927 Bacteria 5637
545 Ga0496124_0080459 3300048927 Bacteria 2681
546 Ga0496125_0000870 3300048928 Bacteria 48206
547 Ga0496125_0000897 3300048928 Bacteria 47149
548 Ga0496126_0010190 3300048929 Bacteria 9887
549 Ga0495678_000150 3300049459 Bacteria 84562
550 Ga0495678_000327 3300049459 Bacteria 50475
551 Ga0495678_002747 3300049459 Bacteria 11546
552 Ga0495678_002960 3300049459 Bacteria 10842
553 Ga0495678_006295 3300049459 Bacteria 6332
554 Ga0495682_0005854 3300049460 Bacteria 5049
555 Ga0495682_0007809 3300049460 Bacteria 4237
556 Ga0501037_0061221 3300049573 Bacteria 2745
557 Ga0501035_0002092 3300049822 Bacteria 19864
558 Ga0500594_0006196 3300053118 Bacteria 2681
559 Ga0500586_000383 3300053145 Bacteria 8845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0006351 Ga0395900_0006351_4646_5920 340
2 3300038443 Ga0395901_0000387 Ga0395901_0000387_5555_6829 340
3 3300048091 Ga0495626_0007295 Ga0495626_0007295_1840_3114 340
4 3300049822 Ga0501035_0002092 Ga0501035_0002092_1361_2635 340
5 3300044658 Ga0466972_0049644 Ga0466972_0049644_419_1693 343
6 3300044683 Ga0466965_0004171 Ga0466965_0004171_4339_5613 343
7 3300044735 Ga0466968_0001681 Ga0466968_0001681_6608_7882 343
8 3300003322 rootL2_10067089 rootL2_100670892 344
9 3300037418 Ga0395900_0362139 Ga0395900_0362139_133_1407 344
10 3300046674 Ga0495588_0000438 Ga0495588_0000438_12005_13279 344
11 3300005344 Ga0070661_100086434 Ga0070661_1000864342 345
12 3300013307 Ga0157372_10146306 Ga0157372_101463062 345
13 3300044842 Ga0466957_0143852 Ga0466957_0143852_32_1240 345
14 3300046528 Ga0495642_0020533 Ga0495642_0020533_447_1679 345
15 3300044683 Ga0466965_0016021 Ga0466965_0016021_1513_2760 347
16 3300046615 Ga0495656_0052805 Ga0495656_0052805_21_1259 347
17 3300044656 Ga0466969_0002843 Ga0466969_0002843_2765_4000 349
18 3300044684 Ga0466966_0053264 Ga0466966_0053264_1056_2291 349
19 3300044693 Ga0466961_0000218 Ga0466961_0000218_35276_36511 349
20 3300045049 Ga0466959_0043250 Ga0466959_0043250_862_2097 349
21 3300046665 Ga0495661_0077277 Ga0495661_0077277_11_1183 351
22 3300003771 Ga0055526_1000063 Ga0055526_100006393 352
23 3300025295 Ga0209564_1000006 Ga0209564_1000006884 352
24 3300031238 Ga0265332_10011599 Ga0265332_100115993 352
25 3300031238 Ga0265332_10000026 Ga0265332_1000002630 353
26 3300046452 Ga0495617_000139 Ga0495617_000139_7649_8929 353
27 3300046471 Ga0495650_0003610 Ga0495650_0003610_6548_7828 353
28 3300046492 Ga0495585_0000418 Ga0495585_0000418_38954_40234 353
29 3300046499 Ga0495594_0028817 Ga0495594_0028817_25_1305 353
30 3300046512 Ga0495610_0000021 Ga0495610_0000021_129143_130423 353
31 3300046524 Ga0495648_0029249 Ga0495648_0029249_37_1317 353
32 3300046531 Ga0495665_0019295 Ga0495665_0019295_1736_3016 353
33 3300046557 Ga0495622_0030806 Ga0495622_0030806_929_2209 353
34 3300046616 Ga0495668_0002382 Ga0495668_0002382_14247_15527 353
35 3300046692 Ga0495671_0000024 Ga0495671_0000024_82_1362 353
36 3300046810 Ga0495660_0063837 Ga0495660_0063837_619_1899 353
37 3300047315 Ga0495581_0005986 Ga0495581_0005986_2449_3729 353
38 3300047469 Ga0495673_0000120 Ga0495673_0000120_139324_140604 353
39 iso_pu_bacteria 2547132512 2548847228 353
40 iso_pu_bacteria 2547132103 2547371573 354
41 3300037466 Ga0395898_0192825 Ga0395898_0192825_761_1933 356
42 3300045051 Ga0451576_0030325 Ga0451576_0030325_2375_3583 356
43 3300047320 Ga0495672_0067346 Ga0495672_0067346_100_1320 356
44 3300046507 Ga0495606_0022891 Ga0495606_0022891_3192_4463 357
45 3300046665 Ga0495661_0003654 Ga0495661_0003654_7035_8252 357
46 3300047443 Ga0495687_034503 Ga0495687_034503_160_1377 357
47 3300049573 Ga0501037_0061221 Ga0501037_0061221_1097_2269 357
48 3300002774 JGI25150J39212_1000930 JGI25150J39212_10009307 358
49 3300003215 JGI25153J46596_10007462 JGI25153J46596_100074622 358
50 3300003791 Ga0055530_10016687 Ga0055530_100166871 358
51 3300005564 Ga0070664_100126189 Ga0070664_1001261892 358
52 3300009176 Ga0105242_10126744 Ga0105242_101267442 358
53 3300013296 Ga0157374_10031989 Ga0157374_100319894 358
54 3300015261 Ga0182006_1000010 Ga0182006_1000010251 358
55 3300015262 Ga0182007_10000021 Ga0182007_1000002140 358
56 3300021361 Ga0213872_10005292 Ga0213872_100052923 358
57 3300025263 Ga0209565_1004840 Ga0209565_10048402 358
58 3300037471 Ga0395905_0129691 Ga0395905_0129691_720_1955 358
59 3300039447 Ga0436361_0415054 Ga0436361_0415054_2652_3911 358
60 3300044683 Ga0466965_0013802 Ga0466965_0013802_2145_3380 358
61 3300044684 Ga0466966_0075343 Ga0466966_0075343_875_2068 358
62 3300044693 Ga0466961_0097351 Ga0466961_0097351_14_1207 358
63 3300045049 Ga0466959_0003051 Ga0466959_0003051_5050_6285 358
64 3300046452 Ga0495617_002033 Ga0495617_002033_3335_4546 358
65 3300046460 Ga0495638_0003406 Ga0495638_0003406_6964_8163 358
66 3300046474 Ga0495605_0110727 Ga0495605_0110727_13_1116 358
67 3300046491 Ga0495584_0073973 Ga0495584_0073973_438_1649 358
