F466341

General Info

Members Datasets Scaffolds Average Seq Length
584 281 584 136

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100793074|Ga0070699_1007930741
Length 165
Sequence MEGKVTRAARKPSFIIRHSYFIDPKTIYNLQLVMITAYARWTDHERFLGQATSGHAVVLDAAKEKTAPSPMELVLIGLCGCTATDVVSILRKKREPFTSLEVRAEAERAAEPPTVYTSIKLTYRVGGQVSKKGMEDAVRLSKEKYCSVSAMLQKTAEITATIEYL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
271 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
272 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
273 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
274 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
275 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.45
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1520736 2162886012 Unclassified 2194
2 JGI24737J22298_10022550 3300001990 Unclassified 2001
3 JGI24743J22301_10003486 3300001991 Unclassified 2494
4 JGI24749J21850_1060864 3300002076 Unclassified 574
5 JGI24033J26618_1012010 3300002155 Unclassified 1039
6 JGI24034J26672_10000499 3300002239 Bacteria 5070
7 JGI24751J29686_10029447 3300002459 Unclassified 1140
8 Ga0058859_11757536 3300004798 Unclassified 1386
9 Ga0065715_10139428 3300005293 Bacteria 1877
10 Ga0065715_10185347 3300005293 Unclassified 1447
11 Ga0065707_10558169 3300005295 Unclassified 716
12 Ga0070658_10320289 3300005327 Unclassified 1324
13 Ga0070658_10575654 3300005327 Unclassified 975
14 Ga0070676_10025389 3300005328 Bacteria 3349
15 Ga0070683_100005697 3300005329 Bacteria 10406
16 Ga0070683_100334469 3300005329 Unclassified 1442
17 Ga0070690_100095705 3300005330 Unclassified 1961
18 Ga0070690_100368272 3300005330 Unclassified 1047
19 Ga0070690_100629758 3300005330 Unclassified 817
20 Ga0070670_100014577 3300005331 Bacteria 6750
21 Ga0070670_100208770 3300005331 Bacteria 1698
22 Ga0070677_10008576 3300005333 Bacteria 3446
23 Ga0070666_10971088 3300005335 Unclassified 629
24 Ga0070680_100162813 3300005336 Bacteria 1875
25 Ga0070682_100064445 3300005337 Unclassified 2326
26 Ga0070682_100183926 3300005337 Unclassified 1462
27 Ga0068868_100256623 3300005338 Unclassified 1473
28 Ga0068868_100846152 3300005338 Unclassified 828
29 Ga0070660_100006500 3300005339 Bacteria 8108
30 Ga0070660_100024092 3300005339 Unclassified 4515
31 Ga0070689_100091819 3300005340 Bacteria 2394
32 Ga0070687_100012916 3300005343 Unclassified 3705
33 Ga0070687_100928477 3300005343 Unclassified 626
34 Ga0070661_100067292 3300005344 Bacteria 2632
35 Ga0070692_11384734 3300005345 Unclassified 507
36 Ga0070668_100014961 3300005347 Bacteria 5798
37 Ga0070669_100013115 3300005353 Bacteria 5889
38 Ga0070669_100139972 3300005353 Bacteria 1865
39 Ga0070675_100055816 3300005354 Bacteria 3252
40 Ga0070675_100621997 3300005354 Unclassified 980
41 Ga0070671_100116805 3300005355 Bacteria 2243
42 Ga0070671_101085981 3300005355 Unclassified 702
43 Ga0070674_100476135 3300005356 Unclassified 1035
44 Ga0070659_100003497 3300005366 Bacteria 11186
45 Ga0070659_100120492 3300005366 Bacteria 2124
46 Ga0070667_100018641 3300005367 Bacteria 5756
47 Ga0070667_102205286 3300005367 Unclassified 519
48 Ga0070709_10002104 3300005434 Bacteria 10775
49 Ga0070709_10006371 3300005434 Bacteria 6429
50 Ga0070709_10101181 3300005434 Bacteria 1920
51 Ga0070714_100000069 3300005435 Bacteria 93567
52 Ga0070714_100009246 3300005435 Bacteria 7743
53 Ga0070714_100119958 3300005435 Bacteria 2338
54 Ga0070714_100198829 3300005435 Bacteria 1833
55 Ga0070714_100276818 3300005435 Bacteria 1558
56 Ga0070714_100396486 3300005435 Bacteria 1304
57 Ga0070714_100429680 3300005435 Bacteria 1252
58 Ga0070714_101503227 3300005435 Unclassified 658
59 Ga0070714_102087367 3300005435 Unclassified 552
60 Ga0070713_100000432 3300005436 Bacteria 26764
61 Ga0070713_100001604 3300005436 Bacteria 14476
62 Ga0070713_100025744 3300005436 Bacteria 4606
63 Ga0070713_100115756 3300005436 Unclassified 2343
64 Ga0070713_100180065 3300005436 Archaea 1899
65 Ga0070713_100259256 3300005436 Bacteria 1588
66 Ga0070713_100338289 3300005436 Bacteria 1394
67 Ga0070713_100569262 3300005436 Bacteria 1074
68 Ga0070710_10032334 3300005437 Bacteria 2834
69 Ga0070710_10095114 3300005437 Bacteria 1764
70 Ga0070710_10239318 3300005437 Unclassified 1162
71 Ga0070701_10035493 3300005438 Unclassified 2505
