F466310

General Info

Members Datasets Scaffolds Average Seq Length
583 361 1166 400

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0175612|Ga0496102_0175612_372_1721
Length 449
Sequence MARQPAGCLPQAVIGQRARRAAQDVPTNVAEPFQSRIHSLRISRWAGIFMNKLSLPLSGIRVLDLSRVLAGPSCAMVLGDFGAEVIKVEHPRRGDDTRDWGSRIGSTQTAYFNSVNRNKRSVTLDLQTDEGQRLALALAAQCDVVIQNFKAGGAEKMGLGYAQIKAVRPDVVYCSISGYDRTGPEAARPGYDLLVQGEAGLMAMNGKADQPPLKFGVAVVDLFTGMYAAQAVLAALFERRRTGDGRHLEMALYDCGIMVTTYYGLEALLLEKDPPRYGNSHPSIVPYGVFDAADGPLVITVGNNSQFGRFCREVIERPELADDERFKTNVLRTANRAALLSQIVPALRCQPRSELMQRLASAGIPCGEVLGLHEALTSERTARGGLVTQQPHPEVGSVQVLAPPYRLDGERLPVRRPPPVLGEGVQDVLSGLLGLDQAELQHLKANGVI

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
115 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
116 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
261 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
262 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
263 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
264 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
265 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
266 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
267 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
268 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
269 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
270 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
271 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
272 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
273 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
274 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
275 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
276 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
277 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
278 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
279 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
280 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
281 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
282 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
283 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
284 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
285 2643221658 Variovorax sp. Root411 Isolate Unclassified
286 2643221672 Variovorax sp. Root434 Isolate Unclassified
287 2643221683 Variovorax sp. Root473 Isolate Unclassified
288 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
289 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
290 2738541277 Variovorax sp. GV051 Isolate Unclassified
291 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
292 2738541307 Variovorax sp. GV008 Isolate Unclassified
293 2738543019 Variovorax sp. GV040 Isolate Unclassified
294 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
295 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
296 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
297 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
298 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
299 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
300 2818991446 Variovorax sp. 1180 Isolate Unclassified
301 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
302 2818991452 Burkholderia cepacia 561 Isolate Unclassified
303 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
304 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
305 2842677519 Variovorax sp. R-72495 Isolate Unclassified
306 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
307 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
308 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
309 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
310 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
311 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
312 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
313 2885198086 Variovorax sp. 679 Isolate Unclassified
314 2885211737 Variovorax sp. 553 Isolate Unclassified
315 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
316 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
317 2899924645 Variovorax sp. 369 Isolate Unclassified
318 2902330777 Methylobacterium sp. 2A Isolate Unclassified
319 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
320 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
321 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
322 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
323 2904456579 Variovorax sp. 2002 Isolate Unclassified
324 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
325 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
326 2904564687 Burkholderia sp. 571 Isolate Unclassified
327 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
328 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
329 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
330 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
331 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
332 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
333 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
334 2928037797 Variovorax sp. 1126 Isolate Unclassified
335 2928044640 Variovorax sp. 1128 Isolate Unclassified
336 2928051484 Variovorax sp. 1133 Isolate Unclassified
337 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
338 2928070936 Variovorax gossypii 1167 Isolate Unclassified
339 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
340 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
341 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
342 2928163908 Burkholderia sp. 567 Isolate Unclassified
343 2928170801 Burkholderia sp. 572 Isolate Unclassified
344 2928536128 Burkholderia sola 565 Isolate Unclassified
345 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
346 2929520902 Variovorax beijingensis 502 Isolate Unclassified
347 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
348 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
349 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
