F466339

General Info

Members Datasets Scaffolds Average Seq Length
584 252 1168 168

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100203796|Ga0068867_1002037961
Length 197
Sequence MSAMRRRPHPNQDAQKKPEVPAAASAPKNNPISNIRKPIEGIRKFVTRRPAIEEVVHETTSGGIVFRRNQKSNELEILLIKDAKNRWTIPKGHVEEGEEPKDTAEREIREETGLQEMLVRDWLGKVNFRYRRNHTLVLMTMHIYLVQGQGNTDRLHPEDWLSDIQWLPATKAVDSIAYEDIGKLMLLGMKKIRDQKL

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
80 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
81 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
147 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
168 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
248 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.63
Nodule 0
Rhizoplane 0.68
Rhizosphere 74.14
Stem 0
Stem Tuber 0
Unclassified 10.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100203796 3300005459 Bacteria 1585
2 MRS1b_contig_4084217 2162886011 Bacteria 929
3 MBSR1b_contig_1799290 2162886012 Bacteria 856
4 JGI24740J21852_10004913 3300001979 Bacteria 5690
5 JGI24740J21852_10005605 3300001979 Bacteria 5288
6 JGI24740J21852_10015481 3300001979 Bacteria 2783
7 JGI24740J21852_10019351 3300001979 Bacteria 2399
8 JGI24740J21852_10047586 3300001979 Bacteria 1251
9 JGI24739J22299_10005141 3300001989 Bacteria 4982
10 JGI24739J22299_10065986 3300001989 Bacteria 1134
11 JGI24737J22298_10002203 3300001990 Bacteria 6943
12 JGI24743J22301_10000630 3300001991 Bacteria 4295
13 JGI24735J21928_10000075 3300002067 Bacteria 41276
14 JGI24735J21928_10000149 3300002067 Bacteria 24660
15 JGI24738J21930_10001791 3300002075 Bacteria 5840
16 rootH2_10000244 3300003320 Bacteria 697651
17 rootH2_10006847 3300003320 Bacteria 155484
18 rootH2_10206709 3300003320 Unclassified 1173
19 rootH2_10224747 3300003320 Bacteria 1913
20 rootL2_10247150 3300003322 Bacteria 2022
21 rootH1_10311088 3300003323 Bacteria 4960
22 JGI25405J52794_10004809 3300003911 Bacteria 2422
23 JGI25405J52794_10007214 3300003911 Unclassified 2046
24 Ga0065712_10265754 3300005290 Bacteria 927
25 Ga0065715_10099813 3300005293 Bacteria 3366
26 Ga0070658_10000015 3300005327 Bacteria 230579
27 Ga0070658_10000020 3300005327 Bacteria 188851
28 Ga0070658_10000024 3300005327 Bacteria 175873
29 Ga0070658_10006516 3300005327 Bacteria 9470
30 Ga0070658_10034417 3300005327 Bacteria 4075
31 Ga0070658_10059696 3300005327 Bacteria 3106
32 Ga0070658_10143421 3300005327 Bacteria 1996
33 Ga0070676_10006637 3300005328 Bacteria 6195
34 Ga0070676_10239783 3300005328 Bacteria 1205
35 Ga0070676_10295997 3300005328 Bacteria 1095
36 Ga0070683_100000505 3300005329 Bacteria 27371
37 Ga0070683_100010750 3300005329 Bacteria 7874
38 Ga0070683_100428918 3300005329 Bacteria 1261
39 Ga0070683_100810260 3300005329 Bacteria 898
40 Ga0070683_100853205 3300005329 Bacteria 873
41 Ga0070683_101218198 3300005329 Bacteria 723
42 Ga0070670_100738903 3300005331 Bacteria 886
43 Ga0070666_10004519 3300005335 Bacteria 8480
44 Ga0070666_10128410 3300005335 Bacteria 1760
45 Ga0070680_100038020 3300005336 Bacteria 3891
46 Ga0070680_100053143 3300005336 Unclassified 3306
47 Ga0070680_100092015 3300005336 Unclassified 2511
48 Ga0070680_100129715 3300005336 Bacteria 2109
49 Ga0070660_100000316 3300005339 Bacteria 31842
50 Ga0070660_100000346 3300005339 Bacteria 30918
51 Ga0070660_100027199 3300005339 Bacteria 4266
52 Ga0070660_100045343 3300005339 Bacteria 3365
53 Ga0070660_100158272 3300005339 Bacteria 1824
54 Ga0070661_100056640 3300005344 Bacteria 2872
55 Ga0070692_10048571 3300005345 Bacteria 2199
56 Ga0070668_100135648 3300005347 Bacteria 1979
57 Ga0070675_101120741 3300005354 Unclassified 724
58 Ga0070671_100000001 3300005355 Bacteria 1228151
59 Ga0070671_100022194 3300005355 Bacteria 5185
60 Ga0070671_100228642 3300005355 Bacteria 1578
61 Ga0070674_100002912 3300005356 Bacteria 9483
62 Ga0070674_100005409 3300005356 Bacteria 7373
63 Ga0070674_101533982 3300005356 Unclassified 599
64 Ga0070673_100000033 3300005364 Bacteria 60744
65 Ga0070688_100622557 3300005365 Bacteria 828
66 Ga0070659_100099914 3300005366 Bacteria 2334
67 Ga0070659_100115307 3300005366 Bacteria 2171
68 Ga0070659_100359880 3300005366 Bacteria 1222
69 Ga0070659_101706293 3300005366 Unclassified 563
70 Ga0070667_100000001 3300005367 Bacteria 1108638
71 Ga0070667_100281074 3300005367 Bacteria 1494
72 Ga0070678_100000201 3300005456 Bacteria 26383
73 Ga0070662_100009029 3300005457 Bacteria 6502
74 Ga0070681_10000608 3300005458 Bacteria 29517
75 Ga0070681_10111539 3300005458 Bacteria 2674
76 Ga0070681_10143721 3300005458 Bacteria 2315
77 Ga0070685_10000690 3300005466 Bacteria 18276
78 Ga0070685_10003963 3300005466 Bacteria 7482
79 Ga0070699_100829465 3300005518 Unclassified 846
80 Ga0070679_100045653 3300005530 Bacteria 4365
81 Ga0070679_100113775 3300005530 Unclassified 2691
82 Ga0070679_100438440 3300005530 Bacteria 1251
83 Ga0070684_100000049 3300005535 Bacteria 79768
84 Ga0070684_100013686 3300005535 Bacteria 6546
85 Ga0070684_100094775 3300005535 Bacteria 2659
86 Ga0070686_100228546 3300005544 Bacteria 1348
87 Ga0070665_100085636 3300005548 Bacteria 3157
88 Ga0070665_100124630 3300005548 Bacteria 2578
89 Ga0070665_101378630 3300005548 Unclassified 714
90 Ga0068855_100000663 3300005563 Bacteria 41994
91 Ga0068855_100004286 3300005563 Bacteria 17425
92 Ga0068855_100042951 3300005563 Bacteria 5356
93 Ga0068855_100770916 3300005563 Bacteria 1024
94 Ga0068855_101775138 3300005563 Unclassified 627
95 Ga0070664_100003334 3300005564 Bacteria 12978
96 Ga0070664_100277615 3300005564 Bacteria 1510
97 Ga0070664_100728018 3300005564 Bacteria 925