68 3300046501 Ga0495607_0000927 Ga0495607_0000927_2241_3473 358
69 3300046501 Ga0495607_0011237 Ga0495607_0011237_2436_3719 358
70 3300046506 Ga0495583_0090235 Ga0495583_0090235_73_1275 358
71 3300046507 Ga0495606_0000158 Ga0495606_0000158_16869_18077 358
72 3300046507 Ga0495606_0018180 Ga0495606_0018180_3865_5067 358
73 3300046512 Ga0495610_0004029 Ga0495610_0004029_8997_10205 358
74 3300046512 Ga0495610_0016680 Ga0495610_0016680_1969_3177 358
75 3300046513 Ga0495616_0098107 Ga0495616_0098107_126_1358 358
76 3300046522 Ga0495643_0003517 Ga0495643_0003517_7289_8497 358
77 3300046522 Ga0495643_0040532 Ga0495643_0040532_116_1315 358
78 3300046524 Ga0495648_0017529 Ga0495648_0017529_2198_3406 358
79 3300046528 Ga0495642_0020764 Ga0495642_0020764_1195_2448 358
80 3300046528 Ga0495642_0065078 Ga0495642_0065078_121_1323 358
81 3300046542 Ga0495597_0002414 Ga0495597_0002414_3838_5046 358
82 3300046558 Ga0495633_0000128 Ga0495633_0000128_92425_93633 358
83 3300046558 Ga0495633_0001360 Ga0495633_0001360_16955_18163 358
84 3300046558 Ga0495633_0026058 Ga0495633_0026058_480_1691 358
85 3300046558 Ga0495633_0031556 Ga0495633_0031556_162_1370 358
86 3300046616 Ga0495668_0000877 Ga0495668_0000877_29103_30299 358
87 3300046648 Ga0495611_0026976 Ga0495611_0026976_703_1902 358
88 3300046665 Ga0495661_0016165 Ga0495661_0016165_2981_4183 358
89 3300046665 Ga0495661_0051226 Ga0495661_0051226_1330_2484 358
90 3300046690 Ga0495624_0111930 Ga0495624_0111930_22_1221 358
91 3300046692 Ga0495671_0036807 Ga0495671_0036807_491_1729 358
92 3300046694 Ga0495649_0006217 Ga0495649_0006217_2914_4122 358
93 3300047320 Ga0495672_0001747 Ga0495672_0001747_12239_13447 358
94 3300047320 Ga0495672_0093733 Ga0495672_0093733_365_1597 358
95 3300047323 Ga0495683_0011814 Ga0495683_0011814_2427_3626 358
96 3300047443 Ga0495687_005064 Ga0495687_005064_6829_8139 358
97 3300047445 Ga0495677_0000153 Ga0495677_0000153_7032_8225 358
98 3300048906 Ga0496103_0052626 Ga0496103_0052626_1261_2454 358
99 3300048920 Ga0496117_0000010 Ga0496117_0000010_461238_462446 358
100 3300048921 Ga0496118_0000009 Ga0496118_0000009_149509_150717 358
101 3300048924 Ga0496121_0012762 Ga0496121_0012762_841_2049 358
102 3300048925 Ga0496122_0000890 Ga0496122_0000890_4905_6113 358
103 3300048926 Ga0496123_0012751 Ga0496123_0012751_5880_7088 358
104 3300049459 Ga0495678_002747 Ga0495678_002747_7446_8654 358
105 3300053118 Ga0500594_0006196 Ga0500594_0006196_46_1254 358
106 3300053145 Ga0500586_000383 Ga0500586_000383_228_1436 358
107 3300003322 rootL2_10063110 rootL2_100631102 359
108 3300003322 rootL2_10067098 rootL2_100670982 359
109 3300003763 Ga0055529_1000133 Ga0055529_100013371 359
110 3300025272 Ga0209455_1000063 Ga0209455_1000063200 359
111 3300046460 Ga0495638_0047679 Ga0495638_0047679_814_2088 359
112 3300046471 Ga0495650_0000471 Ga0495650_0000471_6501_7772 359
113 3300046660 Ga0495625_0001216 Ga0495625_0001216_28170_29444 359
114 3300048905 Ga0496102_0152570 Ga0496102_0152570_797_2077 359
115 iso_pu_bacteria 2600255292 2601666676 359
116 iso_pu_bacteria 2643221664 2644359398 359
117 iso_pu_bacteria 2738541297 2738825895 359
118 iso_pu_bacteria 2738541300 2738845041 359
119 iso_pu_bacteria 2738541357 2739149692 359
120 iso_pu_bacteria 2738543003 2739191611 359
121 iso_pu_bacteria 2738543018 2739274620 359
122 iso_pu_bacteria 2738543026 2739318088 359
123 iso_pu_bacteria 2738543029 2739336329 359
124 iso_pu_bacteria 2738543030 2739343664 359
125 iso_pu_bacteria 2821131069 2821135537 359
126 iso_pu_bacteria 2857547612 2857548441 359
127 iso_pu_bacteria 2857558681 2857562451 359
128 iso_pu_bacteria 2857564685 2857566297 359
129 iso_pu_bacteria 2885080285 2885084524 359
130 iso_pu_bacteria 2932410948 2932413034 359
131 iso_pu_bacteria 2932416698 2932420549 359
132 3300002739 JGI25158J39367_1001630 JGI25158J39367_10016301 360
133 3300002773 JGI25152J39213_1000096 JGI25152J39213_100009654 360
134 3300002773 JGI25152J39213_1013387 JGI25152J39213_10133872 360
135 3300002987 JGI25159J45721_1007904 JGI25159J45721_10079042 360
136 3300002987 JGI25159J45721_1008079 JGI25159J45721_10080792 360
137 3300002987 JGI25159J45721_1008728 JGI25159J45721_10087281 360
138 3300003354 JGI25160J50197_1008949 JGI25160J50197_10089492 360
139 3300003374 JGI25161J50226_1001618 JGI25161J50226_10016182 360
140 3300003374 JGI25161J50226_1002147 JGI25161J50226_10021472 360
141 3300003771 Ga0055526_1005578 Ga0055526_10055784 360
142 3300003773 Ga0055537_1009231 Ga0055537_10092312 360
143 3300003775 Ga0055524_1000849 Ga0055524_10008494 360
144 3300003775 Ga0055524_1004013 Ga0055524_10040134 360
145 3300003784 Ga0055534_1001824 Ga0055534_10018244 360
146 3300004625 Ga0055543_1002138 Ga0055543_10021382 360
147 3300004625 Ga0055543_1006156 Ga0055543_10061562 360
148 3300005262 Ga0065165_1000067 Ga0065165_10000673 360
149 3300005262 Ga0065165_1005745 Ga0065165_10057452 360