350 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
351 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
352 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
353 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
354 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
355 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
356 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
357 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
358 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
359 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
360 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
361 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.96
Metatranscriptomes 0.17
Isolates 18.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.5
Nodule 2.23
Rhizoplane 5.32
Rhizosphere 56.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0175612 3300048905 Bacteria 2017
2 JGI24735J21928_10000280 3300002067 Bacteria 17853
3 JGI24735J21928_10011278 3300002067 Bacteria 2837
4 JGI25158J39367_1010721 3300002739 Bacteria 1233
5 JGI25152J39213_1011320 3300002773 Bacteria 1980
6 JGI25151J46595_10006142 3300003187 Bacteria 6089
7 rootL2_10056961 3300003322 Bacteria 3501
8 Ga0006562J51391_1042127 3300003578 Bacteria 4725
9 Ga0055538_1000008 3300003751 Bacteria 398547
10 Ga0055539_1000012 3300003752 Bacteria 398547
11 Ga0055533_1000015 3300003756 Bacteria 398547
12 Ga0055532_1002124 3300003758 Bacteria 4483
13 Ga0055525_1000017 3300003759 Bacteria 398547
14 Ga0055527_1001629 3300003760 Bacteria 4483
15 Ga0055535_1000108 3300003761 Bacteria 89707
16 Ga0055535_1003412 3300003761 Bacteria 4525
17 Ga0055535_1003416 3300003761 Bacteria 4523
18 Ga0055542_1000051 3300003762 Bacteria 175242
19 Ga0055542_1001092 3300003762 Bacteria 16477
20 Ga0055529_1000997 3300003763 Bacteria 13856
21 Ga0055537_1000792 3300003773 Bacteria 15832
22 Ga0055524_1005278 3300003775 Bacteria 5803
23 Ga0055534_1000290 3300003784 Bacteria 33979
24 Ga0055528_1000928 3300003790 Bacteria 19583
25 Ga0055528_1004786 3300003790 Bacteria 6445
26 Ga0055530_10025794 3300003791 Bacteria 1635
27 Ga0055540_1000796 3300003792 Bacteria 21352
28 Ga0055540_1002763 3300003792 Bacteria 8996
29 Ga0055531_10013040 3300003794 Bacteria 3860
30 Ga0055541_1000009 3300003841 Bacteria 398547
31 Ga0058692_1001352 3300003856 Bacteria 9128
32 Ga0055543_1000879 3300004625 Bacteria 14320
33 Ga0055543_1001495 3300004625 Bacteria 9195
34 Ga0065165_1007299 3300005262 Bacteria 5482
35 Ga0070658_10130798 3300005327 Bacteria 2092
36 Ga0070666_10006477 3300005335 Bacteria 7196
37 Ga0070666_10113956 3300005335 Bacteria 1871
38 Ga0070660_100000001 3300005339 Bacteria 190487
39 Ga0070659_100000189 3300005366 Bacteria 47370
40 Ga0070667_100153562 3300005367 Bacteria 2024
41 Ga0070663_100004388 3300005455 Bacteria 8283
42 Ga0068867_100116154 3300005459 Bacteria 2062
43 Ga0068853_100027855 3300005539 Bacteria 4750
44 Ga0068853_100142351 3300005539 Bacteria 2153
45 Ga0070672_100109592 3300005543 Bacteria 2249
46 Ga0068855_100152728 3300005563 Bacteria 2625
47 Ga0070664_100030611 3300005564 Bacteria 4490
48 Ga0070664_100047629 3300005564 Bacteria 3621
49 Ga0068857_100050592 3300005577 Bacteria 3685
50 Ga0068854_100012898 3300005578 Bacteria 5473
51 Ga0068854_100106897 3300005578 Bacteria 2106
52 Ga0068856_100395006 3300005614 Bacteria 1403
53 Ga0068852_100094955 3300005616 Bacteria 2677
54 Ga0068851_10052761 3300005834 Bacteria 2068
55 Ga0075365_10010345 3300006038 Bacteria 5426
56 Ga0075363_100101022 3300006048 Bacteria 1596
57 Ga0075364_10009672 3300006051 Bacteria 5794
58 Ga0075364_10015062 3300006051 Bacteria 4788
59 Ga0075362_10002848 3300006177 Bacteria 5908
60 Ga0075370_10002516 3300006353 Bacteria 8512
61 Ga0075370_10012527 3300006353 Bacteria 4485
62 Ga0099826_10000541 3300006948 Bacteria 18746
63 Ga0105244_10004724 3300009036 Bacteria 9268
64 Ga0105250_10035743 3300009092 Bacteria 1994
65 Ga0105240_10005282 3300009093 Bacteria 19283
66 Ga0105240_10037846 3300009093 Bacteria 6196
67 Ga0105240_10211351 3300009093 Bacteria 2267
68 Ga0105245_10206042 3300009098 Bacteria 1891
69 Ga0105243_10000101 3300009148 Bacteria 98298
70 Ga0105243_10000838 3300009148 Bacteria 29247
71 Ga0105243_10007790 3300009148 Bacteria 8235
72 Ga0105243_10026518 3300009148 Bacteria 4436
73 Ga0105242_10345102 3300009176 Bacteria 1373
74 Ga0105237_10023372 3300009545 Bacteria 6335
75 Ga0105237_10061060 3300009545 Bacteria 3769
76 Ga0105237_10236642 3300009545 Bacteria 1827
77 Ga0105238_10000111 3300009551 Bacteria 89931
78 Ga0105238_10016342 3300009551 Bacteria 7511
79 Ga0105239_10164483 3300010375 Bacteria 2480
80 Ga0157371_10000128 3300013102 Bacteria 116349
81 Ga0157371_10059094 3300013102 Bacteria 2719
82 Ga0157369_10068093 3300013105 Bacteria 3824
83 Ga0182008_10012589 3300014497 Bacteria 4465
84 Ga0182008_10020360 3300014497 Bacteria 3418
85 Ga0182008_10032377 3300014497 Bacteria 2627
86 Ga0182007_10004704 3300015262 Bacteria 6151
87 Ga0182007_10016587 3300015262 Bacteria 2714
88 Ga0182007_10017331 3300015262 Bacteria 2633
89 Ga0182007_10026078 3300015262 Bacteria 2030
90 Ga0182005_1027395 3300015265 Bacteria 1554
91 Ga0183362_10002 3300015683 Bacteria 1432711
92 Ga0163161_10001574 3300017792 Bacteria 16836
93 Ga0163161_10004673 3300017792 Bacteria 9522
94 Ga0163161_10023680 3300017792 Bacteria 4333
95 Ga0213872_10002340 3300021361 Bacteria 11262
96 Ga0213872_10010050 3300021361 Bacteria 4515
97 Ga0209436_101494 3300025208 Bacteria 8085
98 Ga0209784_100005 3300025224 Bacteria 1040422
99 Ga0209566_100005 3300025225 Bacteria 1040422
100 Ga0209566_101253 3300025225 Bacteria 8612
101 Ga0209674_100009 3300025226 Bacteria 1040422
102 Ga0209672_100046 3300025228 Bacteria 264244
103 Ga0209672_100088 3300025228 Bacteria 121401
104 Ga0209672_102154 3300025228 Bacteria 5197
105 Ga0209147_100043 3300025229 Bacteria 300460
106 Ga0209147_100130 3300025229 Bacteria 121401
107 Ga0209147_100451 3300025229 Bacteria 25804
