F466322

General Info

Members Datasets Scaffolds Average Seq Length
583 439 1166 220

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306091|2551727294
Length 224
Sequence LPHGRAGQSAPIAPLNIVKTDPESFIRANTDILAPPHVPEIRLHLAGEAHELWLKTEEELERIGLPPPFWAFAWAGGQGXRGRRVIDFASGSGLVAIAAKLAGADEVVAADIDPWSETAARLNAGLNGVSFAFTGDDIVGSERAADVYLAGDVFYDKSFADLLLPWFEALERAGAVVLVGDPGRAYCPRGRMTDLATYEVPVTRALEDSEVKRTTVWRFGTLTG

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
41 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
42 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
43 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
44 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
45 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
46 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
84 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
85 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
167 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
168 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
185 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
186 2509276019 Ensifer aridi TW10 Isolate Nodule
187 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
188 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
189 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
190 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
191 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
192 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
193 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
194 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
195 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
196 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
197 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
198 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
199 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
200 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
201 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
202 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
203 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
204 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
205 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
206 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
207 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
208 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
209 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
210 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
211 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
212 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
213 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
214 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
215 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
216 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
217 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
218 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
219 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
220 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
221 2643221557 Ensifer sp. Root558 Isolate Unclassified
222 2643221610 Ensifer sp. Root74 Isolate Unclassified
223 2643221618 Ensifer sp. Root231 Isolate Unclassified
224 2643221626 Ensifer sp. Root31 Isolate Unclassified
225 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
226 2643221655 Ensifer sp. Root1252 Isolate Unclassified
227 2643221659 Ensifer sp. Root127 Isolate Unclassified
228 2643221668 Ensifer sp. Root423 Isolate Unclassified
229 2643221675 Ensifer sp. Root1298 Isolate Unclassified
230 2643221680 Ensifer sp. Root1312 Isolate Unclassified
231 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
232 2643221698 Ensifer sp. Root142 Isolate Unclassified
233 2643221712 Ensifer sp. Root258 Isolate Unclassified
234 2643221723 Ensifer sp. Root278 Isolate Unclassified
235 2643221726 Ensifer sp. Root954 Isolate Unclassified
236 2718217882 Rhizobium sp. N741 Isolate Nodule
237 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
238 2718218009 Rhizobium sp. N561 Isolate Nodule
239 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
240 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
241 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
242 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
243 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
244 2718218363 Rhizobium sp. N113 Isolate Nodule
245 2718218365 Rhizobium sp. N731 Isolate Nodule
246 2718218366 Rhizobium sp. N621 Isolate Nodule
247 2721755514 Rhizobium sp. N6212 Isolate Nodule
248 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
249 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
250 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
251 2721755810 Rhizobium sp. N871 Isolate Nodule
252 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
253 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
254 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
255 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
256 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
257 2728369365 Rhizobium sp. N1341 Isolate Nodule
258 2728369397 Rhizobium sp. N1314 Isolate Nodule
259 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
260 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
261 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
262 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
263 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
264 2791355264 Rhizobium sp. S9 Isolate Nodule
265 2791355265 Rhizobium sp. H4 Isolate Nodule
266 2791355267 Rhizobium sp. L18 Isolate Nodule
267 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
268 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
269 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
270 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
271 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
272 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
273 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
274 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
275 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
276 2838048938 Rhizobium pisi 27/80 Isolate Nodule
277 2838061910 Rhizobium phaseoli L15 Isolate Nodule
278 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
279 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
280 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
281 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
282 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
283 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
284 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
285 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
286 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
287 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
288 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