150 3300005339 Ga0070660_100045504 Ga0070660_1000455042 360
151 3300005366 Ga0070659_100060948 Ga0070659_1000609482 360
152 3300005366 Ga0070659_100201045 Ga0070659_1002010452 360
153 3300009036 Ga0105244_10007118 Ga0105244_100071185 360
154 3300009036 Ga0105244_10091378 Ga0105244_100913781 360
155 3300009174 Ga0105241_10030652 Ga0105241_100306522 360
156 3300011119 Ga0105246_10103592 Ga0105246_101035921 360
157 3300013100 Ga0157373_10089898 Ga0157373_100898982 360
158 3300013102 Ga0157371_10000064 Ga0157371_1000006498 360
159 3300013307 Ga0157372_10091094 Ga0157372_100910944 360
160 3300014497 Ga0182008_10004486 Ga0182008_100044861 360
161 3300015265 Ga0182005_1000009 Ga0182005_1000009134 360
162 3300021361 Ga0213872_10013663 Ga0213872_100136632 360
163 3300021361 Ga0213872_10019858 Ga0213872_100198582 360
164 3300025208 Ga0209436_103941 Ga0209436_1039412 360
165 3300025208 Ga0209436_103947 Ga0209436_1039472 360
166 3300025208 Ga0209436_105191 Ga0209436_1051912 360
167 3300025230 Ga0209563_100015 Ga0209563_100015715 360
168 3300025245 Ga0207425_1000006 Ga0207425_1000006639 360
169 3300025245 Ga0207425_1000120 Ga0207425_10001207 360
170 3300025245 Ga0207425_1000360 Ga0207425_100036019 360
171 3300025246 Ga0209646_1000114 Ga0209646_1000114132 360
172 3300025253 Ga0209677_101670 Ga0209677_1016702 360
173 3300025254 Ga0209148_1000552 Ga0209148_10005522 360
174 3300025258 Ga0209129_1000009 Ga0209129_1000009468 360
175 3300025258 Ga0209129_1003889 Ga0209129_10038892 360
176 3300025263 Ga0209565_1000897 Ga0209565_10008977 360
177 3300025273 Ga0209673_1003343 Ga0209673_10033434 360
178 3300025284 Ga0209130_1001240 Ga0209130_100124011 360
179 3300025284 Ga0209130_1001773 Ga0209130_10017737 360
180 3300025284 Ga0209130_1005746 Ga0209130_10057462 360
181 3300025291 Ga0209675_1000963 Ga0209675_10009637 360
182 3300025291 Ga0209675_1001184 Ga0209675_100118411 360
183 3300025295 Ga0209564_1000026 Ga0209564_1000026358 360
184 3300025295 Ga0209564_1000098 Ga0209564_1000098158 360
185 3300025295 Ga0209564_1012609 Ga0209564_10126092 360
186 3300025297 Ga0209758_1000071 Ga0209758_1000071132 360
187 3300025297 Ga0209758_1000372 Ga0209758_100037244 360
188 3300025298 Ga0209050_1000533 Ga0209050_10005332 360
189 3300025298 Ga0209050_1000580 Ga0209050_100058043 360
190 3300025298 Ga0209050_1004901 Ga0209050_10049014 360
191 3300025299 Ga0209256_1000364 Ga0209256_100036465 360
192 3300025299 Ga0209256_1000372 Ga0209256_100037247 360
193 3300025302 Ga0207426_1012125 Ga0207426_10121252 360
194 3300025304 Ga0209257_1000010 Ga0209257_1000010156 360
195 3300025909 Ga0207705_10009664 Ga0207705_100096643 360
196 3300025911 Ga0207654_10010900 Ga0207654_100109002 360
197 3300025917 Ga0207660_10032202 Ga0207660_100322022 360
198 3300025919 Ga0207657_10013850 Ga0207657_100138504 360
199 3300025919 Ga0207657_10083400 Ga0207657_100834002 360
200 3300025932 Ga0207690_10077699 Ga0207690_100776992 360
201 3300025934 Ga0207686_10036705 Ga0207686_100367052 360
202 3300026142 Ga0207698_10022054 Ga0207698_100220542 360
203 3300031548 Ga0307408_100000815 Ga0307408_1000008152 360
204 3300031548 Ga0307408_100062441 Ga0307408_1000624412 360
205 3300032002 Ga0307416_100006441 Ga0307416_1000064415 360
206 3300032004 Ga0307414_10045060 Ga0307414_100450602 360
207 3300037312 Ga0395899_0050864 Ga0395899_0050864_388_1662 360
208 3300037418 Ga0395900_0011570 Ga0395900_0011570_3710_4984 360
209 3300037418 Ga0395900_0135904 Ga0395900_0135904_727_2001 360
210 3300037471 Ga0395905_0107549 Ga0395905_0107549_1146_2420 360
211 3300038443 Ga0395901_0021161 Ga0395901_0021161_2377_3651 360
212 3300038443 Ga0395901_0101473 Ga0395901_0101473_437_1711 360
213 3300038443 Ga0395901_0301444 Ga0395901_0301444_261_1535 360
214 3300038443 Ga0395901_0402819 Ga0395901_0402819_76_1350 360
215 3300039447 Ga0436361_0066547 Ga0436361_0066547_531_1817 360
216 3300042008 Ga0439450_002931 Ga0439450_002931_806_2080 360
217 3300042012 Ga0439455_0008760 Ga0439455_0008760_537_1805 360
218 3300044683 Ga0466965_0007512 Ga0466965_0007512_1467_2741 360
219 3300044684 Ga0466966_0014551 Ga0466966_0014551_3568_4842 360
220 3300044694 Ga0466963_0065407 Ga0466963_0065407_463_1737 360
221 3300044706 Ga0466964_0002855 Ga0466964_0002855_2598_3872 360
222 3300044706 Ga0466964_0013187 Ga0466964_0013187_1151_2425 360
223 3300044706 Ga0466964_0023097 Ga0466964_0023097_250_1527 360
224 3300044719 Ga0466971_0023642 Ga0466971_0023642_239_1513 360
225 3300044735 Ga0466968_0000137 Ga0466968_0000137_2858_4132 360
226 3300044765 Ga0466970_0143871 Ga0466970_0143871_24_1298 360
227 3300044842 Ga0466957_0001441 Ga0466957_0001441_7032_8306 360
228 3300044842 Ga0466957_0004280 Ga0466957_0004280_5459_6730 360
229 3300044842 Ga0466957_0031056 Ga0466957_0031056_825_2099 360
230 3300045836 Ga0466958_0018456 Ga0466958_0018456_2548_3822 360
231 3300045976 Ga0466967_0011693 Ga0466967_0011693_3139_4413 360