108 Ga0209147_100476 3300025229 Bacteria 24510
109 Ga0209563_100012 3300025230 Bacteria 1040422
110 Ga0209258_100023 3300025242 Bacteria 547286
111 Ga0209258_100132 3300025242 Bacteria 175292
112 Ga0209258_100204 3300025242 Bacteria 121401
113 Ga0207425_1009114 3300025245 Bacteria 2490
114 Ga0209677_100006 3300025253 Bacteria 1040422
115 Ga0209148_1000007 3300025254 Bacteria 1592273
116 Ga0209148_1000029 3300025254 Bacteria 579199
117 Ga0209148_1002080 3300025254 Bacteria 7632
118 Ga0209759_1013884 3300025256 Bacteria 2158
119 Ga0209129_1000084 3300025258 Bacteria 182554
120 Ga0209129_1000974 3300025258 Bacteria 17211
121 Ga0209129_1001931 3300025258 Bacteria 10864
122 Ga0209565_1000285 3300025263 Bacteria 49572
123 Ga0209565_1000526 3300025263 Bacteria 27114
124 Ga0209565_1000658 3300025263 Bacteria 22142
125 Ga0209565_1001335 3300025263 Bacteria 11232
126 Ga0209565_1003712 3300025263 Bacteria 4848
127 Ga0209455_1000064 3300025272 Bacteria 332404
128 Ga0209455_1005283 3300025272 Bacteria 4028
129 Ga0209673_1000084 3300025273 Bacteria 215878
130 Ga0209673_1000114 3300025273 Bacteria 178557
131 Ga0209673_1000857 3300025273 Bacteria 39554
132 Ga0209673_1001172 3300025273 Bacteria 28386
133 Ga0209673_1001325 3300025273 Bacteria 24865
134 Ga0209673_1007829 3300025273 Bacteria 4846
135 Ga0209130_1000124 3300025284 Bacteria 124578
136 Ga0209130_1000323 3300025284 Bacteria 56069
137 Ga0209130_1000937 3300025284 Bacteria 23294
138 Ga0209130_1001647 3300025284 Bacteria 13692
139 Ga0209675_1000062 3300025291 Bacteria 178557
140 Ga0209675_1001395 3300025291 Bacteria 14042
141 Ga0209675_1004044 3300025291 Bacteria 6680
142 Ga0209675_1006226 3300025291 Bacteria 4830
143 Ga0209676_1000112 3300025292 Bacteria 208328
144 Ga0209676_1001058 3300025292 Bacteria 31511
145 Ga0209676_1003050 3300025292 Bacteria 10810
146 Ga0209676_1010622 3300025292 Bacteria 3805
147 Ga0209676_1016526 3300025292 Bacteria 2658
148 Ga0209025_1001103 3300025294 Bacteria 38867
149 Ga0209025_1003528 3300025294 Bacteria 14680
150 Ga0209025_1007104 3300025294 Bacteria 8468
151 Ga0209025_1015410 3300025294 Bacteria 4609
152 Ga0209025_1021136 3300025294 Bacteria 3521
153 Ga0209025_1026558 3300025294 Bacteria 2901
154 Ga0209025_1028828 3300025294 Bacteria 2706
155 Ga0209564_1000108 3300025295 Bacteria 213699
156 Ga0209564_1000320 3300025295 Bacteria 93338
157 Ga0209564_1000357 3300025295 Bacteria 85402
158 Ga0209758_1000184 3300025297 Bacteria 140021
159 Ga0209758_1008503 3300025297 Bacteria 6624
160 Ga0209050_1000052 3300025298 Bacteria 351785
161 Ga0209050_1000445 3300025298 Bacteria 74894
162 Ga0209050_1005240 3300025298 Bacteria 8268
163 Ga0209256_1000101 3300025299 Bacteria 200246
164 Ga0209256_1000156 3300025299 Bacteria 144277
165 Ga0209256_1000226 3300025299 Bacteria 103682
166 Ga0207426_1000049 3300025302 Bacteria 401954
167 Ga0207426_1000086 3300025302 Bacteria 292089
168 Ga0207426_1000219 3300025302 Bacteria 135057
169 Ga0209051_1000161 3300025303 Bacteria 125704
170 Ga0209051_1000220 3300025303 Bacteria 96404
171 Ga0209051_1000365 3300025303 Bacteria 66149
172 Ga0209051_1000634 3300025303 Bacteria 40443
173 Ga0209051_1004720 3300025303 Bacteria 8267
174 Ga0209257_1000037 3300025304 Bacteria 612915
175 Ga0209257_1000411 3300025304 Bacteria 83024
176 Ga0209257_1012221 3300025304 Bacteria 4003
177 Ga0207656_10030912 3300025321 Bacteria 2215
178 Ga0207655_1002549 3300025728 Bacteria 14584
179 Ga0207713_1037917 3300025735 Bacteria 2050
180 Ga0207680_10180021 3300025903 Bacteria 1429
181 Ga0207705_10072048 3300025909 Bacteria 2506
182 Ga0207695_10000769 3300025913 Bacteria 61134
183 Ga0207695_10001169 3300025913 Bacteria 45284
184 Ga0207695_10045611 3300025913 Bacteria 4651
185 Ga0207695_10092630 3300025913 Bacteria 3032
186 Ga0207695_10246160 3300025913 Bacteria 1688
187 Ga0207657_10000022 3300025919 Bacteria 154101
188 Ga0207694_10000199 3300025924 Bacteria 60220
189 Ga0207690_10000010 3300025932 Bacteria 330298
190 Ga0207709_10000103 3300025935 Bacteria 131589
191 Ga0207709_10000621 3300025935 Bacteria 29102
192 Ga0207709_10002926 3300025935 Bacteria 10429
193 Ga0207709_10006718 3300025935 Bacteria 6444
194 Ga0207709_10007395 3300025935 Bacteria 6118
195 Ga0207667_10009007 3300025949 Bacteria 11806
196 Ga0207658_10015657 3300025986 Bacteria 5206
197 Ga0207678_10000013 3300026067 Bacteria 141619
198 Ga0207648_10094837 3300026089 Bacteria 2609
199 Ga0207674_10097955 3300026116 Bacteria 2916
200 Ga0207698_10068776 3300026142 Bacteria 2798
201 Ga0207698_10122203 3300026142 Bacteria 2206
202 Ga0209371_1000526 3300027312 Bacteria 36476
203 Ga0209282_1000282 3300027666 Bacteria 25169
204 Ga0268265_10060906 3300028380 Bacteria 2894
205 Ga0268256_1001282 3300030500 Bacteria 15565
206 Ga0314311_1006183 3300030733 Bacteria 1633
207 Ga0316178_1012286 3300030735 Bacteria 5502
208 Ga0316181_1113472 3300030744 Bacteria 3605
209 Ga0316182_1060776 3300030745 Bacteria 3338
210 Ga0265327_10004544 3300031251 Bacteria 12232
211 Ga0307408_100000067 3300031548 Bacteria 120790
212 Ga0307514_10011789 3300031649 Bacteria 7272
213 Ga0316579_10020503 3300031691 Bacteria 2934
214 Ga0307405_10052165 3300031731 Bacteria 2541
215 Ga0307405_10112014 3300031731 Bacteria 1850
216 Ga0307405_10155461 3300031731 Bacteria 1613
217 Ga0307410_10081902 3300031852 Bacteria 2269
218 Ga0307406_10000778 3300031901 Bacteria 17868
219 Ga0307406_10171772 3300031901 Bacteria 1569
220 Ga0307414_10060296 3300032004 Bacteria 2682
221 Ga0307414_10157563 3300032004 Bacteria 1799
222 Ga0395899_0033609 3300037312 Bacteria 3851
223 Ga0395899_0113319 3300037312 Bacteria 1948
224 Ga0395900_0002787 3300037418 Bacteria 19106
225 Ga0395900_0026536 3300037418 Bacteria 5931
226 Ga0395900_0027639 3300037418 Bacteria 5811
227 Ga0395900_0143106 3300037418 Bacteria 2447
228 Ga0395900_0152317 3300037418 Bacteria 2362
229 Ga0395898_0005973 3300037466 Bacteria 13076
230 Ga0395898_0074277 3300037466 Bacteria 3284