289 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
290 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
291 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
292 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
293 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
294 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
295 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
296 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
297 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
298 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
299 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
300 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
301 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
302 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
303 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
304 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
305 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
306 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
307 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
308 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
309 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
310 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
311 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
312 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
313 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
314 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
315 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
316 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
317 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
318 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
319 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
320 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
321 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
322 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
323 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
324 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
325 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
326 2844163670 Ensifer sp. 1H6 Isolate Unclassified
327 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
328 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
329 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
330 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
331 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
332 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
333 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
334 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
335 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
336 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
337 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
338 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
339 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
340 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
341 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
342 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
343 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
344 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
345 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
346 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
347 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
348 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
349 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
350 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
351 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
352 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
353 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
354 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
355 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
356 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
357 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
358 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
359 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
360 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
361 2933599457 Rhizobium phaseoli M3 Isolate Nodule
362 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
363 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
364 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
365 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
366 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
367 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
368 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
369 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
370 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
371 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
372 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
373 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
374 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
375 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
376 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
377 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
378 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
379 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
380 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
381 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
382 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
383 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
384 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
385 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
386 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
387 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
388 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
389 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
390 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
391 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
392 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
393 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
394 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
395 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
396 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
397 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
398 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
399 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
400 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
401 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
402 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
403 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
404 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
405 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
406 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
407 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
408 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