232 3300045976 Ga0466967_0146695 Ga0466967_0146695_676_1950 360
233 3300046453 Ga0495627_001512 Ga0495627_001512_6702_7976 360
234 3300046453 Ga0495627_019018 Ga0495627_019018_150_1424 360
235 3300046455 Ga0495603_0014495 Ga0495603_0014495_3471_4745 360
236 3300046457 Ga0495590_0000436 Ga0495590_0000436_2321_3601 360
237 3300046457 Ga0495590_0001044 Ga0495590_0001044_3451_4725 360
238 3300046458 Ga0495591_000439 Ga0495591_000439_7378_8652 360
239 3300046459 Ga0495629_0008053 Ga0495629_0008053_2673_3953 360
240 3300046459 Ga0495629_0053327 Ga0495629_0053327_861_2135 360
241 3300046459 Ga0495629_0064677 Ga0495629_0064677_665_1945 360
242 3300046460 Ga0495638_0027319 Ga0495638_0027319_1578_2852 360
243 3300046460 Ga0495638_0102509 Ga0495638_0102509_286_1566 360
244 3300046463 Ga0495653_0000018 Ga0495653_0000018_54753_56036 360
245 3300046463 Ga0495653_0022260 Ga0495653_0022260_1873_3153 360
246 3300046463 Ga0495653_0074754 Ga0495653_0074754_315_1595 360
247 3300046463 Ga0495653_0103998 Ga0495653_0103998_514_1788 360
248 3300046471 Ga0495650_0000173 Ga0495650_0000173_33971_35245 360
249 3300046471 Ga0495650_0000305 Ga0495650_0000305_80828_82111 360
250 3300046471 Ga0495650_0000499 Ga0495650_0000499_51498_52772 360
251 3300046471 Ga0495650_0004033 Ga0495650_0004033_8100_9377 360
252 3300046472 Ga0495580_0055621 Ga0495580_0055621_241_1521 360
253 3300046473 Ga0495582_0003088 Ga0495582_0003088_2195_3475 360
254 3300046473 Ga0495582_0005236 Ga0495582_0005236_4460_5734 360
255 3300046473 Ga0495582_0021208 Ga0495582_0021208_152_1432 360
256 3300046473 Ga0495582_0036853 Ga0495582_0036853_621_1901 360
257 3300046474 Ga0495605_0000005 Ga0495605_0000005_124016_125296 360
258 3300046474 Ga0495605_0000317 Ga0495605_0000317_6904_8178 360
259 3300046474 Ga0495605_0000351 Ga0495605_0000351_6755_8029 360
260 3300046474 Ga0495605_0013403 Ga0495605_0013403_795_2069 360
261 3300046477 Ga0495664_0060213 Ga0495664_0060213_147_1427 360
262 3300046491 Ga0495584_0001019 Ga0495584_0001019_13210_14484 360
263 3300046491 Ga0495584_0001567 Ga0495584_0001567_7399_8673 360
264 3300046491 Ga0495584_0003368 Ga0495584_0003368_1092_2366 360
265 3300046491 Ga0495584_0004556 Ga0495584_0004556_3969_5240 360
266 3300046491 Ga0495584_0005686 Ga0495584_0005686_4291_5571 360
267 3300046491 Ga0495584_0013605 Ga0495584_0013605_145_1419 360
268 3300046491 Ga0495584_0018742 Ga0495584_0018742_663_1940 360
269 3300046491 Ga0495584_0041717 Ga0495584_0041717_836_2122 360
270 3300046491 Ga0495584_0058026 Ga0495584_0058026_133_1413 360
271 3300046491 Ga0495584_0078556 Ga0495584_0078556_17_1291 360
272 3300046492 Ga0495585_0000886 Ga0495585_0000886_5939_7213 360
273 3300046492 Ga0495585_0002670 Ga0495585_0002670_7238_8524 360
274 3300046492 Ga0495585_0002940 Ga0495585_0002940_3950_5224 360
275 3300046492 Ga0495585_0003837 Ga0495585_0003837_1967_3253 360
276 3300046492 Ga0495585_0006663 Ga0495585_0006663_1886_3172 360
277 3300046492 Ga0495585_0014231 Ga0495585_0014231_2401_3675 360
278 3300046492 Ga0495585_0015089 Ga0495585_0015089_1814_3091 360
279 3300046492 Ga0495585_0022692 Ga0495585_0022692_1482_2768 360
280 3300046492 Ga0495585_0028949 Ga0495585_0028949_1157_2431 360
281 3300046492 Ga0495585_0056638 Ga0495585_0056638_749_2032 360
282 3300046492 Ga0495585_0083901 Ga0495585_0083901_125_1408 360
283 3300046492 Ga0495585_0094104 Ga0495585_0094104_211_1485 360
284 3300046499 Ga0495594_0001677 Ga0495594_0001677_10009_11283 360
285 3300046499 Ga0495594_0008003 Ga0495594_0008003_3871_5145 360
286 3300046499 Ga0495594_0020073 Ga0495594_0020073_1716_2990 360
287 3300046500 Ga0495596_0001463 Ga0495596_0001463_4549_5823 360
288 3300046500 Ga0495596_0003850 Ga0495596_0003850_2678_3955 360
289 3300046500 Ga0495596_0007371 Ga0495596_0007371_3254_4540 360
290 3300046500 Ga0495596_0010358 Ga0495596_0010358_2540_3814 360
291 3300046500 Ga0495596_0013270 Ga0495596_0013270_1854_3131 360
292 3300046500 Ga0495596_0024401 Ga0495596_0024401_457_1737 360
293 3300046500 Ga0495596_0030370 Ga0495596_0030370_822_2096 360
294 3300046501 Ga0495607_0000409 Ga0495607_0000409_2690_3964 360
295 3300046501 Ga0495607_0005945 Ga0495607_0005945_6113_7384 360
296 3300046501 Ga0495607_0012586 Ga0495607_0012586_680_1954 360
297 3300046501 Ga0495607_0018901 Ga0495607_0018901_1087_2361 360
298 3300046501 Ga0495607_0051792 Ga0495607_0051792_211_1485 360
299 3300046501 Ga0495607_0063156 Ga0495607_0063156_127_1410 360
300 3300046506 Ga0495583_0000268 Ga0495583_0000268_41597_42883 360
301 3300046506 Ga0495583_0000590 Ga0495583_0000590_42540_43814 360
302 3300046506 Ga0495583_0003724 Ga0495583_0003724_3379_4659 360
303 3300046506 Ga0495583_0010322 Ga0495583_0010322_3318_4592 360
304 3300046506 Ga0495583_0021550 Ga0495583_0021550_1975_3246 360
305 3300046506 Ga0495583_0023339 Ga0495583_0023339_192_1466 360
306 3300046506 Ga0495583_0039690 Ga0495583_0039690_247_1521 360