231 Ga0395905_0014810 3300037471 Bacteria 7435
232 Ga0395905_0045244 3300037471 Bacteria 4128
233 Ga0395905_0077262 3300037471 Bacteria 3119
234 Ga0395901_0000011 3300038443 Bacteria 400724
235 Ga0395901_0008524 3300038443 Bacteria 10356
236 Ga0395901_0078284 3300038443 Bacteria 3452
237 Ga0395901_0183458 3300038443 Bacteria 2195
238 Ga0436361_0271890 3300039447 Bacteria 3795
239 Ga0436361_0548351 3300039447 Bacteria 10954
240 Ga0436361_0682271 3300039447 Bacteria 5628
241 Ga0439465_0021136 3300041413 Bacteria 2041
242 Ga0439442_003588 3300042002 Bacteria 3071
243 Ga0450911_000181 3300042115 Bacteria 24977
244 Ga0450898_004926 3300042134 Bacteria 1995
245 Ga0450906_004940 3300042145 Bacteria 2768
246 Ga0439459_0013526 3300042438 Bacteria 1470
247 Ga0450918_000577 3300042531 Bacteria 7804
248 Ga0450918_002858 3300042531 Bacteria 3241
249 Ga0451577_0005754 3300042876 Bacteria 12569
250 Ga0453683_0005073 3300044673 Bacteria 9238
251 Ga0466966_0049446 3300044684 Bacteria 2678
252 Ga0466961_0034779 3300044693 Bacteria 3235
253 Ga0453684_0004829 3300044712 Bacteria 27681
254 Ga0466957_0006466 3300044842 Bacteria 6616
255 Ga0466959_0118248 3300045049 Bacteria 1886
256 Ga0451576_0034877 3300045051 Bacteria 5342
257 Ga0451576_0064781 3300045051 Bacteria 3806
258 Ga0466958_0000289 3300045836 Bacteria 19621
259 Ga0466967_0123181 3300045976 Bacteria 2398
260 Ga0495617_043705 3300046452 Bacteria 1496
261 Ga0495603_0002112 3300046455 Bacteria 11689
262 Ga0495590_0000737 3300046457 Bacteria 14905
263 Ga0495590_0006032 3300046457 Bacteria 4751
264 Ga0495591_036637 3300046458 Bacteria 1426
265 Ga0495629_0000819 3300046459 Bacteria 25210
266 Ga0495629_0001899 3300046459 Bacteria 16271
267 Ga0495629_0004676 3300046459 Bacteria 10256
268 Ga0495629_0156099 3300046459 Bacteria 1585
269 Ga0495638_0000574 3300046460 Bacteria 41469
270 Ga0495651_0152200 3300046462 Bacteria 1666
271 Ga0495653_0000429 3300046463 Bacteria 33193
272 Ga0495653_0001077 3300046463 Bacteria 21056
273 Ga0495653_0002383 3300046463 Bacteria 14960
274 Ga0495653_0006584 3300046463 Bacteria 9539
275 Ga0495650_0008974 3300046471 Bacteria 5749
276 Ga0495580_0000658 3300046472 Bacteria 29321
277 Ga0495580_0011928 3300046472 Bacteria 6697
278 Ga0495580_0019615 3300046472 Bacteria 5021
279 Ga0495580_0049940 3300046472 Bacteria 2958
280 Ga0495580_0050571 3300046472 Bacteria 2939
281 Ga0495580_0103580 3300046472 Bacteria 1978
282 Ga0495582_0022956 3300046473 Bacteria 3412
283 Ga0495605_0012074 3300046474 Bacteria 4801
284 Ga0495639_0008628 3300046475 Bacteria 4371
285 Ga0495662_0107977 3300046476 Bacteria 1363
286 Ga0495664_0000315 3300046477 Bacteria 23220
287 Ga0495664_0122475 3300046477 Bacteria 1572
288 Ga0495584_0007822 3300046491 Bacteria 5561
289 Ga0495584_0037341 3300046491 Bacteria 2454
290 Ga0495584_0044975 3300046491 Bacteria 2227
291 Ga0495585_0001299 3300046492 Bacteria 19924
292 Ga0495585_0013098 3300046492 Bacteria 4861
293 Ga0495596_0011599 3300046500 Bacteria 3795
294 Ga0495583_0001225 3300046506 Bacteria 27299
295 Ga0495583_0003075 3300046506 Bacteria 13222
296 Ga0495583_0033651 3300046506 Bacteria 2463
297 Ga0495606_0001644 3300046507 Bacteria 29139
298 Ga0495606_0002545 3300046507 Bacteria 20974
299 Ga0495606_0039957 3300046507 Bacteria 3156
300 Ga0495606_0055543 3300046507 Bacteria 2560
301 Ga0495606_0064868 3300046507 Bacteria 2322
302 Ga0495616_0000114 3300046513 Bacteria 70661
303 Ga0495618_0000718 3300046514 Bacteria 23126
304 Ga0495628_0002855 3300046516 Bacteria 15482
305 Ga0495628_0056822 3300046516 Bacteria 3079
306 Ga0495630_0001648 3300046517 Bacteria 15520
307 Ga0495631_0001853 3300046518 Bacteria 12484
308 Ga0495631_0003405 3300046518 Bacteria 8706
309 Ga0495631_0014221 3300046518 Bacteria 3846
310 Ga0495643_0000127 3300046522 Bacteria 123390
311 Ga0495643_0085995 3300046522 Bacteria 1629
312 Ga0495648_0003795 3300046524 Bacteria 13141
313 Ga0495648_0004920 3300046524 Bacteria 11238
314 Ga0495648_0010695 3300046524 Bacteria 6970
315 Ga0495648_0013584 3300046524 Bacteria 6007
316 Ga0495666_0013115 3300046526 Bacteria 4129
317 Ga0495666_0018073 3300046526 Bacteria 3511
318 Ga0495642_0002942 3300046528 Bacteria 6788
319 Ga0495642_0012579 3300046528 Bacteria 3262
320 Ga0495652_0027307 3300046529 Bacteria 5030
321 Ga0495654_0030645 3300046530 Bacteria 2735
322 Ga0495665_0000097 3300046531 Bacteria 40415
323 Ga0495665_0000155 3300046531 Bacteria 34013
324 Ga0495665_0016754 3300046531 Bacteria 3945
325 Ga0495665_0027610 3300046531 Bacteria 3046
326 Ga0495665_0029158 3300046531 Bacteria 2957
327 Ga0495665_0031260 3300046531 Bacteria 2849
328 Ga0495586_0007802 3300046535 Bacteria 5706
329 Ga0495586_0011759 3300046535 Bacteria 4654
330 Ga0495587_0045964 3300046536 Bacteria 2593
331 Ga0495609_0013004 3300046538 Bacteria 3938
332 Ga0495597_0013439 3300046542 Bacteria 3921
333 Ga0495645_0006438 3300046543 Bacteria 8147
334 Ga0495645_0006965 3300046543 Bacteria 7857
335 Ga0495645_0045845 3300046543 Bacteria 3189
336 Ga0495633_0001124 3300046558 Bacteria 21488
337 Ga0495667_0014469 3300046559 Bacteria 5331
338 Ga0495656_0006514 3300046615 Bacteria 4098
339 Ga0495656_0027331 3300046615 Bacteria 2278
340 Ga0495668_0013733 3300046616 Bacteria 4766
341 Ga0495611_0009019 3300046648 Bacteria 4219
342 Ga0495625_0000297 3300046660 Bacteria 76945
343 Ga0495625_0079410 3300046660 Bacteria 2288
344 Ga0495635_0050193 3300046663 Bacteria 2876
345 Ga0495661_0000971 3300046665 Bacteria 25999
346 Ga0495661_0022234 3300046665 Bacteria 4126
347 Ga0495661_0162820 3300046665 Bacteria 1196
348 Ga0495588_0064561 3300046674 Bacteria 1899
349 Ga0495588_0070489 3300046674 Bacteria 1817
350 Ga0495623_0002326 3300046679 Bacteria 12676
351 Ga0495623_0004421 3300046679 Bacteria 9238
352 Ga0495646_0000284 3300046680 Bacteria 25889
353 Ga0495646_0001781 3300046680 Bacteria 12946
354 Ga0495646_0017436 3300046680 Bacteria 4555
355 Ga0495646_0026460 3300046680 Bacteria 3643
356 Ga0495613_0097918 3300046689 Bacteria 2119