409 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
410 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
411 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
412 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
413 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
414 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
415 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
416 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
417 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
418 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
419 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
420 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
421 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
422 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
423 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
424 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
425 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
426 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
427 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
428 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
429 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
430 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
431 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
432 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
433 8018176218 Rhizobium sp. N122 Isolate Nodule
434 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
435 8024501048 Rhizobium sp. H4 Isolate Nodule
436 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
437 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
438 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
439 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.09
Metatranscriptomes 0
Isolates 43.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 24.01
Nodule 38.59
Rhizoplane 1.2
Rhizosphere 17.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000102 3300002705 Bacteria 62463
2 JGI25162J39368_1000879 3300002737 Bacteria 19691
3 JGI25154J39366_1000184 3300002738 Bacteria 48243
4 JGI25158J39367_1000526 3300002739 Bacteria 7697
5 JGI25157J39369_1000009 3300002741 Bacteria 207868
6 JGI25152J39213_1001245 3300002773 Bacteria 11620
7 JGI25152J39213_1008129 3300002773 Bacteria 2634
8 JGI25159J45721_1000053 3300002987 Bacteria 56912
9 JGI25159J45721_1000262 3300002987 Bacteria 24623
10 JGI25151J46595_10010648 3300003187 Bacteria 4259
11 JGI25151J46595_10014524 3300003187 Bacteria 3504
12 JGI25151J46595_10076496 3300003187 Bacteria 988
13 JGI25165J46597_1001977 3300003214 Bacteria 7923
14 JGI25153J46596_10001485 3300003215 Bacteria 13976
15 JGI25153J46596_10019108 3300003215 Bacteria 2634
16 JGI25153J46596_10019385 3300003215 Bacteria 2609
17 JGI25153J46596_10025490 3300003215 Bacteria 2112
18 JGI25160J50197_1000168 3300003354 Bacteria 56596
19 JGI25160J50197_1000235 3300003354 Bacteria 43030
20 JGI25160J50197_1001817 3300003354 Bacteria 10303
21 JGI25161J50226_1000137 3300003374 Bacteria 50627
22 JGI25161J50226_1000175 3300003374 Bacteria 43039
23 JGI25161J50226_1001177 3300003374 Bacteria 8615
24 Ga0055526_1002546 3300003771 Bacteria 12243
25 Ga0055526_1002794 3300003771 Bacteria 11559
26 Ga0055526_1017168 3300003771 Bacteria 2784
27 Ga0055524_1002053 3300003775 Bacteria 10695
28 Ga0055536_1002743 3300003781 Bacteria 9744
29 Ga0055528_1005279 3300003790 Bacteria 6051
30 Ga0055540_1038734 3300003792 Bacteria 1043
31 Ga0055531_10003576 3300003794 Bacteria 9857
32 Ga0058692_1006673 3300003856 Bacteria 3141
33 Ga0058692_1007029 3300003856 Bacteria 3026
34 Ga0055543_1000226 3300004625 Bacteria 44983
35 Ga0055543_1000321 3300004625 Bacteria 33172
36 Ga0055543_1000412 3300004625 Bacteria 26967
37 Ga0055543_1002493 3300004625 Bacteria 6044
38 Ga0065165_1000133 3300005262 Bacteria 128540
39 Ga0065165_1002250 3300005262 Bacteria 17103
40 Ga0070670_100000183 3300005331 Bacteria 57446
41 Ga0070682_100160508 3300005337 Bacteria 1552
42 Ga0070665_100118172 3300005548 Bacteria 2653
43 Ga0068856_100014117 3300005614 Bacteria 7725
44 Ga0075365_10022037 3300006038 Bacteria 3984
45 Ga0075365_10540550 3300006038 Bacteria 824
46 Ga0075368_10000370 3300006042 Bacteria 13204
47 Ga0075362_10005758 3300006177 Bacteria 4564
48 Ga0075362_10041266 3300006177 Bacteria 2035
49 Ga0075367_10214809 3300006178 Bacteria 1203
50 Ga0075369_10007006 3300006186 Bacteria 4280
51 Ga0075369_10009744 3300006186 Bacteria 3741
52 Ga0075366_10015737 3300006195 Bacteria 4342
53 Ga0075370_10000923 3300006353 Bacteria 12065
54 Ga0075370_10036562 3300006353 Bacteria 2758
55 Ga0079104_1019653 3300006946 Bacteria 1881
56 Ga0099826_10030104 3300006948 Bacteria 3947
57 Ga0105243_10018422 3300009148 Bacteria 5289
58 Ga0157373_10007612 3300013100 Bacteria 8048
59 Ga0157371_10000108 3300013102 Bacteria 126288
60 Ga0157370_10000720 3300013104 Bacteria 41451
61 Ga0157369_10054912 3300013105 Bacteria 4300
62 Ga0171463_1004 3300013249 Bacteria 437207
63 Ga0183363_1208 3300015690 Bacteria 11915
64 Ga0214544_1000024 3300021320 Bacteria 163562
65 Ga0214542_1000008 3300021321 Bacteria 278895
66 Ga0214542_1034512 3300021321 Bacteria 1630
67 Ga0214543_1000031 3300021327 Bacteria 206436
68 Ga0214543_1000053 3300021327 Bacteria 141797
69 Ga0228711_1000050 3300022739 Bacteria 81399
70 Ga0228710_1000063 3300022740 Bacteria 81399
71 Ga0209435_100009 3300025206 Bacteria 476614
72 Ga0209436_100299 3300025208 Bacteria 22971
73 Ga0209436_101476 3300025208 Bacteria 8154
74 Ga0209672_104990 3300025228 Bacteria 2350
75 Ga0209563_102664 3300025230 Bacteria 3946
76 Ga0209437_100057 3300025233 Bacteria 362922
77 Ga0209437_100107 3300025233 Bacteria 218656
78 Ga0207425_1001864 3300025245 Bacteria 8100
79 Ga0209646_1000018 3300025246 Bacteria 476716
80 Ga0209646_1010312 3300025246 Bacteria 1465
81 Ga0209026_1000068 3300025250 Bacteria 207601
82 Ga0209759_1000007 3300025256 Bacteria 476614
83 Ga0209759_1027110 3300025256 Bacteria 1188
84 Ga0209129_1001411 3300025258 Bacteria 13452
85 Ga0209129_1002128 3300025258 Bacteria 10070
86 Ga0209129_1002320 3300025258 Bacteria 9438
87 Ga0209129_1007959 3300025258 Bacteria 3035
88 Ga0209233_1000072 3300025261 Bacteria 363074
89 Ga0209233_1000134 3300025261 Bacteria 202535
90 Ga0209673_1000052 3300025273 Bacteria 279795
91 Ga0209673_1000459 3300025273 Bacteria 68727
92 Ga0209673_1024436 3300025273 Bacteria 2030
93 Ga0209130_1000009 3300025284 Bacteria 498952
94 Ga0209130_1000027 3300025284 Bacteria 327700
95 Ga0209130_1000132 3300025284 Bacteria 119765
96 Ga0209130_1032805 3300025284 Bacteria 1056
97 Ga0209676_1001384 3300025292 Bacteria 23645
98 Ga0209025_1000042 3300025294 Bacteria 370577
99 Ga0209025_1000241 3300025294 Bacteria 128329
100 Ga0209025_1001035 3300025294 Bacteria 40774
101 Ga0209025_1017322 3300025294 Bacteria 4169
102 Ga0209025_1020286 3300025294 Bacteria 3644
103 Ga0209025_1068563 3300025294 Bacteria 1273
104 Ga0209025_1068620 3300025294 Bacteria 1272