98 Ga0068857_100000441 3300005577 Bacteria 29474
99 Ga0068857_100000829 3300005577 Bacteria 23132
100 Ga0068857_100039775 3300005577 Bacteria 4167
101 Ga0068857_100102988 3300005577 Bacteria 2563
102 Ga0068857_100128291 3300005577 Unclassified 2286
103 Ga0068857_100777493 3300005577 Bacteria 913
104 Ga0068854_100026707 3300005578 Bacteria 3971
105 Ga0068856_100000027 3300005614 Bacteria 133290
106 Ga0068856_100000200 3300005614 Bacteria 63772
107 Ga0068856_100000445 3300005614 Bacteria 45664
108 Ga0068856_100073196 3300005614 Bacteria 3393
109 Ga0068856_100082335 3300005614 Bacteria 3194
110 Ga0068856_100106228 3300005614 Bacteria 2802
111 Ga0068852_100000001 3300005616 Bacteria 716526
112 Ga0068852_100000155 3300005616 Bacteria 45515
113 Ga0068859_100345560 3300005617 Unclassified 1582
114 Ga0068861_100103735 3300005719 Unclassified 2267
115 Ga0068861_100918014 3300005719 Bacteria 830
116 Ga0068858_100918270 3300005842 Unclassified 856
117 Ga0068860_100004772 3300005843 Bacteria 13816
118 Ga0068860_100013616 3300005843 Bacteria 7972
119 Ga0068862_100134154 3300005844 Bacteria 2193
120 Ga0081455_10000001 3300005937 Bacteria 603871
121 Ga0081455_10000008 3300005937 Bacteria 256558
122 Ga0070717_10058886 3300006028 Bacteria 3177
123 Ga0075365_10000001 3300006038 Bacteria 371589
124 Ga0075365_10000009 3300006038 Bacteria 111957
125 Ga0075365_10000014 3300006038 Bacteria 79945
126 Ga0075365_10004786 3300006038 Bacteria 7224
127 Ga0075365_10007875 3300006038 Bacteria 6002
128 Ga0075365_10092905 3300006038 Bacteria 2057
129 Ga0075365_10390927 3300006038 Bacteria 981
130 Ga0075365_10391815 3300006038 Bacteria 980
131 Ga0075368_10002082 3300006042 Bacteria 6462
132 Ga0075363_100019278 3300006048 Bacteria 3409
133 Ga0075363_100112350 3300006048 Bacteria 1515
134 Ga0075364_10002700 3300006051 Bacteria 9968
135 Ga0075364_10003371 3300006051 Bacteria 9072
136 Ga0075364_10064884 3300006051 Unclassified 2397
137 Ga0075364_10137566 3300006051 Bacteria 1642
138 Ga0075364_10214920 3300006051 Bacteria 1304
139 Ga0075364_10271444 3300006051 Unclassified 1154
140 Ga0075362_10000063 3300006177 Bacteria 31783
141 Ga0075367_10000093 3300006178 Bacteria 24511
142 Ga0075367_10008164 3300006178 Bacteria 5409
143 Ga0075367_10078335 3300006178 Bacteria 1996
144 Ga0075367_10261139 3300006178 Bacteria 1087
145 Ga0075367_10287429 3300006178 Unclassified 1034
146 Ga0075369_10000001 3300006186 Bacteria 299616
147 Ga0075369_10000010 3300006186 Bacteria 77564
148 Ga0075369_10039210 3300006186 Bacteria 2023
149 Ga0075369_10042664 3300006186 Bacteria 1945
150 Ga0075366_10000001 3300006195 Bacteria 569172
151 Ga0075366_10001109 3300006195 Bacteria 13248
152 Ga0075366_10001938 3300006195 Bacteria 10463
153 Ga0075366_10010874 3300006195 Bacteria 5120
154 Ga0075366_10019344 3300006195 Bacteria 3939
155 Ga0075366_10056325 3300006195 Bacteria 2335
156 Ga0075366_10169845 3300006195 Bacteria 1323
157 Ga0097621_100000009 3300006237 Bacteria 114089
158 Ga0097621_100558325 3300006237 Bacteria 1043
159 Ga0075370_10031490 3300006353 Bacteria 2961
160 Ga0075370_10081614 3300006353 Bacteria 1859
161 Ga0075370_10103382 3300006353 Bacteria 1650
162 Ga0068871_100000232 3300006358 Bacteria 39467
163 Ga0068871_100234417 3300006358 Bacteria 1594
164 Ga0068871_100506948 3300006358 Unclassified 1088
165 Ga0068871_101099834 3300006358 Unclassified 743
166 Ga0075428_100001999 3300006844 Bacteria 21962
167 Ga0068865_100000307 3300006881 Bacteria 27001
168 Ga0097620_100345553 3300006931 Unclassified 1582
169 Ga0105240_10000003 3300009093 Bacteria 1183681
170 Ga0105240_10000004 3300009093 Bacteria 708156
171 Ga0105240_10000050 3300009093 Bacteria 236144
172 Ga0105240_10001357 3300009093 Bacteria 42000
173 Ga0105240_10002332 3300009093 Bacteria 30702
174 Ga0105240_10118938 3300009093 Bacteria 3184
175 Ga0105240_11323262 3300009093 Unclassified 759
176 Ga0105245_10000002 3300009098 Bacteria 634374
177 Ga0105245_10000200 3300009098 Bacteria 57196
178 Ga0105245_10061919 3300009098 Unclassified 3375
179 Ga0105245_10173800 3300009098 Bacteria 2053
180 Ga0105245_10373504 3300009098 Bacteria 1418
181 Ga0105247_10185438 3300009101 Unclassified 1391
182 Ga0105243_10000001 3300009148 Bacteria 1156578
183 Ga0105243_10032209 3300009148 Unclassified 4048
184 Ga0105241_10000003 3300009174 Bacteria 839043
185 Ga0105241_10000842 3300009174 Bacteria 23254
186 Ga0105241_10082024 3300009174 Bacteria 2527
187 Ga0105241_10263637 3300009174 Bacteria 1465
188 Ga0105241_10448771 3300009174 Bacteria 1140
189 Ga0105242_10000001 3300009176 Bacteria 574039
190 Ga0105242_10002087 3300009176 Bacteria 15739
191 Ga0105242_10013893 3300009176 Bacteria 6231
192 Ga0105248_10201081 3300009177 Bacteria 2245
193 Ga0105248_10434691 3300009177 Bacteria 1478
194 Ga0105248_10789385 3300009177 Bacteria 1072
195 Ga0105248_11612672 3300009177 Bacteria 735
196 Ga0105237_10000001 3300009545 Bacteria 1009213
197 Ga0105237_10000002 3300009545 Bacteria 702357
198 Ga0105237_10009293 3300009545 Bacteria 10533
199 Ga0105237_10044114 3300009545 Bacteria 4490
200 Ga0105237_10061315 3300009545 Bacteria 3761
201 Ga0105237_11130283 3300009545 Unclassified 790
202 Ga0105237_11683392 3300009545 Unclassified 641
203 Ga0105238_10020346 3300009551 Bacteria 6755
204 Ga0105238_10100206 3300009551 Bacteria 2880
205 Ga0105238_10140584 3300009551 Bacteria 2391
206 Ga0105249_10131763 3300009553 Bacteria 2388
207 Ga0105249_10351772 3300009553 Bacteria 1493
208 Ga0105032_100001 3300009979 Bacteria 472394
209 Ga0105032_100020 3300009979 Bacteria 43175
210 Ga0105029_100086 3300009984 Bacteria 4492