357 Ga0495624_0000486 3300046690 Bacteria 30963
358 Ga0495624_0000554 3300046690 Bacteria 29318
359 Ga0495624_0011431 3300046690 Bacteria 6099
360 Ga0495624_0012294 3300046690 Bacteria 5856
361 Ga0495624_0023331 3300046690 Bacteria 4081
362 Ga0495670_0000127 3300046691 Bacteria 32865
363 Ga0495671_0004162 3300046692 Bacteria 8718
364 Ga0495671_0030102 3300046692 Bacteria 2783
365 Ga0495649_0004419 3300046694 Bacteria 9190
366 Ga0495649_0004642 3300046694 Bacteria 8933
367 Ga0495649_0025012 3300046694 Bacteria 3327
368 Ga0495589_0005249 3300046794 Bacteria 6848
369 Ga0495600_0043072 3300046809 Bacteria 2943
370 Ga0495581_0015819 3300047315 Bacteria 4381
371 Ga0495604_0005373 3300047317 Bacteria 10158
372 Ga0495604_0014717 3300047317 Bacteria 6235
373 Ga0495674_0000647 3300047319 Bacteria 32685
374 Ga0495674_0001534 3300047319 Bacteria 22578
375 Ga0495674_0005453 3300047319 Bacteria 12220
376 Ga0495674_0014132 3300047319 Bacteria 7479
377 Ga0495674_0100129 3300047319 Bacteria 2466
378 Ga0495674_0104487 3300047319 Bacteria 2408
379 Ga0495672_0006454 3300047320 Bacteria 9077
380 Ga0495672_0008707 3300047320 Bacteria 7444
381 Ga0495672_0084843 3300047320 Bacteria 1756
382 Ga0495676_0021056 3300047321 Bacteria 5707
383 Ga0495676_0048272 3300047321 Bacteria 3434
384 Ga0495676_0175065 3300047321 Bacteria 1507
385 Ga0495680_0003266 3300047322 Bacteria 16080
386 Ga0495680_0008834 3300047322 Bacteria 9118
387 Ga0495683_0000523 3300047323 Bacteria 29254
388 Ga0495683_0001560 3300047323 Bacteria 14830
389 Ga0495683_0002605 3300047323 Bacteria 10831
390 Ga0495683_0085333 3300047323 Bacteria 1535
391 Ga0495687_013335 3300047443 Bacteria 4300
392 Ga0495687_016072 3300047443 Bacteria 3776
393 Ga0495677_0000684 3300047445 Bacteria 13755
394 Ga0495679_012476 3300047446 Bacteria 3232
395 Ga0495673_0009825 3300047469 Bacteria 5257
396 Ga0495673_0022858 3300047469 Bacteria 3056
397 Ga0495673_0027674 3300047469 Bacteria 2694
398 Ga0495681_0000729 3300047470 Bacteria 25247
399 Ga0495684_0011101 3300047471 Bacteria 6963
400 Ga0495593_0000207 3300047673 Bacteria 31075
401 Ga0495593_0000861 3300047673 Bacteria 17571
402 Ga0495593_0001333 3300047673 Bacteria 14431
403 Ga0495593_0001795 3300047673 Bacteria 12736
404 Ga0495593_0003929 3300047673 Bacteria 8877
405 Ga0495593_0012080 3300047673 Bacteria 4947
406 Ga0495602_0001137 3300048088 Bacteria 26030
407 Ga0495602_0006588 3300048088 Bacteria 12171
408 Ga0495602_0011607 3300048088 Bacteria 9101
409 Ga0496100_0014163 3300048903 Bacteria 4622
410 Ga0496100_0071617 3300048903 Bacteria 2315
411 Ga0496100_0249117 3300048903 Bacteria 1313
412 Ga0496101_0010002 3300048904 Bacteria 6250
413 Ga0496101_0014112 3300048904 Bacteria 5364
414 Ga0496101_0028785 3300048904 Bacteria 3882
415 Ga0496102_0028256 3300048905 Bacteria 5009
416 Ga0496104_0020536 3300048907 Bacteria 6055
417 Ga0496104_0296471 3300048907 Bacteria 1529
418 Ga0496105_0011544 3300048908 Bacteria 6984
419 Ga0496105_0016382 3300048908 Bacteria 5916
420 Ga0496105_0034177 3300048908 Bacteria 4181
421 Ga0496106_0138929 3300048909 Bacteria 1910
422 Ga0496107_0105256 3300048910 Bacteria 2071
423 Ga0496109_0003895 3300048912 Bacteria 12468
424 Ga0496110_0004135 3300048913 Bacteria 11217
425 Ga0496110_0039023 3300048913 Bacteria 4134
426 Ga0496110_0084210 3300048913 Bacteria 2838
427 Ga0496111_0074009 3300048914 Bacteria 2481
428 Ga0496112_0002367 3300048915 Bacteria 15148
429 Ga0496113_0003751 3300048916 Bacteria 9166
430 Ga0496113_0019242 3300048916 Bacteria 4773
431 Ga0496114_0001072 3300048917 Bacteria 20590
432 Ga0496117_0018131 3300048920 Bacteria 5850
433 Ga0496117_0042213 3300048920 Bacteria 3330
434 Ga0496117_0049074 3300048920 Bacteria 3007
435 Ga0496118_0037018 3300048921 Bacteria 3934
436 Ga0496118_0048254 3300048921 Bacteria 3291
437 Ga0496121_0006535 3300048924 Bacteria 14408
438 Ga0496121_0019785 3300048924 Bacteria 6709
439 Ga0496121_0139918 3300048924 Bacteria 1797
440 Ga0496122_0045701 3300048925 Bacteria 3400
441 Ga0496123_0022217 3300048926 Bacteria 4898
442 Ga0496124_0035100 3300048927 Bacteria 4391
443 Ga0496125_0086465 3300048928 Bacteria 2371
444 Ga0496125_0118214 3300048928 Bacteria 1899
445 Ga0496126_0247236 3300048929 Bacteria 1487
446 Ga0501034_0224053 3300049571 Bacteria 1832
447 Ga0501034_0458827 3300049571 Bacteria 1191
448 Ga0501262_000431 3300049759 Bacteria 5031
449 Ga0501035_0021951 3300049822 Bacteria 5865
450 Ga0501044_0003206 3300049823 Bacteria 18437
451 nmdc:mga03n38_93451_c1 3300050490 Bacteria 1437
452 nmdc:mga00v17_7557_c1 3300050491 Bacteria 5804
453 nmdc:mga0yw44_4295_c1 3300050492 Bacteria 6503
454 nmdc:mga0k408_19785_c1 3300050493 Bacteria 3766
455 nmdc:mga07m45_124926_c1 3300050496 Bacteria 1488
456 nmdc:mga07m45_18343_c1 3300050496 Bacteria 3775
457 nmdc:mga07m45_3226_c1 3300050496 Bacteria 7828
458 nmdc:mga07m45_54144_c1 3300050496 Bacteria 2268
459 Ga0500610_0000551 3300053079 Bacteria 11547
460 Ga0500610_0003312 3300053079 Bacteria 6151
461 Ga0500644_0008259 3300053088 Bacteria 2743
462 Ga0500651_0002027 3300053093 Bacteria 10517
463 Ga0500607_004085 3300053121 Bacteria 10221
464 Ga0500658_0001187 3300053134 Bacteria 10625
465 Ga0500658_0003178 3300053134 Bacteria 6266
466 Ga0500559_0002100 3300053136 Bacteria 10621
467 Ga0500568_0004258 3300053139 Bacteria 7687
468 Ga0500616_0000108 3300053153 Bacteria 152917
469 Ga0500616_0125572 3300053153 Bacteria 1219
470 Ga0500622_0000937 3300053156 Bacteria 24806
471 Ga0500634_0033327 3300053161 Bacteria 2808
472 Ga0500636_0018717 3300053177 Bacteria 4095
473 Ga0466962_0017070 3300061719 Bacteria 3498
474 2501072431 2501025501 Bacteria 7768574
475 2501083879 2501025502 Bacteria 9641094
476 2501085010 2501025502 Bacteria 9641094
477 2501413074 2501025504 Bacteria 8008976
478 2511087296 2510917013 Bacteria 9951648
479 2511090438 2510917013 Bacteria 9951648
480 2511100483 2510917014 Bacteria 8296963
481 2511105853 2510917015 Bacteria 7950052
482 2512348803 2512047030 Bacteria 9031815