307 3300046507 Ga0495606_0000547 Ga0495606_0000547_3954_5237 360
308 3300046507 Ga0495606_0001026 Ga0495606_0001026_3756_5036 360
309 3300046507 Ga0495606_0008570 Ga0495606_0008570_690_1964 360
310 3300046507 Ga0495606_0014187 Ga0495606_0014187_3128_4408 360
311 3300046512 Ga0495610_0006450 Ga0495610_0006450_5399_6673 360
312 3300046512 Ga0495610_0018723 Ga0495610_0018723_129_1412 360
313 3300046513 Ga0495616_0000052 Ga0495616_0000052_29456_30736 360
314 3300046513 Ga0495616_0004974 Ga0495616_0004974_5997_7283 360
315 3300046513 Ga0495616_0009112 Ga0495616_0009112_3865_5136 360
316 3300046513 Ga0495616_0009223 Ga0495616_0009223_670_1944 360
317 3300046513 Ga0495616_0009470 Ga0495616_0009470_3012_4286 360
318 3300046513 Ga0495616_0014880 Ga0495616_0014880_1886_3172 360
319 3300046513 Ga0495616_0016899 Ga0495616_0016899_491_1765 360
320 3300046513 Ga0495616_0018827 Ga0495616_0018827_2278_3552 360
321 3300046513 Ga0495616_0043258 Ga0495616_0043258_696_1970 360
322 3300046513 Ga0495616_0057865 Ga0495616_0057865_361_1635 360
323 3300046513 Ga0495616_0061367 Ga0495616_0061367_508_1791 360
324 3300046513 Ga0495616_0074038 Ga0495616_0074038_85_1365 360
325 3300046515 Ga0495620_0001372 Ga0495620_0001372_4347_5633 360
326 3300046517 Ga0495630_0010240 Ga0495630_0010240_5259_6539 360
327 3300046518 Ga0495631_0001914 Ga0495631_0001914_6736_8010 360
328 3300046518 Ga0495631_0004798 Ga0495631_0004798_3051_4325 360
329 3300046518 Ga0495631_0013050 Ga0495631_0013050_714_1988 360
330 3300046518 Ga0495631_0045229 Ga0495631_0045229_178_1452 360
331 3300046518 Ga0495631_0047101 Ga0495631_0047101_581_1858 360
332 3300046519 Ga0495632_0000260 Ga0495632_0000260_19787_21061 360
333 3300046519 Ga0495632_0000289 Ga0495632_0000289_43609_44883 360
334 3300046519 Ga0495632_0000625 Ga0495632_0000625_24981_26255 360
335 3300046519 Ga0495632_0010491 Ga0495632_0010491_3910_5184 360
336 3300046519 Ga0495632_0045181 Ga0495632_0045181_176_1450 360
337 3300046520 Ga0495637_0000014 Ga0495637_0000014_142107_143381 360
338 3300046520 Ga0495637_0000057 Ga0495637_0000057_78603_79886 360
339 3300046520 Ga0495637_0002195 Ga0495637_0002195_2089_3369 360
340 3300046520 Ga0495637_0048349 Ga0495637_0048349_66_1340 360
341 3300046522 Ga0495643_0000569 Ga0495643_0000569_6711_7985 360
342 3300046522 Ga0495643_0003240 Ga0495643_0003240_3244_4518 360
343 3300046522 Ga0495643_0005048 Ga0495643_0005048_3911_5185 360
344 3300046522 Ga0495643_0016136 Ga0495643_0016136_2630_3904 360
345 3300046522 Ga0495643_0030355 Ga0495643_0030355_1004_2278 360
346 3300046522 Ga0495643_0042957 Ga0495643_0042957_289_1563 360
347 3300046523 Ga0495644_0009441 Ga0495644_0009441_391_1665 360
348 3300046523 Ga0495644_0021280 Ga0495644_0021280_304_1578 360
349 3300046523 Ga0495644_0032052 Ga0495644_0032052_695_1969 360
350 3300046524 Ga0495648_0000117 Ga0495648_0000117_43141_44427 360
351 3300046524 Ga0495648_0008325 Ga0495648_0008325_2578_3852 360
352 3300046524 Ga0495648_0056834 Ga0495648_0056834_153_1433 360
353 3300046526 Ga0495666_0021452 Ga0495666_0021452_272_1552 360
354 3300046526 Ga0495666_0032654 Ga0495666_0032654_443_1723 360
355 3300046526 Ga0495666_0068104 Ga0495666_0068104_288_1568 360
356 3300046528 Ga0495642_0000211 Ga0495642_0000211_26755_28029 360
357 3300046528 Ga0495642_0000512 Ga0495642_0000512_18277_19551 360
358 3300046528 Ga0495642_0001174 Ga0495642_0001174_2507_3793 360
359 3300046528 Ga0495642_0007490 Ga0495642_0007490_607_1884 360
360 3300046528 Ga0495642_0010579 Ga0495642_0010579_1475_2749 360
361 3300046528 Ga0495642_0017587 Ga0495642_0017587_720_1994 360
362 3300046528 Ga0495642_0024984 Ga0495642_0024984_938_2212 360
363 3300046529 Ga0495652_0046571 Ga0495652_0046571_1015_2295 360
364 3300046529 Ga0495652_0114262 Ga0495652_0114262_858_2138 360
365 3300046530 Ga0495654_0000005 Ga0495654_0000005_113644_114927 360
366 3300046530 Ga0495654_0009150 Ga0495654_0009150_1575_2849 360
367 3300046530 Ga0495654_0015707 Ga0495654_0015707_1373_2647 360
368 3300046530 Ga0495654_0037432 Ga0495654_0037432_580_1854 360
369 3300046531 Ga0495665_0022282 Ga0495665_0022282_1237_2517 360
370 3300046531 Ga0495665_0023645 Ga0495665_0023645_1263_2543 360
371 3300046531 Ga0495665_0081218 Ga0495665_0081218_60_1340 360
372 3300046533 Ga0495640_0039492 Ga0495640_0039492_676_1956 360
373 3300046533 Ga0495640_0061287 Ga0495640_0061287_391_1665 360
374 3300046535 Ga0495586_0048702 Ga0495586_0048702_461_1741 360
375 3300046536 Ga0495587_0016261 Ga0495587_0016261_1139_2419 360
376 3300046536 Ga0495587_0031609 Ga0495587_0031609_1782_3062 360
377 3300046538 Ga0495609_0000028 Ga0495609_0000028_119071_120345 360
378 3300046538 Ga0495609_0000663 Ga0495609_0000663_6863_8134 360
379 3300046538 Ga0495609_0001184 Ga0495609_0001184_11170_12444 360
380 3300046538 Ga0495609_0002622 Ga0495609_0002622_753_2057 360