211 Ga0105028_100263 3300009993 Bacteria 5723
212 Ga0105239_10001223 3300010375 Bacteria 35012
213 Ga0105239_10031923 3300010375 Bacteria 5787
214 Ga0105239_10038093 3300010375 Bacteria 5268
215 Ga0105239_10039896 3300010375 Bacteria 5143
216 Ga0105239_10610835 3300010375 Bacteria 1244
217 Ga0105239_10853134 3300010375 Bacteria 1044
218 Ga0105246_10010028 3300011119 Bacteria 5845
219 Ga0105246_10014924 3300011119 Bacteria 4896
220 Ga0105246_10052123 3300011119 Bacteria 2811
221 Ga0157373_10000061 3300013100 Bacteria 95718
222 Ga0157373_10043985 3300013100 Bacteria 3188
223 Ga0157373_10094199 3300013100 Bacteria 2109
224 Ga0157373_10104613 3300013100 Unclassified 1991
225 Ga0157373_10936581 3300013100 Bacteria 644
226 Ga0157371_10007527 3300013102 Bacteria 8809
227 Ga0157371_10077928 3300013102 Bacteria 2347
228 Ga0157371_10109435 3300013102 Unclassified 1961
229 Ga0157370_10002357 3300013104 Bacteria 22781
230 Ga0157370_10012318 3300013104 Bacteria 8877
231 Ga0157370_10137441 3300013104 Bacteria 2277
232 Ga0157370_10379496 3300013104 Bacteria 1302
233 Ga0157370_10479916 3300013104 Bacteria 1142
234 Ga0157369_10000029 3300013105 Bacteria 206955
235 Ga0157369_10000151 3300013105 Bacteria 98331
236 Ga0157369_10000190 3300013105 Bacteria 85077
237 Ga0157369_10000567 3300013105 Bacteria 48628
238 Ga0157369_10119188 3300013105 Bacteria 2801
239 Ga0157369_10262848 3300013105 Bacteria 1800
240 Ga0157369_10451879 3300013105 Bacteria 1331
241 Ga0157374_10000073 3300013296 Bacteria 100517
242 Ga0157374_10000096 3300013296 Bacteria 82179
243 Ga0157374_10000389 3300013296 Bacteria 40308
244 Ga0157374_10001423 3300013296 Bacteria 20253
245 Ga0157374_10004073 3300013296 Bacteria 12275
246 Ga0157378_10037888 3300013297 Bacteria 4273
247 Ga0157378_10327382 3300013297 Bacteria 1490
248 Ga0157378_10402379 3300013297 Bacteria 1349
249 Ga0157372_10000002 3300013307 Bacteria 687862
250 Ga0157372_10000086 3300013307 Bacteria 96247
251 Ga0157372_10002447 3300013307 Bacteria 20124
252 Ga0157372_10025726 3300013307 Bacteria 6402
253 Ga0157372_10140272 3300013307 Unclassified 2784
254 Ga0157372_10257262 3300013307 Bacteria 2027
255 Ga0157375_10074210 3300013308 Bacteria 3422
256 Ga0157375_10640535 3300013308 Bacteria 1220
257 Ga0157375_11044856 3300013308 Bacteria 955
258 Ga0157375_11161074 3300013308 Unclassified 905
259 Ga0163163_10251669 3300014325 Bacteria 1817
260 Ga0157377_10000920 3300014745 Bacteria 12288
261 Ga0157377_10001177 3300014745 Bacteria 11110
262 Ga0157377_10622027 3300014745 Unclassified 773
263 Ga0157376_10000001 3300014969 Bacteria 842910
264 Ga0157376_10000027 3300014969 Bacteria 204157
265 Ga0157376_10945670 3300014969 Bacteria 882
266 Ga0207697_10044198 3300025315 Bacteria 1832
267 Ga0207710_10095235 3300025900 Unclassified 1398
268 Ga0207680_10096370 3300025903 Unclassified 1892
269 Ga0207680_10197512 3300025903 Unclassified 1369
270 Ga0207647_10001245 3300025904 Bacteria 19575
271 Ga0207699_10144502 3300025906 Bacteria 1567
272 Ga0207645_10038847 3300025907 Bacteria 3051
273 Ga0207645_10236498 3300025907 Bacteria 1206
274 Ga0207645_10286483 3300025907 Bacteria 1095
275 Ga0207705_10000011 3300025909 Bacteria 517768
276 Ga0207705_10000047 3300025909 Bacteria 175887
277 Ga0207705_10000115 3300025909 Bacteria 89955
278 Ga0207705_10074336 3300025909 Bacteria 2467
279 Ga0207705_10090408 3300025909 Bacteria 2241
280 Ga0207705_10112718 3300025909 Bacteria 2011
281 Ga0207705_10432439 3300025909 Bacteria 1020
282 Ga0207654_10000002 3300025911 Bacteria 1460142
283 Ga0207654_10002956 3300025911 Bacteria 8617
284 Ga0207654_10047071 3300025911 Bacteria 2462
285 Ga0207654_10157340 3300025911 Bacteria 1464
286 Ga0207707_10025748 3300025912 Bacteria 5145
287 Ga0207695_10000005 3300025913 Bacteria 1196715
288 Ga0207695_10000009 3300025913 Bacteria 1034276
289 Ga0207695_10000158 3300025913 Bacteria 201891
290 Ga0207695_10072681 3300025913 Bacteria 3507
291 Ga0207695_10076332 3300025913 Bacteria 3406
292 Ga0207695_10247811 3300025913 Bacteria 1681
293 Ga0207671_10000003 3300025914 Bacteria 1065461
294 Ga0207671_10000008 3300025914 Bacteria 798229
295 Ga0207671_10003661 3300025914 Bacteria 15170
296 Ga0207671_10033531 3300025914 Bacteria 3818
297 Ga0207660_10020375 3300025917 Bacteria 4448
298 Ga0207660_10055049 3300025917 Bacteria 2841
299 Ga0207660_10057958 3300025917 Unclassified 2776
300 Ga0207657_10000712 3300025919 Bacteria 35358
301 Ga0207657_10002562 3300025919 Bacteria 19664
302 Ga0207657_10011048 3300025919 Bacteria 8976
303 Ga0207657_10038978 3300025919 Bacteria 4225
304 Ga0207657_10430137 3300025919 Bacteria 1037
305 Ga0207652_10041373 3300025921 Unclassified 3917
306 Ga0207652_10161876 3300025921 Bacteria 2006
307 Ga0207694_10088559 3300025924 Bacteria 2440
308 Ga0207694_10112347 3300025924 Bacteria 2168
309 Ga0207659_10091373 3300025926 Bacteria 2274
310 Ga0207687_10000001 3300025927 Bacteria 1130810
311 Ga0207687_10000004 3300025927 Bacteria 841177
312 Ga0207687_10001932 3300025927 Bacteria 14250
313 Ga0207687_10075495 3300025927 Unclassified 2419
314 Ga0207687_10209830 3300025927 Bacteria 1527
315 Ga0207644_10000001 3300025931 Bacteria 1243214
316 Ga0207644_10022204 3300025931 Bacteria 4334
317 Ga0207690_10002652 3300025932 Bacteria 10785
318 Ga0207690_10125620 3300025932 Unclassified 1870
319 Ga0207706_10000073 3300025933 Bacteria 103803
320 Ga0207686_10000001 3300025934 Bacteria 1169580
321 Ga0207686_10061860 3300025934 Unclassified 2375
322 Ga0207709_10000002 3300025935 Bacteria 1171536
323 Ga0207709_10049943 3300025935 Unclassified 2555