483 2512352450 2512047030 Bacteria 9031815
484 2513231269 2513020051 Bacteria 6053213
485 2513551757 2513237082 Bacteria 8640282
486 2513561894 2513237083 Bacteria 8410967
487 2513953552 2513237150 Bacteria 6553639
488 2514044241 2513237165 Bacteria 6771773
489 2516017641 2515154189 Bacteria 9629850
490 2516024820 2515154189 Bacteria 9629850
491 2521557039 2521172590 Bacteria 5047645
492 2553004834 2551306416 Bacteria 6152985
493 2563064859 2562617112 Bacteria 10918404
494 2596374918 2595698237 Bacteria 6712432
495 2599620980 2599185214 Bacteria 8209958
496 2599674214 2599185226 Bacteria 8233575
497 2599678404 2599185227 Bacteria 8246414
498 2599690491 2599185229 Bacteria 8216126
499 2599740170 2599185239 Bacteria 8686614
500 2599744158 2599185240 Bacteria 7968121
501 2600206195 2599185355 Bacteria 7968906
502 2644161272 2643221628 Bacteria 5745828
503 2644326176 2643221658 Bacteria 6064537
504 2644400842 2643221672 Bacteria 6322190
505 2644466071 2643221683 Bacteria 5749203
506 2676743491 2675903129 Bacteria 7964495
507 2713482152 2711768613 Bacteria 11048459
508 2738720821 2738541277 Bacteria 7458140
509 2738747439 2738541281 Bacteria 5112672
510 2738882418 2738541307 Bacteria 8606193
511 2739280020 2738543019 Bacteria 7459457
512 2739356721 2738543032 Bacteria 5115625
513 2746087123 2744054900 Bacteria 8399525
514 2746096056 2744054901 Bacteria 8397047
515 2753566856 2751185846 Bacteria 7242164
516 2792838305 2791355137 Bacteria 9654227
517 2809145725 2808606418 Bacteria 6724496
518 2819602091 2818991446 Bacteria 7757362
519 2819616784 2818991449 Bacteria 5518009
520 2819633632 2818991452 Bacteria 8442785
521 2831269939 2831265667 Bacteria 7184833
522 2838055050 2838054893 Bacteria 7451788
523 2838061367 2838054893 Bacteria 7451788
524 2842681117 2842677519 Bacteria 5615038
525 2856289509 2856287931 Bacteria 7223934
526 2857363977 2857357740 Bacteria 9937880
527 2863427237 2863421361 Bacteria 7300805
528 2867346543 2867346516 Bacteria 7608576
529 2870070038 2870068957 Bacteria 8925310
530 2881101438 2881101125 Bacteria 4590519
531 2883089974 2883087390 Bacteria 9532701
532 2885201959 2885198086 Bacteria 7212419
533 2885215331 2885211737 Bacteria 7212420
534 2885275555 2885270888 Bacteria 9831543
535 2889306520 2889306138 Bacteria 6358934
536 2899927141 2899924645 Bacteria 7487985
537 2902332097 2902330777 Bacteria 6395352
538 2902332372 2902330777 Bacteria 6395352
539 2902411454 2902405164 Bacteria 6784948
540 2902688601 2902682994 Bacteria 8951596
541 2904440262 2904439833 Bacteria 5931679
542 2904454074 2904449895 Bacteria 6927402
543 2904462069 2904456579 Bacteria 6819253
544 2904530827 2904530477 Bacteria 5876334
545 2904546010 2904541872 Bacteria 8915136
546 2904567736 2904564687 Bacteria 7609577
547 2904574862 2904571731 Bacteria 7608790
548 2904585760 2904584206 Bacteria 6028872
549 2904592427 2904589729 Bacteria 6113573
550 2904601438 2904601388 Bacteria 5884906
551 2919082911 2919079590 Bacteria 5946433
552 2919465322 2919462493 Bacteria 5817112
553 2919466998 2919462493 Bacteria 5817112
554 2923515666 2923510766 Bacteria 5926163
555 2928043989 2928037797 Bacteria 7273642
556 2928048637 2928044640 Bacteria 7271509
557 2928054961 2928051484 Bacteria 7773759
558 2928068396 2928064002 Bacteria 7419480
559 2928073711 2928070936 Bacteria 8062541
560 2928090717 2928084124 Bacteria 7159212
561 2928129841 2928125067 Bacteria 5937560
562 2928161974 2928157003 Bacteria 7522202
563 2928169226 2928163908 Bacteria 7561269
564 2928178619 2928170801 Bacteria 8785406
565 2928539047 2928536128 Bacteria 7657547
566 2929161212 2929160207 Bacteria 9075316
567 2929521805 2929520902 Bacteria 6765052
568 2945911825 2945909444 Bacteria 7065066
569 2945914315 2945909444 Bacteria 7065066
570 2945949871 2945945610 Bacteria 5951079
571 2945973874 2945972063 Bacteria 6086495
572 2945990290 2945984333 Bacteria 7358892
573 2954770521 2954767861 Bacteria 5535784
574 2981992862 2981990288 Bacteria 7590678
575 644750371 644736347 Bacteria 6476522
576 8003956923 8003955200 Bacteria 8601927
577 8018846333 8018845410 Bacteria 8933938
578 8020939951 8020938398 Bacteria 7472757
579 8020951581 8020945358 Bacteria 8467355
580 8020954770 8020953355 Bacteria 7439080
581 8021128270 8021120328 Bacteria 8782274
582 8039104577 8039098773 Bacteria 6602928
583 8055302597 8055301274 Bacteria 8587385
584 Ga0496102_0175612
585 JGI24735J21928_10000280
586 JGI24735J21928_10011278
587 JGI25158J39367_1010721
588 JGI25152J39213_1011320
589 JGI25151J46595_10006142
590 rootL2_10056961
591 Ga0006562J51391_1042127
592 Ga0055538_1000008
593 Ga0055539_1000012
594 Ga0055533_1000015
595 Ga0055532_1002124
596 Ga0055525_1000017
597 Ga0055527_1001629
598 Ga0055535_1000108
599 Ga0055535_1003412
600 Ga0055535_1003416
601 Ga0055542_1000051
602 Ga0055542_1001092
603 Ga0055529_1000997
604 Ga0055537_1000792
605 Ga0055524_1005278
606 Ga0055534_1000290
607 Ga0055528_1000928
608 Ga0055528_1004786
609 Ga0055530_10025794
610 Ga0055540_1000796
611 Ga0055540_1002763
612 Ga0055531_10013040
613 Ga0055541_1000009
614 Ga0058692_1001352
615 Ga0055543_1000879
616 Ga0055543_1001495
617 Ga0065165_1007299
618 Ga0070658_10130798
619 Ga0070666_10006477
620 Ga0070666_10113956
621 Ga0070660_100000001
622 Ga0070659_100000189
623 Ga0070667_100153562
624 Ga0070663_100004388
625 Ga0068867_100116154
626 Ga0068853_100027855
627 Ga0068853_100142351
628 Ga0070672_100109592
629 Ga0068855_100152728
630 Ga0070664_100030611
631 Ga0070664_100047629
632 Ga0068857_100050592
633 Ga0068854_100012898
634 Ga0068854_100106897
635 Ga0068856_100395006
636 Ga0068852_100094955
637 Ga0068851_10052761
638 Ga0075365_10010345
639 Ga0075363_100101022
640 Ga0075364_10009672
641 Ga0075364_10015062
642 Ga0075362_10002848
643 Ga0075370_10002516
644 Ga0075370_10012527
645 Ga0099826_10000541
646 Ga0105244_10004724
647 Ga0105250_10035743
648 Ga0105240_10005282
649 Ga0105240_10037846
650 Ga0105240_10211351
651 Ga0105245_10206042
652 Ga0105243_10000101
653 Ga0105243_10000838