381 3300046538 Ga0495609_0007655 Ga0495609_0007655_744_2018 360
382 3300046538 Ga0495609_0009236 Ga0495609_0009236_782_2062 360
383 3300046538 Ga0495609_0030766 Ga0495609_0030766_781_2052 360
384 3300046538 Ga0495609_0064651 Ga0495609_0064651_197_1477 360
385 3300046542 Ga0495597_0000908 Ga0495597_0000908_21345_22622 360
386 3300046542 Ga0495597_0001649 Ga0495597_0001649_8482_9756 360
387 3300046542 Ga0495597_0001913 Ga0495597_0001913_535_1812 360
388 3300046542 Ga0495597_0006518 Ga0495597_0006518_3644_4927 360
389 3300046542 Ga0495597_0027877 Ga0495597_0027877_890_2173 360
390 3300046557 Ga0495622_0058124 Ga0495622_0058124_52_1332 360
391 3300046557 Ga0495622_0063429 Ga0495622_0063429_18_1292 360
392 3300046558 Ga0495633_0011167 Ga0495633_0011167_1583_2857 360
393 3300046558 Ga0495633_0012302 Ga0495633_0012302_2495_3769 360
394 3300046558 Ga0495633_0013096 Ga0495633_0013096_3091_4368 360
395 3300046558 Ga0495633_0015191 Ga0495633_0015191_49_1326 360
396 3300046558 Ga0495633_0018665 Ga0495633_0018665_772_2055 360
397 3300046558 Ga0495633_0030398 Ga0495633_0030398_1166_2440 360
398 3300046558 Ga0495633_0039722 Ga0495633_0039722_89_1363 360
399 3300046558 Ga0495633_0064691 Ga0495633_0064691_18_1292 360
400 3300046615 Ga0495656_0015846 Ga0495656_0015846_208_1512 360
401 3300046615 Ga0495656_0020293 Ga0495656_0020293_215_1489 360
402 3300046616 Ga0495668_0000008 Ga0495668_0000008_333649_334920 360
403 3300046616 Ga0495668_0000482 Ga0495668_0000482_20621_21904 360
404 3300046616 Ga0495668_0000508 Ga0495668_0000508_40862_42136 360
405 3300046616 Ga0495668_0006425 Ga0495668_0006425_5887_7164 360
406 3300046616 Ga0495668_0008854 Ga0495668_0008854_2384_3670 360
407 3300046616 Ga0495668_0009043 Ga0495668_0009043_1380_2654 360
408 3300046616 Ga0495668_0011066 Ga0495668_0011066_1343_2617 360
409 3300046616 Ga0495668_0019720 Ga0495668_0019720_60_1331 360
410 3300046616 Ga0495668_0026679 Ga0495668_0026679_297_1571 360
411 3300046642 Ga0495634_0006065 Ga0495634_0006065_3880_5160 360
412 3300046642 Ga0495634_0022247 Ga0495634_0022247_429_1709 360
413 3300046648 Ga0495611_0000320 Ga0495611_0000320_25268_26542 360
414 3300046648 Ga0495611_0006456 Ga0495611_0006456_1716_2996 360
415 3300046648 Ga0495611_0006713 Ga0495611_0006713_1892_3172 360
416 3300046648 Ga0495611_0016039 Ga0495611_0016039_725_2029 360
417 3300046648 Ga0495611_0032084 Ga0495611_0032084_99_1385 360
418 3300046660 Ga0495625_0002285 Ga0495625_0002285_135_1409 360
419 3300046660 Ga0495625_0006157 Ga0495625_0006157_3460_4743 360
420 3300046660 Ga0495625_0006717 Ga0495625_0006717_6954_8225 360
421 3300046660 Ga0495625_0009146 Ga0495625_0009146_3766_5043 360
422 3300046660 Ga0495625_0012440 Ga0495625_0012440_2427_3707 360
423 3300046660 Ga0495625_0019958 Ga0495625_0019958_1219_2499 360
424 3300046660 Ga0495625_0105397 Ga0495625_0105397_101_1378 360
425 3300046664 Ga0495659_0000015 Ga0495659_0000015_67483_68766 360
426 3300046664 Ga0495659_0000607 Ga0495659_0000607_2845_4116 360
427 3300046664 Ga0495659_0008358 Ga0495659_0008358_728_2032 360
428 3300046665 Ga0495661_0000641 Ga0495661_0000641_3143_4417 360
429 3300046665 Ga0495661_0001197 Ga0495661_0001197_6972_8246 360
430 3300046665 Ga0495661_0005796 Ga0495661_0005796_996_2270 360
431 3300046665 Ga0495661_0007519 Ga0495661_0007519_3958_5232 360
432 3300046665 Ga0495661_0009379 Ga0495661_0009379_2858_4144 360
433 3300046665 Ga0495661_0010125 Ga0495661_0010125_4943_6217 360
434 3300046665 Ga0495661_0015757 Ga0495661_0015757_2393_3667 360
435 3300046665 Ga0495661_0017567 Ga0495661_0017567_1764_3038 360
436 3300046665 Ga0495661_0047104 Ga0495661_0047104_761_2038 360
437 3300046665 Ga0495661_0066028 Ga0495661_0066028_53_1324 360
438 3300046665 Ga0495661_0073028 Ga0495661_0073028_256_1530 360
439 3300046674 Ga0495588_0023124 Ga0495588_0023124_1312_2586 360
440 3300046680 Ga0495646_0010340 Ga0495646_0010340_788_2068 360
441 3300046684 Ga0495669_0000756 Ga0495669_0000756_10052_11326 360
442 3300046684 Ga0495669_0001014 Ga0495669_0001014_3421_4695 360
443 3300046684 Ga0495669_0007957 Ga0495669_0007957_1844_3121 360
444 3300046684 Ga0495669_0012146 Ga0495669_0012146_531_1805 360
445 3300046690 Ga0495624_0071573 Ga0495624_0071573_440_1720 360
446 3300046691 Ga0495670_0002581 Ga0495670_0002581_7529_8803 360
447 3300046691 Ga0495670_0003328 Ga0495670_0003328_1999_3285 360
448 3300046691 Ga0495670_0006407 Ga0495670_0006407_2065_3351 360
449 3300046691 Ga0495670_0007683 Ga0495670_0007683_729_2009 360
450 3300046691 Ga0495670_0012036 Ga0495670_0012036_2574_3848 360
451 3300046691 Ga0495670_0035041 Ga0495670_0035041_606_1880 360
452 3300046691 Ga0495670_0048541 Ga0495670_0048541_418_1701 360
453 3300046691 Ga0495670_0098233 Ga0495670_0098233_214_1488 360
454 3300046692 Ga0495671_0000550 Ga0495671_0000550_18878_20161 360
455 3300046692 Ga0495671_0001227 Ga0495671_0001227_15668_16942 360
456 3300046694 Ga0495649_0000094 Ga0495649_0000094_8887_10161 360