324 Ga0207670_11398663 3300025936 Unclassified 594
325 Ga0207669_10006666 3300025937 Bacteria 5292
326 Ga0207669_10024885 3300025937 Bacteria 3225
327 Ga0207704_10001468 3300025938 Bacteria 10545
328 Ga0207711_10135448 3300025941 Bacteria 2212
329 Ga0207661_10000077 3300025944 Bacteria 67190
330 Ga0207661_10000129 3300025944 Bacteria 47940
331 Ga0207661_10002445 3300025944 Bacteria 12778
332 Ga0207679_10000124 3300025945 Bacteria 63038
333 Ga0207679_10316443 3300025945 Bacteria 1350
334 Ga0207679_10507067 3300025945 Unclassified 1077
335 Ga0207679_10844895 3300025945 Unclassified 836
336 Ga0207667_10000003 3300025949 Bacteria 822935
337 Ga0207667_10000756 3300025949 Bacteria 42002
338 Ga0207667_10004357 3300025949 Bacteria 17337
339 Ga0207667_10062876 3300025949 Bacteria 3880
340 Ga0207667_10195280 3300025949 Unclassified 2076
341 Ga0207667_10280915 3300025949 Bacteria 1701
342 Ga0207651_10000141 3300025960 Bacteria 31367
343 Ga0207712_10003874 3300025961 Bacteria 9451
344 Ga0207712_10309436 3300025961 Bacteria 1299
345 Ga0207668_10121136 3300025972 Bacteria 1981
346 Ga0207668_11427994 3300025972 Bacteria 624
347 Ga0207640_10019721 3300025981 Bacteria 3989
348 Ga0207658_10000003 3300025986 Bacteria 1151934
349 Ga0207703_10508632 3300026035 Bacteria 1131
350 Ga0207639_10011466 3300026041 Bacteria 6157
351 Ga0207702_10000015 3300026078 Bacteria 250830
352 Ga0207702_10000034 3300026078 Bacteria 164965
353 Ga0207702_10000057 3300026078 Bacteria 131118
354 Ga0207702_10000739 3300026078 Bacteria 34921
355 Ga0207702_10061822 3300026078 Bacteria 3196
356 Ga0207702_10681970 3300026078 Bacteria 1012
357 Ga0207674_10000439 3300026116 Bacteria 53818
358 Ga0207674_10000878 3300026116 Bacteria 39325
359 Ga0207674_10119816 3300026116 Bacteria 2600
360 Ga0207674_10143475 3300026116 Bacteria 2347
361 Ga0207674_10149562 3300026116 Bacteria 2292
362 Ga0207674_10259094 3300026116 Bacteria 1686
363 Ga0207674_11305110 3300026116 Unclassified 695
364 Ga0207683_10030359 3300026121 Bacteria 4684
365 Ga0207698_10000001 3300026142 Bacteria 625389
366 Ga0207698_10000048 3300026142 Bacteria 90201
367 Ga0207698_11249590 3300026142 Bacteria 757
368 Ga0209998_10043572 3300027717 Bacteria 1024
369 Ga0209813_10000335 3300027866 Bacteria 12250
370 Ga0207428_10083905 3300027907 Bacteria 2483
371 Ga0268266_10021620 3300028379 Bacteria 5480
372 Ga0268265_11072907 3300028380 Bacteria 798
373 Ga0268264_10007105 3300028381 Bacteria 9383
374 Ga0265337_1014219 3300028556 Unclassified 2644
375 Ga0265319_1056368 3300028563 Bacteria 1284
376 Ga0265334_10000106 3300028573 Bacteria 55987
377 Ga0265338_10000181 3300028800 Bacteria 117792
378 Ga0265338_10000625 3300028800 Bacteria 61650
379 Ga0265338_10052669 3300028800 Bacteria 3649
380 Ga0314311_1122390 3300030733 Bacteria 4613
381 Ga0316179_1064424 3300030734 Bacteria 12008
382 Ga0316180_1071123 3300030736 Bacteria 1944
383 Ga0316183_1041045 3300030742 Bacteria 1390
384 Ga0316183_1192095 3300030742 Bacteria 16108
385 Ga0316181_1019399 3300030744 Bacteria 3114
386 Ga0316182_1017501 3300030745 Bacteria 11122
387 Ga0316182_1175280 3300030745 Bacteria 2574
388 Ga0316182_1326517 3300030745 Bacteria 4444
389 Ga0316182_1396058 3300030745 Bacteria 6284
390 Ga0265340_10000445 3300031247 Bacteria 22294
391 Ga0265327_10000017 3300031251 Bacteria 445264
392 Ga0265327_10035518 3300031251 Bacteria 2753
393 Ga0265342_10121422 3300031712 Bacteria 1471
394 Ga0307516_10008182 3300031730 Bacteria 11877
395 Ga0307405_10051169 3300031731 Unclassified 2562
396 Ga0307412_10122601 3300031911 Bacteria 1874
397 Ga0395899_0013685 3300037312 Bacteria 6202
398 Ga0395899_0039022 3300037312 Bacteria 3556
399 Ga0395899_0144552 3300037312 Bacteria 1690
400 Ga0395900_0000001 3300037418 Bacteria 931146
401 Ga0395900_0002513 3300037418 Bacteria 20134
402 Ga0395900_0010811 3300037418 Bacteria 9337
403 Ga0395900_0035071 3300037418 Bacteria 5167
404 Ga0395900_0138321 3300037418 Bacteria 2495
405 Ga0395900_0155063 3300037418 Bacteria 2339
406 Ga0395900_0475537 3300037418 Bacteria 1203
407 Ga0395898_0000002 3300037466 Bacteria 931013
408 Ga0395898_0025806 3300037466 Bacteria 5917
409 Ga0395898_0038857 3300037466 Unclassified 4714
410 Ga0395898_0165359 3300037466 Unclassified 2116
411 Ga0395905_0002429 3300037471 Bacteria 20672
412 Ga0395905_0019326 3300037471 Bacteria 6459
413 Ga0395905_0055986 3300037471 Unclassified 3691
414 Ga0395905_0309971 3300037471 Bacteria 1467
415 Ga0395901_0000006 3300038443 Bacteria 514112
416 Ga0395901_0006327 3300038443 Bacteria 11992
417 Ga0395901_0010187 3300038443 Bacteria 9524
418 Ga0395901_0032625 3300038443 Bacteria 5371
419 Ga0395901_0132250 3300038443 Bacteria 2622
420 Ga0439461_0002738 3300041410 Bacteria 2848
421 Ga0451853_0102201 3300041512 Bacteria 559
422 Ga0451853_0725875 3300041512 Bacteria 703
423 Ga0439445_0005738 3300042004 Bacteria 2836
424 Ga0439448_0214674 3300042005 Bacteria 676
425 Ga0439432_007573 3300042006 Bacteria 3842
426 Ga0450920_000808 3300042122 Bacteria 5051
427 Ga0450906_005983 3300042145 Bacteria 2476
428 Ga0439446_0000001 3300042156 Bacteria 275840
429 Ga0450909_001971 3300042185 Bacteria 2897
430 Ga0439464_0000130 3300042439 Bacteria 11960
431 Ga0439464_0036928 3300042439 Bacteria 1384
432 Ga0450918_000617 3300042531 Bacteria 7630
433 Ga0466970_0123694 3300044765 Bacteria 1418
434 Ga0495629_0298073 3300046459 Bacteria 1104
435 Ga0495638_0000132 3300046460 Bacteria 120039
436 Ga0495638_0000551 3300046460 Bacteria 42775
437 Ga0495582_0056117 3300046473 Bacteria 2171
438 Ga0495597_0030047 3300046542 Bacteria 2478
439 Ga0495622_0000502 3300046557 Bacteria 24435