105 Ga0209564_1000111 3300025295 Bacteria 212210
106 Ga0209564_1000569 3300025295 Bacteria 58592
107 Ga0209564_1006046 3300025295 Bacteria 6668
108 Ga0209758_1002002 3300025297 Bacteria 21937
109 Ga0209758_1005244 3300025297 Bacteria 10149
110 Ga0209758_1014392 3300025297 Bacteria 4211
111 Ga0209758_1019160 3300025297 Bacteria 3315
112 Ga0209758_1028111 3300025297 Bacteria 2387
113 Ga0209758_1043029 3300025297 Bacteria 1668
114 Ga0209758_1057280 3300025297 Bacteria 1311
115 Ga0209050_1008253 3300025298 Bacteria 5613
116 Ga0209256_1000132 3300025299 Bacteria 160806
117 Ga0209256_1000361 3300025299 Bacteria 73723
118 Ga0209256_1002153 3300025299 Bacteria 16996
119 Ga0209256_1002711 3300025299 Bacteria 13805
120 Ga0209256_1011367 3300025299 Bacteria 3571
121 Ga0209256_1019551 3300025299 Bacteria 2150
122 Ga0209256_1019624 3300025299 Bacteria 2144
123 Ga0207426_1000041 3300025302 Bacteria 433536
124 Ga0207426_1000072 3300025302 Bacteria 327700
125 Ga0207426_1000246 3300025302 Bacteria 119765
126 Ga0207426_1000723 3300025302 Bacteria 38116
127 Ga0209051_1003573 3300025303 Bacteria 10112
128 Ga0209051_1013102 3300025303 Bacteria 3965
129 Ga0209051_1018700 3300025303 Bacteria 3056
130 Ga0209257_1001613 3300025304 Bacteria 25850
131 Ga0209257_1031551 3300025304 Bacteria 1693
132 Ga0209257_1060092 3300025304 Bacteria 1035
133 Ga0207650_10000151 3300025925 Bacteria 83229
134 Ga0207709_10143847 3300025935 Bacteria 1643
135 Ga0207678_10016101 3300026067 Bacteria 6566
136 Ga0207702_10014459 3300026078 Bacteria 6553
137 Ga0209281_1000030 3300027111 Bacteria 425931
138 Ga0209281_1000840 3300027111 Bacteria 27410
139 Ga0209371_1000037 3300027312 Bacteria 367074
140 Ga0209371_1001857 3300027312 Bacteria 12997
141 Ga0209371_1008497 3300027312 Bacteria 3402
142 Ga0209282_1000004 3300027666 Bacteria 425931
143 Ga0209282_1000283 3300027666 Bacteria 25146
144 Ga0209282_1039116 3300027666 Bacteria 2833
145 Ga0209813_10000828 3300027866 Bacteria 7008
146 Ga0268265_10652163 3300028380 Bacteria 1012
147 Ga0307515_10000377 3300028794 Bacteria 109082
148 Ga0307515_10016274 3300028794 Bacteria 13625
149 Ga0307515_10033701 3300028794 Bacteria 8418
150 Ga0307515_10458804 3300028794 Bacteria 889
151 Ga0268256_1000039 3300030500 Bacteria 354969
152 Ga0268256_1002298 3300030500 Bacteria 9905
153 Ga0268256_1008786 3300030500 Bacteria 3431
154 Ga0307513_10001888 3300031456 Bacteria 29770
155 Ga0307413_10664400 3300031824 Bacteria 861
156 Ga0307410_10188008 3300031852 Bacteria 1569
157 Ga0307410_10469622 3300031852 Bacteria 1030
158 Ga0315914_1000001 3300031967 Bacteria 416633
159 Ga0315913_1000024 3300033430 Bacteria 90863
160 Ga0315915_1000002 3300033464 Bacteria 425854
161 Ga0373923_0263581 3300035111 Bacteria 809
162 Ga0373927_0000135 3300035695 Bacteria 56787
163 Ga0373925_0001135 3300037068 Bacteria 23635
164 Ga0395900_0092735 3300037418 Bacteria 3103
165 Ga0395905_0001126 3300037471 Bacteria 33477
166 Ga0395905_0136682 3300037471 Bacteria 2306
167 Ga0395901_0320823 3300038443 Bacteria 1603
168 Ga0400488_01324 3300038741 Bacteria 1034
169 Ga0439438_044942 3300041405 Bacteria 1137
170 Ga0439447_043642 3300041407 Bacteria 1086
171 Ga0439465_0008566 3300041413 Bacteria 3227
172 Ga0439465_0085351 3300041413 Bacteria 1075
173 Ga0451787_328280 3300041441 Bacteria 1979
174 Ga0451849_0612694 3300041505 Bacteria 1022
175 Ga0451853_1929787 3300041512 Bacteria 1682
176 Ga0439433_0094624 3300041999 Bacteria 737
177 Ga0439449_0031021 3300042007 Bacteria 1992
178 Ga0439462_0017774 3300042015 Bacteria 1843
179 Ga0450906_008285 3300042145 Bacteria 2017
180 Ga0450907_012720 3300042146 Bacteria 1401
181 Ga0439434_0110972 3300042435 Bacteria 888
182 Ga0466963_0057534 3300044694 Bacteria 2589
183 Ga0466970_0023346 3300044765 Bacteria 3229
184 Ga0466957_0252803 3300044842 Bacteria 1172
185 Ga0466958_0031431 3300045836 Bacteria 3155
186 Ga0466967_0177688 3300045976 Bacteria 2006
187 Ga0495590_0008145 3300046457 Bacteria 4013
188 Ga0495605_0259809 3300046474 Bacteria 741
189 Ga0495607_0278492 3300046501 Bacteria 794
190 Ga0495583_0100666 3300046506 Bacteria 1234
191 Ga0495606_0011138 3300046507 Bacteria 7371
192 Ga0495610_0023092 3300046512 Bacteria 3389
193 Ga0495610_0135631 3300046512 Bacteria 1064
194 Ga0495616_0002338 3300046513 Bacteria 12653
195 Ga0495620_0017309 3300046515 Bacteria 3596
196 Ga0495632_0026520 3300046519 Bacteria 3049
197 Ga0495609_0012502 3300046538 Bacteria 4027
198 Ga0495609_0070523 3300046538 Bacteria 1536
199 Ga0495597_0077195 3300046542 Bacteria 1428
200 Ga0495633_0053812 3300046558 Bacteria 1894
201 Ga0495668_0025481 3300046616 Bacteria 3360
202 Ga0495625_0014610 3300046660 Bacteria 6256
203 Ga0495625_0059406 3300046660 Bacteria 2713
204 Ga0495625_0328812 3300046660 Bacteria 971
205 Ga0495670_0138369 3300046691 Bacteria 1272
206 Ga0495649_0034639 3300046694 Bacteria 2778
207 Ga0495660_0015869 3300046810 Bacteria 4346
208 Ga0495636_0029106 3300047318 Bacteria 2254
209 Ga0495687_115828 3300047443 Bacteria 976
210 Ga0495686_0045229 3300047472 Bacteria 2785
211 Ga0495686_0126052 3300047472 Bacteria 1522
212 Ga0495626_0064869 3300048091 Bacteria 1654
213 Ga0496104_0070681 3300048907 Bacteria 3319
214 Ga0496106_0002113 3300048909 Bacteria 14850
215 Ga0496106_0227374 3300048909 Bacteria 1489
216 Ga0496116_0016742 3300048919 Bacteria 5722
217 Ga0496116_0020118 3300048919 Bacteria 5079
218 Ga0496116_0134532 3300048919 Bacteria 1402
219 Ga0496117_0000031 3300048920 Bacteria 381048
220 Ga0496117_0004678 3300048920 Bacteria 14866
221 Ga0496117_0017870 3300048920 Bacteria 5908
222 Ga0496117_0120834 3300048920 Bacteria 1609
223 Ga0496117_0176067 3300048920 Bacteria 1236
224 Ga0496117_0259116 3300048920 Bacteria 944
225 Ga0496118_0001884 3300048921 Bacteria 29940
226 Ga0496118_0004259 3300048921 Bacteria 17116
227 Ga0496118_0017624 3300048921 Bacteria 6488
228 Ga0496118_0208467 3300048921 Bacteria 1149
229 Ga0496119_0036562 3300048922 Bacteria 3203
230 Ga0496119_0058927 3300048922 Bacteria 2310
231 Ga0496119_0059077 3300048922 Bacteria 2306
232 Ga0496119_0060203 3300048922 Bacteria 2275
233 Ga0496119_0091575 3300048922 Bacteria 1726
234 Ga0496120_0001817 3300048923 Bacteria 23874
235 Ga0496120_0014950 3300048923 Bacteria 5143
236 Ga0496120_0056595 3300048923 Bacteria 2212
237 Ga0496120_0280621 3300048923 Bacteria 770
238 Ga0496121_0000034 3300048924 Bacteria 377095
239 Ga0496121_0275544 3300048924 Bacteria 1154
240 Ga0496122_0000023 3300048925 Bacteria 381035
241 Ga0496122_0002284 3300048925 Bacteria 27720
242 Ga0496122_0125444 3300048925 Bacteria 1644
243 Ga0496122_0173935 3300048925 Bacteria 1293
244 Ga0496122_0271258 3300048925 Bacteria 934
245 Ga0496123_0000027 3300048926 Bacteria 306773
246 Ga0496123_0000290 3300048926 Bacteria 98053
247 Ga0496123_0031088 3300048926 Bacteria 3892
248 Ga0496123_0044983 3300048926 Bacteria 3012
249 Ga0496123_0053721 3300048926 Bacteria 2660
250 Ga0496123_0079503 3300048926 Bacteria 2003