654 Ga0105243_10007790
655 Ga0105243_10026518
656 Ga0105242_10345102
657 Ga0105237_10023372
658 Ga0105237_10061060
659 Ga0105237_10236642
660 Ga0105238_10000111
661 Ga0105238_10016342
662 Ga0105239_10164483
663 Ga0157371_10000128
664 Ga0157371_10059094
665 Ga0157369_10068093
666 Ga0182008_10012589
667 Ga0182008_10020360
668 Ga0182008_10032377
669 Ga0182007_10004704
670 Ga0182007_10016587
671 Ga0182007_10017331
672 Ga0182007_10026078
673 Ga0182005_1027395
674 Ga0183362_10002
675 Ga0163161_10001574
676 Ga0163161_10004673
677 Ga0163161_10023680
678 Ga0213872_10002340
679 Ga0213872_10010050
680 Ga0209436_101494
681 Ga0209784_100005
682 Ga0209566_100005
683 Ga0209566_101253
684 Ga0209674_100009
685 Ga0209672_100046
686 Ga0209672_100088
687 Ga0209672_102154
688 Ga0209147_100043
689 Ga0209147_100130
690 Ga0209147_100451
691 Ga0209147_100476
692 Ga0209563_100012
693 Ga0209258_100023
694 Ga0209258_100132
695 Ga0209258_100204
696 Ga0207425_1009114
697 Ga0209677_100006
698 Ga0209148_1000007
699 Ga0209148_1000029
700 Ga0209148_1002080
701 Ga0209759_1013884
702 Ga0209129_1000084
703 Ga0209129_1000974
704 Ga0209129_1001931
705 Ga0209565_1000285
706 Ga0209565_1000526
707 Ga0209565_1000658
708 Ga0209565_1001335
709 Ga0209565_1003712
710 Ga0209455_1000064
711 Ga0209455_1005283
712 Ga0209673_1000084
713 Ga0209673_1000114
714 Ga0209673_1000857
715 Ga0209673_1001172
716 Ga0209673_1001325
717 Ga0209673_1007829
718 Ga0209130_1000124
719 Ga0209130_1000323
720 Ga0209130_1000937
721 Ga0209130_1001647
722 Ga0209675_1000062
723 Ga0209675_1001395
724 Ga0209675_1004044
725 Ga0209675_1006226
726 Ga0209676_1000112
727 Ga0209676_1001058
728 Ga0209676_1003050
729 Ga0209676_1010622
730 Ga0209676_1016526
731 Ga0209025_1001103
732 Ga0209025_1003528
733 Ga0209025_1007104
734 Ga0209025_1015410
735 Ga0209025_1021136
736 Ga0209025_1026558
737 Ga0209025_1028828
738 Ga0209564_1000108
739 Ga0209564_1000320
740 Ga0209564_1000357
741 Ga0209758_1000184
742 Ga0209758_1008503
743 Ga0209050_1000052
744 Ga0209050_1000445
745 Ga0209050_1005240
746 Ga0209256_1000101
747 Ga0209256_1000156
748 Ga0209256_1000226
749 Ga0207426_1000049
750 Ga0207426_1000086
751 Ga0207426_1000219
752 Ga0209051_1000161
753 Ga0209051_1000220
754 Ga0209051_1000365
755 Ga0209051_1000634
756 Ga0209051_1004720
757 Ga0209257_1000037
758 Ga0209257_1000411
759 Ga0209257_1012221
760 Ga0207656_10030912
761 Ga0207655_1002549
762 Ga0207713_1037917
763 Ga0207680_10180021
764 Ga0207705_10072048
765 Ga0207695_10000769
766 Ga0207695_10001169
767 Ga0207695_10045611
768 Ga0207695_10092630
769 Ga0207695_10246160
770 Ga0207657_10000022
771 Ga0207694_10000199
772 Ga0207690_10000010
773 Ga0207709_10000103
774 Ga0207709_10000621
775 Ga0207709_10002926
776 Ga0207709_10006718
777 Ga0207709_10007395
778 Ga0207667_10009007
779 Ga0207658_10015657
780 Ga0207678_10000013
781 Ga0207648_10094837
782 Ga0207674_10097955
783 Ga0207698_10068776
784 Ga0207698_10122203
785 Ga0209371_1000526
786 Ga0209282_1000282
787 Ga0268265_10060906
788 Ga0268256_1001282
789 Ga0314311_1006183
790 Ga0316178_1012286
791 Ga0316181_1113472
792 Ga0316182_1060776
793 Ga0265327_10004544
794 Ga0307408_100000067
795 Ga0307514_10011789
796 Ga0316579_10020503
797 Ga0307405_10052165
798 Ga0307405_10112014
799 Ga0307405_10155461
800 Ga0307410_10081902
801 Ga0307406_10000778
802 Ga0307406_10171772
803 Ga0307414_10060296
804 Ga0307414_10157563
805 Ga0395899_0033609
806 Ga0395899_0113319
807 Ga0395900_0002787
808 Ga0395900_0026536
809 Ga0395900_0027639
810 Ga0395900_0143106
811 Ga0395900_0152317
812 Ga0395898_0005973
813 Ga0395898_0074277
814 Ga0395905_0014810
815 Ga0395905_0045244
816 Ga0395905_0077262
817 Ga0395901_0000011
818 Ga0395901_0008524
819 Ga0395901_0078284
820 Ga0395901_0183458
821 Ga0436361_0271890
822 Ga0436361_0548351
823 Ga0436361_0682271
824 Ga0439465_0021136
825 Ga0439442_003588
826 Ga0450911_000181
827 Ga0450898_004926
828 Ga0450906_004940
829 Ga0439459_0013526
830 Ga0450918_000577
831 Ga0450918_002858
832 Ga0451577_0005754
833 Ga0453683_0005073
834 Ga0466966_0049446
835 Ga0466961_0034779
836 Ga0453684_0004829
837 Ga0466957_0006466
838 Ga0466959_0118248
839 Ga0451576_0034877
840 Ga0451576_0064781
841 Ga0466958_0000289
842 Ga0466967_0123181
843 Ga0495617_043705
844 Ga0495603_0002112
845 Ga0495590_0000737
846 Ga0495590_0006032
847 Ga0495591_036637
848 Ga0495629_0000819
849 Ga0495629_0001899
850 Ga0495629_0004676
851 Ga0495629_0156099
852 Ga0495638_0000574
853 Ga0495651_0152200
854 Ga0495653_0000429
855 Ga0495653_0001077
856 Ga0495653_0002383
857 Ga0495653_0006584
858 Ga0495650_0008974
859 Ga0495580_0000658
860 Ga0495580_0011928
861 Ga0495580_0019615
862 Ga0495580_0049940
863 Ga0495580_0050571
864 Ga0495580_0103580
865 Ga0495582_0022956
866 Ga0495605_0012074
867 Ga0495639_0008628
868 Ga0495662_0107977
869 Ga0495664_0000315
870 Ga0495664_0122475
871 Ga0495584_0007822
872 Ga0495584_0037341
873 Ga0495584_0044975
874 Ga0495585_0001299
875 Ga0495585_0013098
876 Ga0495596_0011599
877 Ga0495583_0001225
878 Ga0495583_0003075
879 Ga0495583_0033651
880 Ga0495606_0001644
881 Ga0495606_0002545
882 Ga0495606_0039957
883 Ga0495606_0055543
884 Ga0495606_0064868
885 Ga0495616_0000114
886 Ga0495618_0000718
887 Ga0495628_0002855
888 Ga0495628_0056822
889 Ga0495630_0001648
890 Ga0495631_0001853
891 Ga0495631_0003405
892 Ga0495631_0014221
893 Ga0495643_0000127
894 Ga0495643_0085995
895 Ga0495648_0003795
896 Ga0495648_0004920
897 Ga0495648_0010695
898 Ga0495648_0013584
899 Ga0495666_0013115
900 Ga0495666_0018073
901 Ga0495642_0002942
902 Ga0495642_0012579
903 Ga0495652_0027307
904 Ga0495654_0030645
905 Ga0495665_0000097
906 Ga0495665_0000155
907 Ga0495665_0016754
908 Ga0495665_0027610
909 Ga0495665_0029158
910 Ga0495665_0031260
911 Ga0495586_0007802
912 Ga0495586_0011759
913 Ga0495587_0045964
914 Ga0495609_0013004
915 Ga0495597_0013439
916 Ga0495645_0006438
917 Ga0495645_0006965
918 Ga0495645_0045845
919 Ga0495633_0001124
920 Ga0495667_0014469
921 Ga0495656_0006514