440 Ga0495634_0096185 3300046642 Bacteria 1918
441 Ga0495588_0000171 3300046674 Bacteria 83176
442 Ga0495658_0000641 3300046683 Bacteria 18915
443 Ga0495671_0065105 3300046692 Bacteria 1794
444 Ga0495671_0269845 3300046692 Unclassified 820
445 Ga0495600_0008925 3300046809 Bacteria 6175
446 Ga0495660_0000005 3300046810 Bacteria 574567
447 Ga0495672_0000694 3300047320 Bacteria 37308
448 Ga0495676_0745076 3300047321 Bacteria 633
449 Ga0495681_0201217 3300047470 Bacteria 808
450 Ga0495686_0005549 3300047472 Bacteria 9924
451 Ga0495686_0159155 3300047472 Bacteria 1321
452 Ga0495593_0109795 3300047673 Bacteria 1409
453 Ga0495615_0092397 3300048090 Bacteria 845
454 Ga0496100_0017761 3300048903 Bacteria 4208
455 Ga0496104_0574219 3300048907 Bacteria 1038
456 Ga0496112_0072167 3300048915 Bacteria 3412
457 Ga0496113_0025550 3300048916 Bacteria 4212
458 Ga0501031_0002442 3300049568 Bacteria 11833
459 Ga0501032_0000624 3300049569 Bacteria 28751
460 Ga0501033_0421571 3300049570 Bacteria 929
461 Ga0501034_0000028 3300049571 Bacteria 255803
462 Ga0501034_0006453 3300049571 Bacteria 12628
463 Ga0501034_0009503 3300049571 Bacteria 10178
464 Ga0501034_0868664 3300049571 Bacteria 791
465 Ga0501036_0001666 3300049572 Bacteria 17221
466 Ga0501037_0000001 3300049573 Bacteria 753276
467 Ga0501037_0000031 3300049573 Bacteria 133137
468 Ga0501038_0070790 3300049574 Bacteria 2960
469 Ga0501043_0000366 3300049579 Bacteria 40919
470 Ga0501046_0000138 3300049580 Bacteria 77052
471 Ga0501047_0000032 3300049581 Bacteria 208294
472 Ga0501048_0000013 3300049582 Bacteria 76554
473 Ga0501068_0341900 3300049584 Bacteria 961
474 Ga0501070_0081893 3300049586 Bacteria 2671
475 Ga0501073_0037892 3300049589 Bacteria 3422
476 Ga0501073_0282905 3300049589 Bacteria 1144
477 Ga0501234_003057 3300049707 Bacteria 2628
478 Ga0501083_0011227 3300049744 Bacteria 6286
479 Ga0501083_0025578 3300049744 Bacteria 4086
480 Ga0501035_0000799 3300049822 Bacteria 33519
481 Ga0501044_0037308 3300049823 Bacteria 5081
482 nmdc:mga03683_32384_c1 3300050489 Bacteria 2103
483 nmdc:mga03683_42674_c2 3300050489 Unclassified 562
484 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
485 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
486 nmdc:mga00v17_162499_c1 3300050491 Bacteria 1438
487 nmdc:mga00v17_177221_c1 3300050491 Bacteria 1375
488 nmdc:mga00v17_2630_c1 3300050491 Bacteria 8611
489 nmdc:mga00v17_293530_c1 3300050491 Bacteria 1056
490 nmdc:mga00v17_3801_c1 3300050491 Bacteria 5606
491 nmdc:mga00v17_461019_c1 3300050491 Unclassified 825
492 nmdc:mga00v17_5335_c1 3300050491 Bacteria 6314
493 nmdc:mga00v17_56476_c1 3300050491 Unclassified 2400
494 nmdc:mga0yw44_112386_c1 3300050492 Bacteria 1747
495 nmdc:mga0yw44_128525_c1 3300050492 Bacteria 1638
496 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
497 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
498 nmdc:mga0yw44_21337_c1 3300050492 Bacteria 3611
499 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
500 nmdc:mga0yw44_3147_c1 3300050492 Bacteria 7247
501 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
502 nmdc:mga0yw44_523976_c1 3300050492 Bacteria 804
503 nmdc:mga0yw44_703768_c1 3300050492 Unclassified 686
504 nmdc:mga0yw44_84798_c1 3300050492 Unclassified 1992
505 nmdc:mga0k408_118_c1 3300050493 Bacteria 11075
506 nmdc:mga0k408_159617_c1 3300050493 Bacteria 1343
507 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
508 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
509 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
510 nmdc:mga0k408_3696_c1 3300050493 Bacteria 7332
511 nmdc:mga0k408_3708_c1 3300050493 Bacteria 8095
512 nmdc:mga0k408_4209_c3 3300050493 Bacteria 2379
513 nmdc:mga06z11_127_c1 3300050494 Bacteria 25603
514 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
515 nmdc:mga06z11_249319_c1 3300050494 Unclassified 1045
516 nmdc:mga06z11_58210_c1 3300050494 Bacteria 2004
517 nmdc:mga06z11_728833_c1 3300050494 Unclassified 604
518 nmdc:mga04h51_202516_c1 3300050495 Bacteria 780
519 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
520 nmdc:mga07m45_10022_c1 3300050496 Bacteria 4932
521 nmdc:mga07m45_148205_c1 3300050496 Bacteria 1360
522 nmdc:mga07m45_248674_c1 3300050496 Bacteria 1035
523 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
524 nmdc:mga0sz30_13016_c1 3300050516 Bacteria 3248
525 nmdc:mga0sz30_1978_c2 3300050516 Bacteria 2048
526 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
527 nmdc:mga0sz30_256333_c1 3300050516 Unclassified 779
528 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
529 Ga0500610_0051662 3300053079 Unclassified 2141
530 Ga0500643_000022 3300053087 Bacteria 277519
531 Ga0500643_000148 3300053087 Bacteria 71560
532 Ga0500643_003568 3300053087 Bacteria 7402
533 Ga0500644_0001037 3300053088 Bacteria 8346
534 Ga0500644_0007239 3300053088 Bacteria 2883
535 Ga0500644_0012144 3300053088 Bacteria 2374
536 Ga0500644_0472856 3300053088 Unclassified 550
537 Ga0500646_0000007 3300053090 Bacteria 115744
538 Ga0500646_0000805 3300053090 Bacteria 8705
539 Ga0500646_0046835 3300053090 Bacteria 1235
540 Ga0500583_0000082 3300053092 Bacteria 54810
541 Ga0500583_0011114 3300053092 Bacteria 3378
542 Ga0500583_0014634 3300053092 Bacteria 3079
543 Ga0500583_0015409 3300053092 Bacteria 3023
544 Ga0500583_0291472 3300053092 Bacteria 800
545 Ga0500651_0000191 3300053093 Bacteria 39269
546 Ga0500651_0009366 3300053093 Bacteria 5812
547 Ga0500651_0287179 3300053093 Unclassified 947
548 Ga0500566_0000001 3300053094 Bacteria 1101031
549 Ga0500641_0000001 3300053096 Bacteria 1115973