251 Ga0496124_0008017 3300048927 Bacteria 11111
252 Ga0496124_0009644 3300048927 Bacteria 9889
253 Ga0496124_0271971 3300048927 Bacteria 1240
254 Ga0496125_0000030 3300048928 Bacteria 375023
255 Ga0496125_0003346 3300048928 Bacteria 19530
256 Ga0496125_0014218 3300048928 Bacteria 7760
257 Ga0496125_0133085 3300048928 Bacteria 1746
258 Ga0496125_0216734 3300048928 Bacteria 1237
259 Ga0496125_0248521 3300048928 Bacteria 1124
260 Ga0496125_0288152 3300048928 Bacteria 1013
261 Ga0496126_0002222 3300048929 Bacteria 26858
262 Ga0496126_0004878 3300048929 Bacteria 15705
263 Ga0496126_0009461 3300048929 Bacteria 10344
264 Ga0496126_0034327 3300048929 Bacteria 4764
265 Ga0496126_0192147 3300048929 Bacteria 1728
266 Ga0496126_0251933 3300048929 Bacteria 1471
267 Ga0496126_0253787 3300048929 Bacteria 1464
268 Ga0495678_016669 3300049459 Bacteria 3352
269 Ga0495682_0007963 3300049460 Bacteria 4190
270 Ga0501031_0027698 3300049568 Bacteria 3694
271 Ga0501033_0000518 3300049570 Bacteria 36156
272 Ga0501033_0077311 3300049570 Bacteria 2442
273 Ga0501033_0314726 3300049570 Bacteria 1100
274 Ga0501034_0251782 3300049571 Bacteria 1711
275 Ga0501034_0486126 3300049571 Bacteria 1149
276 Ga0501036_0115040 3300049572 Bacteria 2273
277 Ga0501037_0056639 3300049573 Bacteria 2862
278 Ga0501039_0058415 3300049575 Bacteria 2988
279 Ga0501043_0161588 3300049579 Bacteria 1750
280 Ga0501043_0165230 3300049579 Bacteria 1728
281 Ga0501047_0078900 3300049581 Bacteria 3166
282 Ga0501047_0174214 3300049581 Bacteria 2020
283 Ga0501048_0047427 3300049582 Bacteria 3066
284 Ga0501083_0040593 3300049744 Bacteria 3158
285 Ga0501035_0000316 3300049822 Bacteria 55833
286 Ga0501035_0167364 3300049822 Bacteria 1900
287 nmdc:mga03683_10202_c1 3300050489 Bacteria 3364
288 nmdc:mga03n38_74528_c1 3300050490 Bacteria 1579
289 nmdc:mga03n38_84582_c1 3300050490 Bacteria 1498
290 nmdc:mga00v17_229530_c1 3300050491 Bacteria 1203
291 nmdc:mga00v17_360_c1 3300050491 Bacteria 25745
292 nmdc:mga0yw44_10819_c2 3300050492 Bacteria 2203
293 nmdc:mga0yw44_1402_c1 3300050492 Bacteria 9555
294 nmdc:mga0yw44_257407_c1 3300050492 Bacteria 1163
295 nmdc:mga0yw44_48194_c1 3300050492 Bacteria 2569
296 nmdc:mga0k408_68217_c1 3300050493 Bacteria 2074
297 nmdc:mga06z11_137765_c1 3300050494 Bacteria 1377
298 nmdc:mga06z11_60498_c1 3300050494 Bacteria 1972
299 nmdc:mga06z11_7031_c1 3300050494 Bacteria 4614
300 nmdc:mga07m45_139912_c1 3300050496 Bacteria 1402
301 nmdc:mga07m45_211356_c1 3300050496 Bacteria 1129
302 nmdc:mga07m45_2146_c1 3300050496 Bacteria 2716
303 nmdc:mga0sz30_1057_c1 3300050516 Bacteria 9929
304 Ga0500651_0350323 3300053093 Bacteria 838
305 Ga0500560_000732 3300053107 Bacteria 4959
306 Ga0500569_021327 3300053109 Bacteria 1711
307 Ga0500569_094345 3300053109 Bacteria 973
308 Ga0500572_003603 3300053111 Bacteria 3525
309 Ga0500594_0001734 3300053118 Bacteria 4745
310 Ga0500618_003034 3300053125 Bacteria 5964
311 Ga0500658_0000112 3300053134 Bacteria 38407
312 Ga0500658_0136052 3300053134 Bacteria 1099
313 Ga0500659_0101648 3300053135 Bacteria 1489
314 Ga0500559_0002392 3300053136 Bacteria 9741
315 Ga0500561_0000170 3300053137 Bacteria 12023
316 Ga0500568_0011712 3300053139 Bacteria 4054
317 Ga0500604_0016781 3300053151 Bacteria 2019
318 Ga0500604_0041820 3300053151 Bacteria 1387
319 Ga0500616_0048868 3300053153 Bacteria 2241
320 Ga0500616_0226166 3300053153 Bacteria 813
321 Ga0500620_000075 3300053155 Bacteria 19025
322 Ga0500622_0001966 3300053156 Bacteria 15471
323 Ga0500633_0005614 3300053160 Bacteria 2999
324 Ga0500636_0000025 3300053177 Bacteria 86697
325 Ga0501084_0242070 3300054114 Bacteria 1523
326 Ga0501082_0055900 3300060353 Bacteria 3399
327 Ga0501082_0647102 3300060353 Bacteria 925
328 2551727294 2551306091 Bacteria 7086830
329 2509109488 2508501122 Bacteria 6292184
330 2509378202 2509276019 Bacteria 6802256
331 2510305357 2510065057 Bacteria 6649661
332 2511503225 2511231052 Bacteria 6974333
333 2512534496 2512047086 Bacteria 6850303
334 2512973693 2512875026 Bacteria 6861065
335 2513578601 2513237085 Bacteria 7695351
336 2513586099 2513237086 Bacteria 7265287
337 2513601789 2513237089 Bacteria 6553624
338 2513615615 2513237091 Bacteria 6900273
339 2513884190 2513237140 Bacteria 7076289
340 2513903519 2513237143 Bacteria 6664116
341 2513984064 2513237156 Bacteria 6402557
342 2513998548 2513237159 Bacteria 6810126
343 2514003627 2513237160 Bacteria 6650282
344 2515610963 2515154107 Bacteria 6795637
345 2515741527 2515154134 Bacteria 7220242
346 2516894656 2516653046 Bacteria 6989037
347 2517078250 2516653085 Bacteria 7346596
348 2517571304 2517487022 Bacteria 7227575
349 2524450552 2524023207 Bacteria 6813453
350 2530647410 2529292951 Bacteria 6916614
351 2551675887 2551306084 Bacteria 8942552
352 2551689613 2551306085 Bacteria 7347181
353 2551693318 2551306086 Bacteria 6843938
354 2551703303 2551306087 Bacteria 7351905
355 2551709408 2551306089 Bacteria 7162724
356 2551723760 2551306090 Bacteria 7953713
357 2551734706 2551306092 Bacteria 6992595
358 2551741024 2551306093 Bacteria 7064773
359 2558867312 2558860100 Bacteria 8458965
360 2585387910 2582581865 Bacteria 6644329
361 2585396005 2582581866 Bacteria 6859583
362 2600193463 2599185352 Bacteria 7228948
363 2601610783 2600255279 Bacteria 5605316
364 2601747557 2600255308 Bacteria 5611129
365 2643808154 2643221557 Bacteria 7184309
366 2644068657 2643221610 Bacteria 7480339
367 2644110062 2643221618 Bacteria 7717186
368 2644150338 2643221626 Bacteria 8069654
369 2644201464 2643221636 Bacteria 6583769
370 2644312942 2643221655 Bacteria 7722067
371 2644336490 2643221659 Bacteria 7890716
372 2644379588 2643221668 Bacteria 7306521
373 2644419726 2643221675 Bacteria 7473456
374 2644453083 2643221680 Bacteria 7473610
375 2644484432 2643221686 Bacteria 6310811
376 2644546136 2643221698 Bacteria 7756764
377 2644618672 2643221712 Bacteria 7729434
378 2644677182 2643221723 Bacteria 7095460
379 2644688888 2643221726 Bacteria 7455827
380 2719182902 2718217882 Bacteria 6556348
381 2719667245 2718217997 Bacteria 6740740
382 2719733619 2718218009 Bacteria 6478651
383 2720493665 2718218199 Bacteria 6740745
384 2720615120 2718218232 Bacteria 6720332
385 2720621913 2718218233 Bacteria 6662049
386 2720633263 2718218235 Bacteria 6630699
387 2720776962 2718218269 Bacteria 6906114
388 2721149014 2718218363 Bacteria 6524337
389 2721160412 2718218365 Bacteria 6274507
390 2721165827 2718218366 Bacteria 6425255
391 2722841997 2721755514 Bacteria 6424414
392 2723028561 2721755556 Bacteria 6745503
393 2723562163 2721755684 Bacteria 6859907
394 2723568866 2721755685 Bacteria 6704835
395 2724046375 2721755810 Bacteria 6479005
396 2724091569 2721755819 Bacteria 6906405
397 2724106131 2721755822 Bacteria 6726041
398 2724111936 2721755823 Bacteria 6752556
399 2725947472 2724679232 Bacteria 7646494
400 2730109497 2728369352 Bacteria 6745171
401 2730166137 2728369365 Bacteria 6555560
402 2730300044 2728369397 Bacteria 6274511