457 3300046694 Ga0495649_0012185 Ga0495649_0012185_3577_4851 360
458 3300046694 Ga0495649_0014759 Ga0495649_0014759_351_1625 360
459 3300046694 Ga0495649_0034751 Ga0495649_0034751_193_1464 360
460 3300046794 Ga0495589_0000113 Ga0495589_0000113_35129_36403 360
461 3300046794 Ga0495589_0000178 Ga0495589_0000178_43230_44504 360
462 3300046794 Ga0495589_0007144 Ga0495589_0007144_3187_4461 360
463 3300046794 Ga0495589_0013053 Ga0495589_0013053_2853_4127 360
464 3300046794 Ga0495589_0013136 Ga0495589_0013136_2810_4084 360
465 3300046794 Ga0495589_0015167 Ga0495589_0015167_2232_3506 360
466 3300046794 Ga0495589_0017723 Ga0495589_0017723_1088_2362 360
467 3300046794 Ga0495589_0032332 Ga0495589_0032332_1143_2417 360
468 3300046794 Ga0495589_0034833 Ga0495589_0034833_736_2016 360
469 3300046809 Ga0495600_0021253 Ga0495600_0021253_2169_3449 360
470 3300046809 Ga0495600_0047082 Ga0495600_0047082_939_2219 360
471 3300046810 Ga0495660_0001650 Ga0495660_0001650_8660_9934 360
472 3300046810 Ga0495660_0001922 Ga0495660_0001922_7118_8389 360
473 3300046810 Ga0495660_0036166 Ga0495660_0036166_554_1840 360
474 3300046810 Ga0495660_0042211 Ga0495660_0042211_524_1795 360
475 3300046810 Ga0495660_0063968 Ga0495660_0063968_505_1779 360
476 3300047315 Ga0495581_0001885 Ga0495581_0001885_6437_7711 360
477 3300047315 Ga0495581_0021534 Ga0495581_0021534_836_2116 360
478 3300047315 Ga0495581_0031588 Ga0495581_0031588_551_1831 360
479 3300047317 Ga0495604_0005712 Ga0495604_0005712_1645_2925 360
480 3300047317 Ga0495604_0016197 Ga0495604_0016197_3021_4295 360
481 3300047317 Ga0495604_0025748 Ga0495604_0025748_2169_3449 360
482 3300047318 Ga0495636_0000231 Ga0495636_0000231_15283_16587 360
483 3300047319 Ga0495674_0003592 Ga0495674_0003592_11667_12947 360
484 3300047320 Ga0495672_0000140 Ga0495672_0000140_5786_7060 360
485 3300047320 Ga0495672_0000471 Ga0495672_0000471_42880_44154 360
486 3300047320 Ga0495672_0000521 Ga0495672_0000521_35955_37229 360
487 3300047320 Ga0495672_0011053 Ga0495672_0011053_3008_4282 360
488 3300047320 Ga0495672_0016520 Ga0495672_0016520_1271_2545 360
489 3300047321 Ga0495676_0000180 Ga0495676_0000180_11269_12543 360
490 3300047321 Ga0495676_0016225 Ga0495676_0016225_5316_6593 360
491 3300047321 Ga0495676_0033872 Ga0495676_0033872_79_1359 360
492 3300047322 Ga0495680_0004699 Ga0495680_0004699_6836_8110 360
493 3300047322 Ga0495680_0177601 Ga0495680_0177601_53_1333 360
494 3300047323 Ga0495683_0000275 Ga0495683_0000275_2907_4193 360
495 3300047323 Ga0495683_0001831 Ga0495683_0001831_7379_8653 360
496 3300047323 Ga0495683_0006505 Ga0495683_0006505_2553_3827 360
497 3300047323 Ga0495683_0013933 Ga0495683_0013933_1406_2680 360
498 3300047323 Ga0495683_0017864 Ga0495683_0017864_1186_2460 360
499 3300047443 Ga0495687_000054 Ga0495687_000054_153114_154388 360
500 3300047443 Ga0495687_000060 Ga0495687_000060_171170_172444 360
501 3300047443 Ga0495687_000487 Ga0495687_000487_36958_38262 360
502 3300047443 Ga0495687_000759 Ga0495687_000759_8498_9772 360
503 3300047443 Ga0495687_001790 Ga0495687_001790_6952_8226 360
504 3300047443 Ga0495687_007428 Ga0495687_007428_5098_6369 360
505 3300047444 Ga0495675_0001798 Ga0495675_0001798_6623_7903 360
506 3300047444 Ga0495675_0096489 Ga0495675_0096489_519_1793 360
507 3300047445 Ga0495677_0000084 Ga0495677_0000084_40061_41335 360
508 3300047445 Ga0495677_0001191 Ga0495677_0001191_4362_5636 360
509 3300047445 Ga0495677_0001337 Ga0495677_0001337_5356_6630 360
510 3300047445 Ga0495677_0002830 Ga0495677_0002830_374_1648 360
511 3300047445 Ga0495677_0004612 Ga0495677_0004612_3368_4648 360
512 3300047445 Ga0495677_0005513 Ga0495677_0005513_1186_2460 360
513 3300047445 Ga0495677_0005852 Ga0495677_0005852_1063_2367 360
514 3300047445 Ga0495677_0012567 Ga0495677_0012567_1390_2664 360
515 3300047445 Ga0495677_0013561 Ga0495677_0013561_612_1883 360
516 3300047445 Ga0495677_0019351 Ga0495677_0019351_1178_2452 360
517 3300047445 Ga0495677_0037064 Ga0495677_0037064_49_1326 360
518 3300047445 Ga0495677_0056876 Ga0495677_0056876_68_1342 360
519 3300047446 Ga0495679_009077 Ga0495679_009077_2178_3452 360
520 3300047446 Ga0495679_017515 Ga0495679_017515_24_1298 360
521 3300047446 Ga0495679_018374 Ga0495679_018374_1163_2434 360
522 3300047447 Ga0495685_000132 Ga0495685_000132_3454_4758 360
523 3300047469 Ga0495673_0000033 Ga0495673_0000033_119438_120718 360
524 3300047469 Ga0495673_0000034 Ga0495673_0000034_195765_197045 360
525 3300047469 Ga0495673_0012118 Ga0495673_0012118_771_2051 360
526 3300047470 Ga0495681_0004186 Ga0495681_0004186_5136_6410 360
527 3300047470 Ga0495681_0010114 Ga0495681_0010114_1038_2312 360
528 3300047470 Ga0495681_0016302 Ga0495681_0016302_1489_2763 360
529 3300047470 Ga0495681_0021452 Ga0495681_0021452_719_1996 360
530 3300047470 Ga0495681_0051011 Ga0495681_0051011_631_1902 360