550 Ga0500650_0000001 3300053098 Bacteria 818797
551 Ga0500555_000001 3300053103 Bacteria 1353713
552 Ga0500555_000009 3300053103 Bacteria 263998
553 Ga0500562_009692 3300053108 Bacteria 2435
554 Ga0500569_000018 3300053109 Bacteria 42775
555 Ga0500594_0000001 3300053118 Bacteria 1178472
556 Ga0500614_000001 3300053123 Bacteria 1274484
557 Ga0500614_002185 3300053123 Unclassified 4442
558 Ga0500642_0016865 3300053130 Bacteria 2785
559 Ga0500652_000001 3300053131 Bacteria 946868
560 Ga0500652_136312 3300053131 Bacteria 1023
561 Ga0500655_001617 3300053133 Bacteria 4244
562 Ga0500559_0006860 3300053136 Bacteria 5104
563 Ga0500568_0031933 3300053139 Bacteria 2168
564 Ga0500577_0000528 3300053142 Bacteria 9883
565 Ga0500577_0014179 3300053142 Bacteria 2456
566 Ga0500577_0054346 3300053142 Bacteria 1517
567 Ga0500579_000781 3300053143 Bacteria 18261
568 Ga0500588_0000752 3300053146 Bacteria 5553
569 Ga0500589_000013 3300053147 Bacteria 109118
570 Ga0500589_025605 3300053147 Bacteria 2734
571 Ga0500589_202833 3300053147 Bacteria 760
572 Ga0500604_0014397 3300053151 Bacteria 2154
573 Ga0500604_0049606 3300053151 Bacteria 1291
574 Ga0500616_0000005 3300053153 Bacteria 961725
575 Ga0500616_0000012 3300053153 Bacteria 681798
576 Ga0500616_0015635 3300053153 Bacteria 4334
577 Ga0500616_0025837 3300053153 Bacteria 3256
578 Ga0500649_000004 3300053722 Bacteria 139374
579 Ga0500570_008150 3300053724 Bacteria 5773
580 Ga0500570_070171 3300053724 Bacteria 1639
581 Ga0500611_004452 3300053727 Bacteria 1891
582 Ga0500656_002995 3300053732 Bacteria 1558
583 Ga0590077_054771 3300059426 Bacteria 899
584 Ga0501082_0152578 3300060353 Bacteria 2007
585 Ga0068867_100203796
586 MRS1b_contig_4084217
587 MBSR1b_contig_1799290
588 JGI24740J21852_10004913
589 JGI24740J21852_10005605
590 JGI24740J21852_10015481
591 JGI24740J21852_10019351
592 JGI24740J21852_10047586
593 JGI24739J22299_10005141
594 JGI24739J22299_10065986
595 JGI24737J22298_10002203
596 JGI24743J22301_10000630
597 JGI24735J21928_10000075
598 JGI24735J21928_10000149
599 JGI24738J21930_10001791
600 rootH2_10000244
601 rootH2_10006847
602 rootH2_10206709
603 rootH2_10224747
604 rootL2_10247150
605 rootH1_10311088
606 JGI25405J52794_10004809
607 JGI25405J52794_10007214
608 Ga0065712_10265754
609 Ga0065715_10099813
610 Ga0070658_10000015
611 Ga0070658_10000020
612 Ga0070658_10000024
613 Ga0070658_10006516
614 Ga0070658_10034417
615 Ga0070658_10059696
616 Ga0070658_10143421
617 Ga0070676_10006637
618 Ga0070676_10239783
619 Ga0070676_10295997
620 Ga0070683_100000505
621 Ga0070683_100010750
622 Ga0070683_100428918
623 Ga0070683_100810260
624 Ga0070683_100853205
625 Ga0070683_101218198
626 Ga0070670_100738903
627 Ga0070666_10004519
628 Ga0070666_10128410
629 Ga0070680_100038020
630 Ga0070680_100053143
631 Ga0070680_100092015
632 Ga0070680_100129715
633 Ga0070660_100000316
634 Ga0070660_100000346
635 Ga0070660_100027199
636 Ga0070660_100045343
637 Ga0070660_100158272
638 Ga0070661_100056640
639 Ga0070692_10048571
640 Ga0070668_100135648
641 Ga0070675_101120741
642 Ga0070671_100000001
643 Ga0070671_100022194
644 Ga0070671_100228642
645 Ga0070674_100002912
646 Ga0070674_100005409
647 Ga0070674_101533982
648 Ga0070673_100000033
649 Ga0070688_100622557
650 Ga0070659_100099914
651 Ga0070659_100115307
652 Ga0070659_100359880
653 Ga0070659_101706293
654 Ga0070667_100000001
655 Ga0070667_100281074
656 Ga0070678_100000201
657 Ga0070662_100009029
658 Ga0070681_10000608
659 Ga0070681_10111539
660 Ga0070681_10143721
661 Ga0070685_10000690
662 Ga0070685_10003963
663 Ga0070699_100829465
664 Ga0070679_100045653
665 Ga0070679_100113775
666 Ga0070679_100438440
667 Ga0070684_100000049
668 Ga0070684_100013686
669 Ga0070684_100094775
670 Ga0070686_100228546
671 Ga0070665_100085636
672 Ga0070665_100124630
673 Ga0070665_101378630
674 Ga0068855_100000663
675 Ga0068855_100004286
676 Ga0068855_100042951
677 Ga0068855_100770916
678 Ga0068855_101775138
679 Ga0070664_100003334
680 Ga0070664_100277615
681 Ga0070664_100728018
682 Ga0068857_100000441
683 Ga0068857_100000829
684 Ga0068857_100039775
685 Ga0068857_100102988
686 Ga0068857_100128291
687 Ga0068857_100777493
688 Ga0068854_100026707
689 Ga0068856_100000027
690 Ga0068856_100000200
691 Ga0068856_100000445
692 Ga0068856_100073196
693 Ga0068856_100082335
694 Ga0068856_100106228
695 Ga0068852_100000001
696 Ga0068852_100000155
697 Ga0068859_100345560
698 Ga0068861_100103735
699 Ga0068861_100918014
700 Ga0068858_100918270
701 Ga0068860_100004772
702 Ga0068860_100013616
703 Ga0068862_100134154
704 Ga0081455_10000001
705 Ga0081455_10000008
706 Ga0070717_10058886
707 Ga0075365_10000001
708 Ga0075365_10000009
709 Ga0075365_10000014
710 Ga0075365_10004786
711 Ga0075365_10007875
712 Ga0075365_10092905
713 Ga0075365_10390927
714 Ga0075365_10391815
715 Ga0075368_10002082
716 Ga0075363_100019278
717 Ga0075363_100112350
718 Ga0075364_10002700
719 Ga0075364_10003371
720 Ga0075364_10064884
721 Ga0075364_10137566
722 Ga0075364_10214920
723 Ga0075364_10271444
724 Ga0075362_10000063
725 Ga0075367_10000093
726 Ga0075367_10008164
727 Ga0075367_10078335
728 Ga0075367_10261139
729 Ga0075367_10287429
730 Ga0075369_10000001
731 Ga0075369_10000010
732 Ga0075369_10039210
733 Ga0075369_10042664
734 Ga0075366_10000001
735 Ga0075366_10001109
736 Ga0075366_10001938
737 Ga0075366_10010874
738 Ga0075366_10019344
739 Ga0075366_10056325
740 Ga0075366_10169845
741 Ga0097621_100000009
742 Ga0097621_100558325
743 Ga0075370_10031490
744 Ga0075370_10081614
745 Ga0075370_10103382
746 Ga0068871_100000232
747 Ga0068871_100234417
748 Ga0068871_100506948
749 Ga0068871_101099834