403 2753463723 2751185821 Bacteria 6189929
404 2766064337 2765235942 Bacteria 7445910
405 2792582136 2791355082 Bacteria 5973319
406 2792641332 2791355094 Bacteria 7011481
407 2793281108 2791355253 Bacteria 5171699
408 2793346539 2791355264 Bacteria 6429314
409 2793353926 2791355265 Bacteria 6539969
410 2793365840 2791355267 Bacteria 7222458
411 2802717329 2802428858 Bacteria 6636079
412 2802724682 2802428859 Bacteria 6667919
413 2802729434 2802428860 Bacteria 6525526
414 2802736779 2802428861 Bacteria 6534206
415 2802743185 2802428862 Bacteria 6633353
416 2802749689 2802428863 Bacteria 6410669
417 2805926147 2802429605 Bacteria 6875453
418 2819560907 2818991439 Bacteria 6907412
419 2838018396 2838016132 Bacteria 6577831
420 2838050742 2838048938 Bacteria 6044578
421 2838062507 2838061910 Bacteria 6794874
422 2838072059 2838068647 Bacteria 6208656
423 2838078267 2838074704 Bacteria 6785777
424 2838672882 2838668709 Bacteria 6671819
425 2838683956 2838680041 Bacteria 6545511
426 2838690214 2838686498 Bacteria 7807632
427 2838698485 2838694306 Bacteria 6853137
428 2838705640 2838701080 Bacteria 6669771
429 2838711600 2838707686 Bacteria 6619912
430 2838731989 2838729681 Bacteria 7400765
431 2838744885 2838742623 Bacteria 7396178
432 2841855942 2841851746 Bacteria 7532261
433 2841867823 2841864319 Bacteria 6742987
434 2842081401 2842077413 Bacteria 6508645
435 2842116925 2842110456 Bacteria 7656360
436 2842121822 2842118031 Bacteria 7033875
437 2842149970 2842146304 Bacteria 5957337
438 2842161112 2842156927 Bacteria 6894975
439 2842166630 2842163707 Bacteria 6916235
440 2842184728 2842180545 Bacteria 6888678
441 2842194951 2842192696 Bacteria 6147454
442 2842232311 2842229732 Bacteria 7475766
443 2842240837 2842237096 Bacteria 6620661
444 2842246726 2842243621 Bacteria 7421798
445 2842255320 2842250916 Bacteria 6579627
446 2842261172 2842257432 Bacteria 7401195
447 2842269573 2842264693 Bacteria 6472963
448 2842274234 2842271015 Bacteria 7807131
449 2842288448 2842285085 Bacteria 6011953
450 2842295058 2842291075 Bacteria 7076806
451 2842305919 2842304105 Bacteria 7023636
452 2842311346 2842311132 Bacteria 6616990
453 2842321042 2842317721 Bacteria 6793725
454 2842366337 2842363717 Bacteria 6844742
455 2842374924 2842370503 Bacteria 7038661
456 2842381457 2842377471 Bacteria 7140707
457 2842388527 2842384541 Bacteria 7057858
458 2842406206 2842402390 Bacteria 6681310
459 2842412791 2842409023 Bacteria 6687331
460 2842419330 2842415677 Bacteria 6596907
461 2842425691 2842422224 Bacteria 6239196
462 2842433531 2842428310 Bacteria 6767288
463 2842439859 2842434925 Bacteria 6502746
464 2842446488 2842441272 Bacteria 6769273
465 2842448845 2842447887 Bacteria 6754142
466 2842467838 2842462802 Bacteria 6588055
467 2842474468 2842469257 Bacteria 6752936
468 2842491095 2842489311 Bacteria 6620893
469 2842498432 2842495871 Bacteria 6820686
470 2844164261 2844163670 Bacteria 7266046
471 2844457088 2844454524 Bacteria 7952546
472 2847673806 2847670302 Bacteria 6165597
473 2850082548 2850079185 Bacteria 6848280
474 2855827282 2855825444 Bacteria 6785811
475 2855842664 2855839649 Bacteria 7135830
476 2856320543 2856314179 Bacteria 6477897
477 2857519502 2857516855 Bacteria 7787325
478 2858803475 2858800743 Bacteria 6603254
479 2878038958 2878035449 Bacteria 6555736
480 2878760013 2878753008 Bacteria 6922523
481 2881867187 2881861095 Bacteria 7128710
482 2885324478 2885318864 Bacteria 6729568
483 2885344913 2885342637 Bacteria 7011821
484 2885357740 2885350715 Bacteria 6787678
485 2891373844 2891373044 Bacteria 5202277
486 2903494247 2903492973 Bacteria 13473544
487 2906421322 2906414383 Bacteria 6580790
488 2913300074 2913295892 Bacteria 6333755
489 2915982544 2915980308 Bacteria 6624279
490 2916031236 2916028427 Bacteria 6748433
491 2920760448 2920760137 Bacteria 7427611
492 2920825843 2920822456 Bacteria 6897201
493 2921205898 2921201388 Bacteria 6926299
494 2921257702 2921257292 Bacteria 6808382
495 2924161153 2924158325 Bacteria 7188855
496 2924169926 2924165586 Bacteria 7260590
497 2924173347 2924172951 Bacteria 6749356
498 2924193693 2924193448 Bacteria 6955718
499 2924209343 2924207177 Bacteria 6917007
500 2924790817 2924784321 Bacteria 7416538
501 2933010684 2933006813 Bacteria 4912075
502 2933572424 2933570622 Bacteria 7023390
503 2933593071 2933586486 Bacteria 7667493
504 2933597617 2933594066 Bacteria 5594265
505 2933603087 2933599457 Bacteria 5858799
506 2935897866 2935894831 Bacteria 6620579
507 2935903698 2935901341 Bacteria 7341747
508 2936997559 2936996657 Bacteria 6298727
509 2937013674 2937009748 Bacteria 6746052
510 2937019108 2937016420 Bacteria 6782579
511 2937024782 2937023124 Bacteria 6815156
512 2937036097 2937036028 Bacteria 6846469
513 2937051125 2937049772 Bacteria 6757901
514 2937106700 2937106411 Bacteria 6947143
515 2937132663 2937126314 Bacteria 6771275
516 2941501258 2941499720 Bacteria 7599444
517 2957400517 2957395598 Bacteria 6822399
518 2957416601 2957415311 Bacteria 6991633
519 2957463743 2957457609 Bacteria 6967680
520 2957470678 2957464669 Bacteria 6568877
521 2957483963 2957478035 Bacteria 6756658
522 2957485692 2957484790 Bacteria 6703082
523 2957502980 2957498199 Bacteria 7126688
524 2960587002 2960584000 Bacteria 6864594
525 2960624930 2960624210 Bacteria 6875384
526 2960664286 2960660292 Bacteria 7041660
527 2961177284 2961170736 Bacteria 7072258
528 2964609626 2964607997 Bacteria 7101408
529 2964657402 2964656573 Bacteria 7100150
530 2964674246 2964670856 Bacteria 6851364
531 2964683083 2964678106 Bacteria 6792020
532 2964707906 2964705432 Bacteria 7114648
533 2964712887 2964712639 Bacteria 6695970
534 2967673513 2967671571 Bacteria 7021409
535 2967711412 2967706974 Bacteria 7186053
536 2967722583 2967721400 Bacteria 7073753
537 2967739022 2967735183 Bacteria 6827012
538 2967749874 2967748971 Bacteria 6733771
539 2967768122 2967762386 Bacteria 6923502
540 2968002387 2967996073 Bacteria 6787468
541 2968009618 2968003550 Bacteria 6929263
542 2970062355 2970061556 Bacteria 7099761
543 2970086371 2970082768 Bacteria 6183754
544 2970122353 2970116247 Bacteria 6501857
545 2970133729 2970129317 Bacteria 6806560
546 2970138159 2970136068 Bacteria 7207982
547 2970143717 2970143518 Bacteria 6446480
548 2970175015 2970170962 Bacteria 6876229
549 2970178822 2970177841 Bacteria 6768001
550 2970186912 2970184632 Bacteria 7054431
551 2970509958 2970503327 Bacteria 7099517
552 2977559691 2977558990 Bacteria 6863948
553 2977585491 2977579622 Bacteria 6772100
554 2977828535 2977821940 Bacteria 6906439
555 2977829663 2977828996 Bacteria 7007971
556 2979104450 2979100975 Bacteria 5423623
557 2979814834 2979808191 Bacteria 7179355
558 2984513754 2984509177 Bacteria 5274802
559 2984522668 2984518228 Bacteria 5277463
560 2984541974 2984537506 Bacteria 5277481
561 2984601404 2984601300 Bacteria 5455244
562 2989354836 2989349275 Bacteria 6349068
563 648737104 648276728 Bacteria 6968865