531 3300047472 Ga0495686_0000778 Ga0495686_0000778_7363_8637 360
532 3300047472 Ga0495686_0024963 Ga0495686_0024963_1645_2916 360
533 3300047673 Ga0495593_0002068 Ga0495593_0002068_8705_9979 360
534 3300047673 Ga0495593_0012240 Ga0495593_0012240_2254_3534 360
535 3300047673 Ga0495593_0023976 Ga0495593_0023976_745_2025 360
536 3300048088 Ga0495602_0098508 Ga0495602_0098508_575_1855 360
537 3300048089 Ga0495614_0008781 Ga0495614_0008781_1077_2351 360
538 3300048091 Ga0495626_0000036 Ga0495626_0000036_34712_35986 360
539 3300048091 Ga0495626_0000044 Ga0495626_0000044_38004_39278 360
540 3300048091 Ga0495626_0003205 Ga0495626_0003205_7061_8341 360
541 3300048091 Ga0495626_0005156 Ga0495626_0005156_442_1722 360
542 3300048091 Ga0495626_0013428 Ga0495626_0013428_956_2236 360
543 3300048091 Ga0495626_0013652 Ga0495626_0013652_776_2050 360
544 3300048091 Ga0495626_0016398 Ga0495626_0016398_470_1744 360
545 3300048091 Ga0495626_0078403 Ga0495626_0078403_180_1454 360
546 3300048903 Ga0496100_0179965 Ga0496100_0179965_115_1389 360
547 3300048904 Ga0496101_0186426 Ga0496101_0186426_285_1559 360
548 3300048905 Ga0496102_0000192 Ga0496102_0000192_56540_57823 360
549 3300048905 Ga0496102_0000422 Ga0496102_0000422_40390_41664 360
550 3300048905 Ga0496102_0036852 Ga0496102_0036852_1073_2347 360
551 3300048905 Ga0496102_0048912 Ga0496102_0048912_1455_2714 360
552 3300048909 Ga0496106_0030819 Ga0496106_0030819_483_1757 360
553 3300048912 Ga0496109_0012456 Ga0496109_0012456_2526_3800 360
554 3300048912 Ga0496109_0134233 Ga0496109_0134233_143_1402 360
555 3300048913 Ga0496110_0000734 Ga0496110_0000734_20300_21574 360
556 3300048913 Ga0496110_0095287 Ga0496110_0095287_855_2129 360
557 3300048916 Ga0496113_0064613 Ga0496113_0064613_186_1460 360
558 3300048917 Ga0496114_0028311 Ga0496114_0028311_2248_3528 360
559 3300048917 Ga0496114_0067420 Ga0496114_0067420_196_1497 360
560 3300048924 Ga0496121_0088534 Ga0496121_0088534_1107_2381 360
561 3300048925 Ga0496122_0018994 Ga0496122_0018994_1765_3048 360
562 3300048925 Ga0496122_0042474 Ga0496122_0042474_1206_2480 360
563 3300048925 Ga0496122_0079062 Ga0496122_0079062_54_1328 360
564 3300048926 Ga0496123_0000780 Ga0496123_0000780_42792_44066 360
565 3300048926 Ga0496123_0003373 Ga0496123_0003373_7049_8332 360
566 3300048926 Ga0496123_0007610 Ga0496123_0007610_2449_3723 360
567 3300048927 Ga0496124_0018686 Ga0496124_0018686_3183_4457 360
568 3300048927 Ga0496124_0023423 Ga0496124_0023423_181_1455 360
569 3300048927 Ga0496124_0080459 Ga0496124_0080459_361_1641 360
570 3300048928 Ga0496125_0000870 Ga0496125_0000870_40957_42231 360
571 3300048928 Ga0496125_0000897 Ga0496125_0000897_39620_40900 360
572 3300048929 Ga0496126_0010190 Ga0496126_0010190_1178_2458 360
573 3300049459 Ga0495678_000150 Ga0495678_000150_40642_41916 360
574 3300049459 Ga0495678_000327 Ga0495678_000327_42583_43857 360
575 3300049459 Ga0495678_002960 Ga0495678_002960_3415_4719 360
576 3300049459 Ga0495678_006295 Ga0495678_006295_2382_3656 360
577 3300049460 Ga0495682_0005854 Ga0495682_0005854_1487_2767 360
578 3300049460 Ga0495682_0007809 Ga0495682_0007809_175_1449 360
579 iso_pu_bacteria 2643221554 2643789133 360
580 iso_pu_bacteria 2643221556 2643800482 360
581 iso_pu_bacteria 2643221638 2644215073 360
582 iso_pu_bacteria 2643221684 2644470391 360
583 iso_pu_bacteria 8047673197 8047678782 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

19

226

0.87

PF07690

MFS_1

Major Facilitator Superfamily

50

401

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.9095 1 353
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.8806 1 353
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8392 1 357
5ayn-assembly1.cif.gz_A crystal structure of a bacterial homologue of iron transporter ferroportin in outward-facing state 0.8137 2 352
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.8105 3 351
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9426 7 144 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9346 1 161 1.20.1250.20
af_P37597_7_380_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9249 1 347 1.20.1250.20
af_P9WJY3_11_221_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9162 5 150 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9134 1 162 1.20.1250.20
ID Description Score Start End GO Terms
AF-A2SCX4-F1-model_v4 Bcr/CflA family efflux transporter 0.9889 7 352 GO:0005886
GO:0042910
GO:1990961
AF-A0A0R2VFG6-F1-model_v4 Bcr/CflA family efflux transporter 0.9846 1 346 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A7Y7LFS9-F1-model_v4 deleted 0.9802 1 357
AF-A0A561BH73-F1-model_v4 Bcr/CflA family efflux transporter 0.9799 1 357 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A3N5N9R6-F1-model_v4 Bcr/CflA family efflux transporter 0.9781 1 360 GO:0005886
GO:0042910
GO:1990961

Feature Viewer

pLDDT pTM Quality
90.26 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map