750 Ga0075428_100001999
751 Ga0068865_100000307
752 Ga0097620_100345553
753 Ga0105240_10000003
754 Ga0105240_10000004
755 Ga0105240_10000050
756 Ga0105240_10001357
757 Ga0105240_10002332
758 Ga0105240_10118938
759 Ga0105240_11323262
760 Ga0105245_10000002
761 Ga0105245_10000200
762 Ga0105245_10061919
763 Ga0105245_10173800
764 Ga0105245_10373504
765 Ga0105247_10185438
766 Ga0105243_10000001
767 Ga0105243_10032209
768 Ga0105241_10000003
769 Ga0105241_10000842
770 Ga0105241_10082024
771 Ga0105241_10263637
772 Ga0105241_10448771
773 Ga0105242_10000001
774 Ga0105242_10002087
775 Ga0105242_10013893
776 Ga0105248_10201081
777 Ga0105248_10434691
778 Ga0105248_10789385
779 Ga0105248_11612672
780 Ga0105237_10000001
781 Ga0105237_10000002
782 Ga0105237_10009293
783 Ga0105237_10044114
784 Ga0105237_10061315
785 Ga0105237_11130283
786 Ga0105237_11683392
787 Ga0105238_10020346
788 Ga0105238_10100206
789 Ga0105238_10140584
790 Ga0105249_10131763
791 Ga0105249_10351772
792 Ga0105032_100001
793 Ga0105032_100020
794 Ga0105029_100086
795 Ga0105028_100263
796 Ga0105239_10001223
797 Ga0105239_10031923
798 Ga0105239_10038093
799 Ga0105239_10039896
800 Ga0105239_10610835
801 Ga0105239_10853134
802 Ga0105246_10010028
803 Ga0105246_10014924
804 Ga0105246_10052123
805 Ga0157373_10000061
806 Ga0157373_10043985
807 Ga0157373_10094199
808 Ga0157373_10104613
809 Ga0157373_10936581
810 Ga0157371_10007527
811 Ga0157371_10077928
812 Ga0157371_10109435
813 Ga0157370_10002357
814 Ga0157370_10012318
815 Ga0157370_10137441
816 Ga0157370_10379496
817 Ga0157370_10479916
818 Ga0157369_10000029
819 Ga0157369_10000151
820 Ga0157369_10000190
821 Ga0157369_10000567
822 Ga0157369_10119188
823 Ga0157369_10262848
824 Ga0157369_10451879
825 Ga0157374_10000073
826 Ga0157374_10000096
827 Ga0157374_10000389
828 Ga0157374_10001423
829 Ga0157374_10004073
830 Ga0157378_10037888
831 Ga0157378_10327382
832 Ga0157378_10402379
833 Ga0157372_10000002
834 Ga0157372_10000086
835 Ga0157372_10002447
836 Ga0157372_10025726
837 Ga0157372_10140272
838 Ga0157372_10257262
839 Ga0157375_10074210
840 Ga0157375_10640535
841 Ga0157375_11044856
842 Ga0157375_11161074
843 Ga0163163_10251669
844 Ga0157377_10000920
845 Ga0157377_10001177
846 Ga0157377_10622027
847 Ga0157376_10000001
848 Ga0157376_10000027
849 Ga0157376_10945670
850 Ga0207697_10044198
851 Ga0207710_10095235
852 Ga0207680_10096370
853 Ga0207680_10197512
854 Ga0207647_10001245
855 Ga0207699_10144502
856 Ga0207645_10038847
857 Ga0207645_10236498
858 Ga0207645_10286483
859 Ga0207705_10000011
860 Ga0207705_10000047
861 Ga0207705_10000115
862 Ga0207705_10074336
863 Ga0207705_10090408
864 Ga0207705_10112718
865 Ga0207705_10432439
866 Ga0207654_10000002
867 Ga0207654_10002956
868 Ga0207654_10047071
869 Ga0207654_10157340
870 Ga0207707_10025748
871 Ga0207695_10000005
872 Ga0207695_10000009
873 Ga0207695_10000158
874 Ga0207695_10072681
875 Ga0207695_10076332
876 Ga0207695_10247811
877 Ga0207671_10000003
878 Ga0207671_10000008
879 Ga0207671_10003661
880 Ga0207671_10033531
881 Ga0207660_10020375
882 Ga0207660_10055049
883 Ga0207660_10057958
884 Ga0207657_10000712
885 Ga0207657_10002562
886 Ga0207657_10011048
887 Ga0207657_10038978
888 Ga0207657_10430137
889 Ga0207652_10041373
890 Ga0207652_10161876
891 Ga0207694_10088559
892 Ga0207694_10112347
893 Ga0207659_10091373
894 Ga0207687_10000001
895 Ga0207687_10000004
896 Ga0207687_10001932
897 Ga0207687_10075495
898 Ga0207687_10209830
899 Ga0207644_10000001
900 Ga0207644_10022204
901 Ga0207690_10002652
902 Ga0207690_10125620
903 Ga0207706_10000073
904 Ga0207686_10000001
905 Ga0207686_10061860
906 Ga0207709_10000002
907 Ga0207709_10049943
908 Ga0207670_11398663
909 Ga0207669_10006666
910 Ga0207669_10024885
911 Ga0207704_10001468
912 Ga0207711_10135448
913 Ga0207661_10000077
914 Ga0207661_10000129
915 Ga0207661_10002445
916 Ga0207679_10000124
917 Ga0207679_10316443
918 Ga0207679_10507067
919 Ga0207679_10844895
920 Ga0207667_10000003
921 Ga0207667_10000756
922 Ga0207667_10004357
923 Ga0207667_10062876
924 Ga0207667_10195280
925 Ga0207667_10280915
926 Ga0207651_10000141
927 Ga0207712_10003874
928 Ga0207712_10309436
929 Ga0207668_10121136
930 Ga0207668_11427994
931 Ga0207640_10019721
932 Ga0207658_10000003
933 Ga0207703_10508632
934 Ga0207639_10011466
935 Ga0207702_10000015
936 Ga0207702_10000034
937 Ga0207702_10000057
938 Ga0207702_10000739
939 Ga0207702_10061822
940 Ga0207702_10681970
941 Ga0207674_10000439
942 Ga0207674_10000878
943 Ga0207674_10119816
944 Ga0207674_10143475
945 Ga0207674_10149562
946 Ga0207674_10259094
947 Ga0207674_11305110
948 Ga0207683_10030359
949 Ga0207698_10000001
950 Ga0207698_10000048
951 Ga0207698_11249590
952 Ga0209998_10043572
953 Ga0209813_10000335
954 Ga0207428_10083905
955 Ga0268266_10021620
956 Ga0268265_11072907
957 Ga0268264_10007105
958 Ga0265337_1014219
959 Ga0265319_1056368
960 Ga0265334_10000106
961 Ga0265338_10000181
962 Ga0265338_10000625
963 Ga0265338_10052669
964 Ga0314311_1122390
965 Ga0316179_1064424
966 Ga0316180_1071123
967 Ga0316183_1041045
968 Ga0316183_1192095
969 Ga0316181_1019399
970 Ga0316182_1017501
971 Ga0316182_1175280
972 Ga0316182_1326517
973 Ga0316182_1396058
974 Ga0265340_10000445
975 Ga0265327_10000017
976 Ga0265327_10035518
977 Ga0265342_10121422
978 Ga0307516_10008182
979 Ga0307405_10051169
980 Ga0307412_10122601
981 Ga0395899_0013685
982 Ga0395899_0039022
983 Ga0395899_0144552
984 Ga0395900_0000001
985 Ga0395900_0002513
986 Ga0395900_0010811
987 Ga0395900_0035071
988 Ga0395900_0138321
989 Ga0395900_0155063
990 Ga0395900_0475537
991 Ga0395898_0000002
992 Ga0395898_0025806