922 Ga0495656_0027331
923 Ga0495668_0013733
924 Ga0495611_0009019
925 Ga0495625_0000297
926 Ga0495625_0079410
927 Ga0495635_0050193
928 Ga0495661_0000971
929 Ga0495661_0022234
930 Ga0495661_0162820
931 Ga0495588_0064561
932 Ga0495588_0070489
933 Ga0495623_0002326
934 Ga0495623_0004421
935 Ga0495646_0000284
936 Ga0495646_0001781
937 Ga0495646_0017436
938 Ga0495646_0026460
939 Ga0495613_0097918
940 Ga0495624_0000486
941 Ga0495624_0000554
942 Ga0495624_0011431
943 Ga0495624_0012294
944 Ga0495624_0023331
945 Ga0495670_0000127
946 Ga0495671_0004162
947 Ga0495671_0030102
948 Ga0495649_0004419
949 Ga0495649_0004642
950 Ga0495649_0025012
951 Ga0495589_0005249
952 Ga0495600_0043072
953 Ga0495581_0015819
954 Ga0495604_0005373
955 Ga0495604_0014717
956 Ga0495674_0000647
957 Ga0495674_0001534
958 Ga0495674_0005453
959 Ga0495674_0014132
960 Ga0495674_0100129
961 Ga0495674_0104487
962 Ga0495672_0006454
963 Ga0495672_0008707
964 Ga0495672_0084843
965 Ga0495676_0021056
966 Ga0495676_0048272
967 Ga0495676_0175065
968 Ga0495680_0003266
969 Ga0495680_0008834
970 Ga0495683_0000523
971 Ga0495683_0001560
972 Ga0495683_0002605
973 Ga0495683_0085333
974 Ga0495687_013335
975 Ga0495687_016072
976 Ga0495677_0000684
977 Ga0495679_012476
978 Ga0495673_0009825
979 Ga0495673_0022858
980 Ga0495673_0027674
981 Ga0495681_0000729
982 Ga0495684_0011101
983 Ga0495593_0000207
984 Ga0495593_0000861
985 Ga0495593_0001333
986 Ga0495593_0001795
987 Ga0495593_0003929
988 Ga0495593_0012080
989 Ga0495602_0001137
990 Ga0495602_0006588
991 Ga0495602_0011607
992 Ga0496100_0014163
993 Ga0496100_0071617
994 Ga0496100_0249117
995 Ga0496101_0010002
996 Ga0496101_0014112
997 Ga0496101_0028785
998 Ga0496102_0028256
999 Ga0496104_0020536
1000 Ga0496104_0296471
1001 Ga0496105_0011544
1002 Ga0496105_0016382
1003 Ga0496105_0034177
1004 Ga0496106_0138929
1005 Ga0496107_0105256
1006 Ga0496109_0003895
1007 Ga0496110_0004135
1008 Ga0496110_0039023
1009 Ga0496110_0084210
1010 Ga0496111_0074009
1011 Ga0496112_0002367
1012 Ga0496113_0003751
1013 Ga0496113_0019242
1014 Ga0496114_0001072
1015 Ga0496117_0018131
1016 Ga0496117_0042213
1017 Ga0496117_0049074
1018 Ga0496118_0037018
1019 Ga0496118_0048254
1020 Ga0496121_0006535
1021 Ga0496121_0019785
1022 Ga0496121_0139918
1023 Ga0496122_0045701
1024 Ga0496123_0022217
1025 Ga0496124_0035100
1026 Ga0496125_0086465
1027 Ga0496125_0118214
1028 Ga0496126_0247236
1029 Ga0501034_0224053
1030 Ga0501034_0458827
1031 Ga0501262_000431
1032 Ga0501035_0021951
1033 Ga0501044_0003206
1034 nmdc:mga03n38_93451_c1
1035 nmdc:mga00v17_7557_c1
1036 nmdc:mga0yw44_4295_c1
1037 nmdc:mga0k408_19785_c1
1038 nmdc:mga07m45_124926_c1
1039 nmdc:mga07m45_18343_c1
1040 nmdc:mga07m45_3226_c1
1041 nmdc:mga07m45_54144_c1
1042 Ga0500610_0000551
1043 Ga0500610_0003312
1044 Ga0500644_0008259
1045 Ga0500651_0002027
1046 Ga0500607_004085
1047 Ga0500658_0001187
1048 Ga0500658_0003178
1049 Ga0500559_0002100
1050 Ga0500568_0004258
1051 Ga0500616_0000108
1052 Ga0500616_0125572
1053 Ga0500622_0000937
1054 Ga0500634_0033327
1055 Ga0500636_0018717
1056 Ga0466962_0017070
1057 2501072431
1058 2501083879
1059 2501085010
1060 2501413074
1061 2511087296
1062 2511090438
1063 2511100483
1064 2511105853
1065 2512348803
1066 2512352450
1067 2513231269
1068 2513551757
1069 2513561894
1070 2513953552
1071 2514044241
1072 2516017641
1073 2516024820
1074 2521557039
1075 2553004834
1076 2563064859
1077 2596374918
1078 2599620980
1079 2599674214
1080 2599678404
1081 2599690491
1082 2599740170
1083 2599744158
1084 2600206195
1085 2644161272
1086 2644326176
1087 2644400842
1088 2644466071
1089 2676743491
1090 2713482152
1091 2738720821
1092 2738747439
1093 2738882418
1094 2739280020
1095 2739356721
1096 2746087123
1097 2746096056
1098 2753566856
1099 2792838305
1100 2809145725
1101 2819602091
1102 2819616784
1103 2819633632
1104 2831269939
1105 2838055050
1106 2838061367
1107 2842681117
1108 2856289509
1109 2857363977
1110 2863427237
1111 2867346543
1112 2870070038
1113 2881101438
1114 2883089974
1115 2885201959
1116 2885215331
1117 2885275555
1118 2889306520
1119 2899927141
1120 2902332097
1121 2902332372
1122 2902411454
1123 2902688601
1124 2904440262
1125 2904454074
1126 2904462069
1127 2904530827
1128 2904546010
1129 2904567736
1130 2904574862
1131 2904585760
1132 2904592427
1133 2904601438
1134 2919082911
1135 2919465322
1136 2919466998
1137 2923515666
1138 2928043989
1139 2928048637
1140 2928054961
1141 2928068396
1142 2928073711
1143 2928090717
1144 2928129841
1145 2928161974
1146 2928169226
1147 2928178619
1148 2928539047
1149 2929161212
1150 2929521805
1151 2945911825
1152 2945914315
1153 2945949871
1154 2945973874
1155 2945990290
1156 2954770521
1157 2981992862
1158 644750371
1159 8003956923
1160 8018846333
1161 8020939951
1162 8020951581
1163 8020954770
1164 8021128270
1165 8039104577
1166 8055302597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

57

425

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9393 6 383
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9369 6 377
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9354 6 380
5yiy-assembly1.cif.gz_B crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis 0.9351 5 377
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9335 6 378
ID Description Score Start End Superfamily
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9728 6 286 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9704 28 239 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.964 231 318 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9626 6 286 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9604 229 321 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A2W7HCP5-F1-model_v4 deleted 0.9891 28 400
AF-F0G2Y9-F1-model_v4 L-carnitine dehydratase/bile aciD-inducible protein f 0.9846 1 241 GO:0008410
AF-A0A2W7HCP5-F1-model_v4 deleted 0.9838 28 400
AF-A0A379P538-F1-model_v4 deleted 0.981 6 337
AF-A0A7W0PUI8-F1-model_v4 CoA transferase 0.9797 6 199 GO:0008410

Map