564 650741111 650716007 Bacteria 5573770
565 8003995246 8003992118 Bacteria 7266902
566 8004381512 8004374579 Bacteria 6898112
567 8005286813 8005282627 Bacteria 6675747
568 8005313635 8005307578 Bacteria 7395396
569 8005431040 8005430974 Bacteria 6689030
570 8005497609 8005497431 Bacteria 6477605
571 8005565729 8005563573 Bacteria 7153261
572 8005623343 8005619151 Bacteria 7030230
573 8005631077 8005626139 Bacteria 6534237
574 8005669014 8005668836 Bacteria 6953162
575 8005694404 8005688590 Bacteria 6610080
576 8018155121 8018150411 Bacteria 5549903
577 8018177081 8018176218 Bacteria 6896178
578 8023686473 8023680758 Bacteria 7729763
579 8024502394 8024501048 Bacteria 6427847
580 8049296165 8049293176 Bacteria 6128433
581 8054560172 8054558443 Bacteria 5204801
582 8055435632 8055431914 Bacteria 4551896
583 8056380349 8056375014 Bacteria 7006639
584 JGI25156J39149_1000102
585 JGI25162J39368_1000879
586 JGI25154J39366_1000184
587 JGI25158J39367_1000526
588 JGI25157J39369_1000009
589 JGI25152J39213_1001245
590 JGI25152J39213_1008129
591 JGI25159J45721_1000053
592 JGI25159J45721_1000262
593 JGI25151J46595_10010648
594 JGI25151J46595_10014524
595 JGI25151J46595_10076496
596 JGI25165J46597_1001977
597 JGI25153J46596_10001485
598 JGI25153J46596_10019108
599 JGI25153J46596_10019385
600 JGI25153J46596_10025490
601 JGI25160J50197_1000168
602 JGI25160J50197_1000235
603 JGI25160J50197_1001817
604 JGI25161J50226_1000137
605 JGI25161J50226_1000175
606 JGI25161J50226_1001177
607 Ga0055526_1002546
608 Ga0055526_1002794
609 Ga0055526_1017168
610 Ga0055524_1002053
611 Ga0055536_1002743
612 Ga0055528_1005279
613 Ga0055540_1038734
614 Ga0055531_10003576
615 Ga0058692_1006673
616 Ga0058692_1007029
617 Ga0055543_1000226
618 Ga0055543_1000321
619 Ga0055543_1000412
620 Ga0055543_1002493
621 Ga0065165_1000133
622 Ga0065165_1002250
623 Ga0070670_100000183
624 Ga0070682_100160508
625 Ga0070665_100118172
626 Ga0068856_100014117
627 Ga0075365_10022037
628 Ga0075365_10540550
629 Ga0075368_10000370
630 Ga0075362_10005758
631 Ga0075362_10041266
632 Ga0075367_10214809
633 Ga0075369_10007006
634 Ga0075369_10009744
635 Ga0075366_10015737
636 Ga0075370_10000923
637 Ga0075370_10036562
638 Ga0079104_1019653
639 Ga0099826_10030104
640 Ga0105243_10018422
641 Ga0157373_10007612
642 Ga0157371_10000108
643 Ga0157370_10000720
644 Ga0157369_10054912
645 Ga0171463_1004
646 Ga0183363_1208
647 Ga0214544_1000024
648 Ga0214542_1000008
649 Ga0214542_1034512
650 Ga0214543_1000031
651 Ga0214543_1000053
652 Ga0228711_1000050
653 Ga0228710_1000063
654 Ga0209435_100009
655 Ga0209436_100299
656 Ga0209436_101476
657 Ga0209672_104990
658 Ga0209563_102664
659 Ga0209437_100057
660 Ga0209437_100107
661 Ga0207425_1001864
662 Ga0209646_1000018
663 Ga0209646_1010312
664 Ga0209026_1000068
665 Ga0209759_1000007
666 Ga0209759_1027110
667 Ga0209129_1001411
668 Ga0209129_1002128
669 Ga0209129_1002320
670 Ga0209129_1007959
671 Ga0209233_1000072
672 Ga0209233_1000134
673 Ga0209673_1000052
674 Ga0209673_1000459
675 Ga0209673_1024436
676 Ga0209130_1000009
677 Ga0209130_1000027
678 Ga0209130_1000132
679 Ga0209130_1032805
680 Ga0209676_1001384
681 Ga0209025_1000042
682 Ga0209025_1000241
683 Ga0209025_1001035
684 Ga0209025_1017322
685 Ga0209025_1020286
686 Ga0209025_1068563
687 Ga0209025_1068620
688 Ga0209564_1000111
689 Ga0209564_1000569
690 Ga0209564_1006046
691 Ga0209758_1002002
692 Ga0209758_1005244
693 Ga0209758_1014392
694 Ga0209758_1019160
695 Ga0209758_1028111
696 Ga0209758_1043029
697 Ga0209758_1057280
698 Ga0209050_1008253
699 Ga0209256_1000132
700 Ga0209256_1000361
701 Ga0209256_1002153
702 Ga0209256_1002711
703 Ga0209256_1011367
704 Ga0209256_1019551
705 Ga0209256_1019624
706 Ga0207426_1000041
707 Ga0207426_1000072
708 Ga0207426_1000246
709 Ga0207426_1000723
710 Ga0209051_1003573
711 Ga0209051_1013102
712 Ga0209051_1018700
713 Ga0209257_1001613
714 Ga0209257_1031551
715 Ga0209257_1060092
716 Ga0207650_10000151
717 Ga0207709_10143847
718 Ga0207678_10016101
719 Ga0207702_10014459
720 Ga0209281_1000030
721 Ga0209281_1000840
722 Ga0209371_1000037
723 Ga0209371_1001857
724 Ga0209371_1008497
725 Ga0209282_1000004
726 Ga0209282_1000283
727 Ga0209282_1039116
728 Ga0209813_10000828
729 Ga0268265_10652163
730 Ga0307515_10000377
731 Ga0307515_10016274
732 Ga0307515_10033701
733 Ga0307515_10458804
734 Ga0268256_1000039
735 Ga0268256_1002298
736 Ga0268256_1008786
737 Ga0307513_10001888
738 Ga0307413_10664400
739 Ga0307410_10188008
740 Ga0307410_10469622
741 Ga0315914_1000001
742 Ga0315913_1000024
743 Ga0315915_1000002
744 Ga0373923_0263581
745 Ga0373927_0000135
746 Ga0373925_0001135
747 Ga0395900_0092735
748 Ga0395905_0001126
749 Ga0395905_0136682
750 Ga0395901_0320823
751 Ga0400488_01324
752 Ga0439438_044942
753 Ga0439447_043642
754 Ga0439465_0008566
755 Ga0439465_0085351
756 Ga0451787_328280
757 Ga0451849_0612694
758 Ga0451853_1929787
759 Ga0439433_0094624
760 Ga0439449_0031021
761 Ga0439462_0017774
762 Ga0450906_008285
763 Ga0450907_012720
764 Ga0439434_0110972
765 Ga0466963_0057534
766 Ga0466970_0023346
767 Ga0466957_0252803
768 Ga0466958_0031431
769 Ga0466967_0177688
770 Ga0495590_0008145
771 Ga0495605_0259809
772 Ga0495607_0278492
773 Ga0495583_0100666
774 Ga0495606_0011138
775 Ga0495610_0023092
776 Ga0495610_0135631
777 Ga0495616_0002338
778 Ga0495620_0017309
779 Ga0495632_0026520
780 Ga0495609_0012502
781 Ga0495609_0070523
782 Ga0495597_0077195
783 Ga0495633_0053812
784 Ga0495668_0025481
785 Ga0495625_0014610
786 Ga0495625_0059406
787 Ga0495625_0328812
788 Ga0495670_0138369
789 Ga0495649_0034639
790 Ga0495660_0015869
791 Ga0495636_0029106
792 Ga0495687_115828
793 Ga0495686_0045229
794 Ga0495686_0126052
795 Ga0495626_0064869
796 Ga0496104_0070681
797 Ga0496106_0002113
798 Ga0496106_0227374
799 Ga0496116_0016742
800 Ga0496116_0020118
801 Ga0496116_0134532
802 Ga0496117_0000031
803 Ga0496117_0004678
804 Ga0496117_0017870
805 Ga0496117_0120834
806 Ga0496117_0176067
807 Ga0496117_0259116
808 Ga0496118_0001884
809 Ga0496118_0004259
810 Ga0496118_0017624
811 Ga0496118_0208467
812 Ga0496119_0036562
813 Ga0496119_0058927
814 Ga0496119_0059077
815 Ga0496119_0060203
816 Ga0496119_0091575
817 Ga0496120_0001817
818 Ga0496120_0014950
819 Ga0496120_0056595
820 Ga0496120_0280621
821 Ga0496121_0000034
822 Ga0496121_0275544
823 Ga0496122_0000023
824 Ga0496122_0002284
825 Ga0496122_0125444
826 Ga0496122_0173935
827 Ga0496122_0271258
828 Ga0496123_0000027
829 Ga0496123_0000290
830 Ga0496123_0031088
831 Ga0496123_0044983
832 Ga0496123_0053721
833 Ga0496123_0079503
834 Ga0496124_0008017
835 Ga0496124_0009644
836 Ga0496124_0271971
837 Ga0496125_0000030
838 Ga0496125_0003346
839 Ga0496125_0014218
840 Ga0496125_0133085
841 Ga0496125_0216734
842 Ga0496125_0248521
843 Ga0496125_0288152
844 Ga0496126_0002222
845 Ga0496126_0004878
846 Ga0496126_0009461
847 Ga0496126_0034327
848 Ga0496126_0192147
849 Ga0496126_0251933
850 Ga0496126_0253787
851 Ga0495678_016669
852 Ga0495682_0007963
853 Ga0501031_0027698