993 Ga0395898_0038857
994 Ga0395898_0165359
995 Ga0395905_0002429
996 Ga0395905_0019326
997 Ga0395905_0055986
998 Ga0395905_0309971
999 Ga0395901_0000006
1000 Ga0395901_0006327
1001 Ga0395901_0010187
1002 Ga0395901_0032625
1003 Ga0395901_0132250
1004 Ga0439461_0002738
1005 Ga0451853_0102201
1006 Ga0451853_0725875
1007 Ga0439445_0005738
1008 Ga0439448_0214674
1009 Ga0439432_007573
1010 Ga0450920_000808
1011 Ga0450906_005983
1012 Ga0439446_0000001
1013 Ga0450909_001971
1014 Ga0439464_0000130
1015 Ga0439464_0036928
1016 Ga0450918_000617
1017 Ga0466970_0123694
1018 Ga0495629_0298073
1019 Ga0495638_0000132
1020 Ga0495638_0000551
1021 Ga0495582_0056117
1022 Ga0495597_0030047
1023 Ga0495622_0000502
1024 Ga0495634_0096185
1025 Ga0495588_0000171
1026 Ga0495658_0000641
1027 Ga0495671_0065105
1028 Ga0495671_0269845
1029 Ga0495600_0008925
1030 Ga0495660_0000005
1031 Ga0495672_0000694
1032 Ga0495676_0745076
1033 Ga0495681_0201217
1034 Ga0495686_0005549
1035 Ga0495686_0159155
1036 Ga0495593_0109795
1037 Ga0495615_0092397
1038 Ga0496100_0017761
1039 Ga0496104_0574219
1040 Ga0496112_0072167
1041 Ga0496113_0025550
1042 Ga0501031_0002442
1043 Ga0501032_0000624
1044 Ga0501033_0421571
1045 Ga0501034_0000028
1046 Ga0501034_0006453
1047 Ga0501034_0009503
1048 Ga0501034_0868664
1049 Ga0501036_0001666
1050 Ga0501037_0000001
1051 Ga0501037_0000031
1052 Ga0501038_0070790
1053 Ga0501043_0000366
1054 Ga0501046_0000138
1055 Ga0501047_0000032
1056 Ga0501048_0000013
1057 Ga0501068_0341900
1058 Ga0501070_0081893
1059 Ga0501073_0037892
1060 Ga0501073_0282905
1061 Ga0501234_003057
1062 Ga0501083_0011227
1063 Ga0501083_0025578
1064 Ga0501035_0000799
1065 Ga0501044_0037308
1066 nmdc:mga03683_32384_c1
1067 nmdc:mga03683_42674_c2
1068 nmdc:mga03683_80_c1
1069 nmdc:mga00v17_120_c1
1070 nmdc:mga00v17_162499_c1
1071 nmdc:mga00v17_177221_c1
1072 nmdc:mga00v17_2630_c1
1073 nmdc:mga00v17_293530_c1
1074 nmdc:mga00v17_3801_c1
1075 nmdc:mga00v17_461019_c1
1076 nmdc:mga00v17_5335_c1
1077 nmdc:mga00v17_56476_c1
1078 nmdc:mga0yw44_112386_c1
1079 nmdc:mga0yw44_128525_c1
1080 nmdc:mga0yw44_16_c1
1081 nmdc:mga0yw44_1_c1
1082 nmdc:mga0yw44_21337_c1
1083 nmdc:mga0yw44_2_c1
1084 nmdc:mga0yw44_3147_c1
1085 nmdc:mga0yw44_4_c1
1086 nmdc:mga0yw44_523976_c1
1087 nmdc:mga0yw44_703768_c1
1088 nmdc:mga0yw44_84798_c1
1089 nmdc:mga0k408_118_c1
1090 nmdc:mga0k408_159617_c1
1091 nmdc:mga0k408_1_c1
1092 nmdc:mga0k408_214_c1
1093 nmdc:mga0k408_2889_c1
1094 nmdc:mga0k408_3696_c1
1095 nmdc:mga0k408_3708_c1
1096 nmdc:mga0k408_4209_c3
1097 nmdc:mga06z11_127_c1
1098 nmdc:mga06z11_198_c1
1099 nmdc:mga06z11_249319_c1
1100 nmdc:mga06z11_58210_c1
1101 nmdc:mga06z11_728833_c1
1102 nmdc:mga04h51_202516_c1
1103 nmdc:mga04h51_251_c1
1104 nmdc:mga07m45_10022_c1
1105 nmdc:mga07m45_148205_c1
1106 nmdc:mga07m45_248674_c1
1107 nmdc:mga08y16_5295_c1
1108 nmdc:mga0sz30_13016_c1
1109 nmdc:mga0sz30_1978_c2
1110 nmdc:mga0sz30_1_c1
1111 nmdc:mga0sz30_256333_c1
1112 nmdc:mga0sz30_3_c9
1113 Ga0500610_0051662
1114 Ga0500643_000022
1115 Ga0500643_000148
1116 Ga0500643_003568
1117 Ga0500644_0001037
1118 Ga0500644_0007239
1119 Ga0500644_0012144
1120 Ga0500644_0472856
1121 Ga0500646_0000007
1122 Ga0500646_0000805
1123 Ga0500646_0046835
1124 Ga0500583_0000082
1125 Ga0500583_0011114
1126 Ga0500583_0014634
1127 Ga0500583_0015409
1128 Ga0500583_0291472
1129 Ga0500651_0000191
1130 Ga0500651_0009366
1131 Ga0500651_0287179
1132 Ga0500566_0000001
1133 Ga0500641_0000001
1134 Ga0500650_0000001
1135 Ga0500555_000001
1136 Ga0500555_000009
1137 Ga0500562_009692
1138 Ga0500569_000018
1139 Ga0500594_0000001
1140 Ga0500614_000001
1141 Ga0500614_002185
1142 Ga0500642_0016865
1143 Ga0500652_000001
1144 Ga0500652_136312
1145 Ga0500655_001617
1146 Ga0500559_0006860
1147 Ga0500568_0031933
1148 Ga0500577_0000528
1149 Ga0500577_0014179
1150 Ga0500577_0054346
1151 Ga0500579_000781
1152 Ga0500588_0000752
1153 Ga0500589_000013
1154 Ga0500589_025605
1155 Ga0500589_202833
1156 Ga0500604_0014397
1157 Ga0500604_0049606
1158 Ga0500616_0000005
1159 Ga0500616_0000012
1160 Ga0500616_0015635
1161 Ga0500616_0025837
1162 Ga0500649_000004
1163 Ga0500570_008150
1164 Ga0500570_070171
1165 Ga0500611_004452
1166 Ga0500656_002995
1167 Ga0590077_054771
1168 Ga0501082_0152578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

57

186

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9486 12 149
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.9284 14 146
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.9271 14 147
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9214 12 149
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.9138 13 140
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9499 16 145 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9197 16 146 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9139 16 145 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8982 16 146 3.90.79.10
af_P9WIY3_15_154_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8912 13 141 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7W4HU80-F1-model_v4 NUDIX domain-containing protein 0.9954 23 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A660M028-F1-model_v4 NUDIX domain-containing protein 0.9895 2 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7W4HU80-F1-model_v4 NUDIX domain-containing protein 0.9878 23 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7C7HV55-F1-model_v4 NUDIX domain-containing protein 0.9822 2 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7W1KHD8-F1-model_v4 NUDIX domain-containing protein 0.9815 1 152 GO:0004081
GO:0006167
GO:0006754

Map