854 Ga0501033_0000518
855 Ga0501033_0077311
856 Ga0501033_0314726
857 Ga0501034_0251782
858 Ga0501034_0486126
859 Ga0501036_0115040
860 Ga0501037_0056639
861 Ga0501039_0058415
862 Ga0501043_0161588
863 Ga0501043_0165230
864 Ga0501047_0078900
865 Ga0501047_0174214
866 Ga0501048_0047427
867 Ga0501083_0040593
868 Ga0501035_0000316
869 Ga0501035_0167364
870 nmdc:mga03683_10202_c1
871 nmdc:mga03n38_74528_c1
872 nmdc:mga03n38_84582_c1
873 nmdc:mga00v17_229530_c1
874 nmdc:mga00v17_360_c1
875 nmdc:mga0yw44_10819_c2
876 nmdc:mga0yw44_1402_c1
877 nmdc:mga0yw44_257407_c1
878 nmdc:mga0yw44_48194_c1
879 nmdc:mga0k408_68217_c1
880 nmdc:mga06z11_137765_c1
881 nmdc:mga06z11_60498_c1
882 nmdc:mga06z11_7031_c1
883 nmdc:mga07m45_139912_c1
884 nmdc:mga07m45_211356_c1
885 nmdc:mga07m45_2146_c1
886 nmdc:mga0sz30_1057_c1
887 Ga0500651_0350323
888 Ga0500560_000732
889 Ga0500569_021327
890 Ga0500569_094345
891 Ga0500572_003603
892 Ga0500594_0001734
893 Ga0500618_003034
894 Ga0500658_0000112
895 Ga0500658_0136052
896 Ga0500659_0101648
897 Ga0500559_0002392
898 Ga0500561_0000170
899 Ga0500568_0011712
900 Ga0500604_0016781
901 Ga0500604_0041820
902 Ga0500616_0048868
903 Ga0500616_0226166
904 Ga0500620_000075
905 Ga0500622_0001966
906 Ga0500633_0005614
907 Ga0500636_0000025
908 Ga0501084_0242070
909 Ga0501082_0055900
910 Ga0501082_0647102
911 2551727294
912 2509109488
913 2509378202
914 2510305357
915 2511503225
916 2512534496
917 2512973693
918 2513578601
919 2513586099
920 2513601789
921 2513615615
922 2513884190
923 2513903519
924 2513984064
925 2513998548
926 2514003627
927 2515610963
928 2515741527
929 2516894656
930 2517078250
931 2517571304
932 2524450552
933 2530647410
934 2551675887
935 2551689613
936 2551693318
937 2551703303
938 2551709408
939 2551723760
940 2551734706
941 2551741024
942 2558867312
943 2585387910
944 2585396005
945 2600193463
946 2601610783
947 2601747557
948 2643808154
949 2644068657
950 2644110062
951 2644150338
952 2644201464
953 2644312942
954 2644336490
955 2644379588
956 2644419726
957 2644453083
958 2644484432
959 2644546136
960 2644618672
961 2644677182
962 2644688888
963 2719182902
964 2719667245
965 2719733619
966 2720493665
967 2720615120
968 2720621913
969 2720633263
970 2720776962
971 2721149014
972 2721160412
973 2721165827
974 2722841997
975 2723028561
976 2723562163
977 2723568866
978 2724046375
979 2724091569
980 2724106131
981 2724111936
982 2725947472
983 2730109497
984 2730166137
985 2730300044
986 2753463723
987 2766064337
988 2792582136
989 2792641332
990 2793281108
991 2793346539
992 2793353926
993 2793365840
994 2802717329
995 2802724682
996 2802729434
997 2802736779
998 2802743185
999 2802749689
1000 2805926147
1001 2819560907
1002 2838018396
1003 2838050742
1004 2838062507
1005 2838072059
1006 2838078267
1007 2838672882
1008 2838683956
1009 2838690214
1010 2838698485
1011 2838705640
1012 2838711600
1013 2838731989
1014 2838744885
1015 2841855942
1016 2841867823
1017 2842081401
1018 2842116925
1019 2842121822
1020 2842149970
1021 2842161112
1022 2842166630
1023 2842184728
1024 2842194951
1025 2842232311
1026 2842240837
1027 2842246726
1028 2842255320
1029 2842261172
1030 2842269573
1031 2842274234
1032 2842288448
1033 2842295058
1034 2842305919
1035 2842311346
1036 2842321042
1037 2842366337
1038 2842374924
1039 2842381457
1040 2842388527
1041 2842406206
1042 2842412791
1043 2842419330
1044 2842425691
1045 2842433531
1046 2842439859
1047 2842446488
1048 2842448845
1049 2842467838
1050 2842474468
1051 2842491095
1052 2842498432
1053 2844164261
1054 2844457088
1055 2847673806
1056 2850082548
1057 2855827282
1058 2855842664
1059 2856320543
1060 2857519502
1061 2858803475
1062 2878038958
1063 2878760013
1064 2881867187
1065 2885324478
1066 2885344913
1067 2885357740
1068 2891373844
1069 2903494247
1070 2906421322
1071 2913300074
1072 2915982544
1073 2916031236
1074 2920760448
1075 2920825843
1076 2921205898
1077 2921257702
1078 2924161153
1079 2924169926
1080 2924173347
1081 2924193693
1082 2924209343
1083 2924790817
1084 2933010684
1085 2933572424
1086 2933593071
1087 2933597617
1088 2933603087
1089 2935897866
1090 2935903698
1091 2936997559
1092 2937013674
1093 2937019108
1094 2937024782
1095 2937036097
1096 2937051125
1097 2937106700
1098 2937132663
1099 2941501258
1100 2957400517
1101 2957416601
1102 2957463743
1103 2957470678
1104 2957483963
1105 2957485692
1106 2957502980
1107 2960587002
1108 2960624930
1109 2960664286
1110 2961177284
1111 2964609626
1112 2964657402
1113 2964674246
1114 2964683083
1115 2964707906
1116 2964712887
1117 2967673513
1118 2967711412
1119 2967722583
1120 2967739022
1121 2967749874
1122 2967768122
1123 2968002387
1124 2968009618
1125 2970062355
1126 2970086371
1127 2970122353
1128 2970133729
1129 2970138159
1130 2970143717
1131 2970175015
1132 2970178822
1133 2970186912
1134 2970509958
1135 2977559691
1136 2977585491
1137 2977828535
1138 2977829663
1139 2979104450
1140 2979814834
1141 2984513754
1142 2984522668
1143 2984541974
1144 2984601404
1145 2989354836
1146 648737104
1147 650741111
1148 8003995246
1149 8004381512
1150 8005286813
1151 8005313635
1152 8005431040
1153 8005497609
1154 8005565729
1155 8005623343
1156 8005631077
1157 8005669014
1158 8005694404
1159 8018155121
1160 8018177081
1161 8023686473
1162 8024502394
1163 8049296165
1164 8054560172
1165 8055435632
1166 8056380349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

72

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ori-assembly1.cif.gz_A structure of the predominant protein arginine methyltransferase prmt1 0.818 85 171
4qqn-assembly1.cif.gz_A-2 protein arginine methyltransferase 3 in complex with compound mtv044246 0.796 83 171
8g2f-assembly1.cif.gz_A-2 crystal structure of prmt3 with compound ii710 0.7958 83 171
4ryl-assembly1.cif.gz_A human protein arginine methyltransferase 3 in complex with 1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea 0.7952 83 171
1orh-assembly1.cif.gz_A structure of the predominant protein arginine methyltransferase prmt1 0.7947 85 181
ID Description Score Start End Superfamily
af_Q8IXQ9_82_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9625 72 202 3.40.50.150
af_O01503_44_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8959 66 206 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.894 96 154 3.40.50.150
af_Q4CTF2_4_246_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8505 93 139 3.40.50.150
af_A4I047_66_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8448 77 179 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A436IY35-F1-model_v4 deleted 0.987 71 235
AF-A0A2P2E907-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9855 27 235 GO:0005840
GO:0016279
GO:0032259
AF-A0A256FAM0-F1-model_v4 Methyltransferase family protein 0.9837 27 236 GO:0016279
GO:0032259
AF-A0A519PNX6-F1-model_v4 Methyltransferase 0.983 27 144 GO:0016279
GO:0032259
AF-A0A651G2J7-F1-model_v4 Methyltransferase 0.9768 24 237 GO:0016279
GO:0032259

Map