72 Ga0070711_100000340 3300005439 Bacteria 24038
73 Ga0070711_100039044 3300005439 Unclassified 3195
74 Ga0070711_100069569 3300005439 Bacteria 2476
75 Ga0070711_100412032 3300005439 Unclassified 1099
76 Ga0070711_101056692 3300005439 Bacteria 698
77 Ga0070711_101474866 3300005439 Unclassified 593
78 Ga0070700_100235392 3300005441 Unclassified 1306
79 Ga0070708_100012763 3300005445 Bacteria 6864
80 Ga0070708_100041792 3300005445 Bacteria 4021
81 Ga0070708_100073284 3300005445 Unclassified 3086
82 Ga0070708_101489142 3300005445 Bacteria 631
83 Ga0070663_100132557 3300005455 Bacteria 1894
84 Ga0070663_100154652 3300005455 Unclassified 1761
85 Ga0070678_100001279 3300005456 Bacteria 13335
86 Ga0070678_100325364 3300005456 Unclassified 1314
87 Ga0070662_100072154 3300005457 Unclassified 2548
88 Ga0070681_10015039 3300005458 Bacteria 7698
89 Ga0070681_10137981 3300005458 Bacteria 2368
90 Ga0070681_10316890 3300005458 Bacteria 1469
91 Ga0070681_11067802 3300005458 Bacteria 728
92 Ga0070681_11406604 3300005458 Bacteria 621
93 Ga0070685_10006488 3300005466 Bacteria 5966
94 Ga0070706_100010487 3300005467 Bacteria 8600
95 Ga0070706_100069388 3300005467 Unclassified 3260
96 Ga0070706_100071686 3300005467 Bacteria 3205
97 Ga0070706_100135894 3300005467 Bacteria 2295
98 Ga0070707_100006096 3300005468 Bacteria 11241
99 Ga0070707_100009485 3300005468 Bacteria 9039
100 Ga0070707_100092063 3300005468 Bacteria 2935
101 Ga0070707_100124956 3300005468 Bacteria 2499
102 Ga0070707_100193914 3300005468 Bacteria 1981
103 Ga0070707_100249291 3300005468 Unclassified 1728
104 Ga0070707_100379607 3300005468 Bacteria 1373
105 Ga0070707_100849896 3300005468 Bacteria 877
106 Ga0070698_100030770 3300005471 Bacteria 5565
107 Ga0070698_100064327 3300005471 Bacteria 3696
108 Ga0070698_100166792 3300005471 Bacteria 2145
109 Ga0070699_100001027 3300005518 Bacteria 25921
110 Ga0070699_100008978 3300005518 Bacteria 8658
111 Ga0070699_100644604 3300005518 Bacteria 967
112 Ga0070699_100793074 3300005518 Bacteria 867
113 Ga0070699_101352983 3300005518 Unclassified 653
114 Ga0070699_101354503 3300005518 Unclassified 653
115 Ga0070699_101821952 3300005518 Unclassified 557
116 Ga0070679_100306637 3300005530 Bacteria 1538
117 Ga0070679_100356680 3300005530 Unclassified 1410
118 Ga0070679_101054760 3300005530 Unclassified 757
119 Ga0070684_100008190 3300005535 Bacteria 8165
120 Ga0070684_100058238 3300005535 Unclassified 3376
121 Ga0070697_100005514 3300005536 Bacteria 9753
122 Ga0070697_100038998 3300005536 Bacteria 3839
123 Ga0070697_100415627 3300005536 Bacteria 1168
124 Ga0070697_100703548 3300005536 Bacteria 892
125 Ga0070697_100905908 3300005536 Unclassified 782
126 Ga0068853_100007763 3300005539 Bacteria 8605
127 Ga0068853_100030992 3300005539 Bacteria 4520
128 Ga0068853_101225314 3300005539 Unclassified 725
129 Ga0070672_100106557 3300005543 Unclassified 2280
130 Ga0070686_100278841 3300005544 Bacteria 1232
131 Ga0070686_100379598 3300005544 Unclassified 1069
132 Ga0070695_101241229 3300005545 Bacteria 614
133 Ga0070693_100059055 3300005547 Unclassified 2222
134 Ga0068855_100029998 3300005563 Bacteria 6504
135 Ga0068855_100444416 3300005563 Bacteria 1416
136 Ga0068855_100467719 3300005563 Bacteria 1374
137 Ga0068855_100830688 3300005563 Bacteria 980
138 Ga0070664_100453641 3300005564 Unclassified 1177
139 Ga0068857_100149834 3300005577 Bacteria 2113
140 Ga0068857_100833958 3300005577 Unclassified 881
141 Ga0068857_102299117 3300005577 Bacteria 529
142 Ga0068854_100147293 3300005578 Bacteria 1812
143 Ga0068854_100676058 3300005578 Unclassified 889
144 Ga0068854_101015950 3300005578 Bacteria 735
145 Ga0068856_100002427 3300005614 Bacteria 19176
146 Ga0068856_100040140 3300005614 Unclassified 4596
147 Ga0068856_100293226 3300005614 Unclassified 1643
148 Ga0068856_100343659 3300005614 Bacteria 1511
149 Ga0070702_100599296 3300005615 Unclassified 826
150 Ga0068852_100033406 3300005616 Unclassified 4270
151 Ga0068852_100198010 3300005616 Bacteria 1900
152 Ga0068859_100108769 3300005617 Bacteria 2833
153 Ga0068864_100117827 3300005618 Bacteria 2371
154 Ga0068864_101587147 3300005618 Unclassified 658
155 Ga0068866_10004876 3300005718 Bacteria 5510
156 Ga0068861_102532556 3300005719 Unclassified 517
157 Ga0068851_10038726 3300005834 Bacteria 2393
158 Ga0068851_10576531 3300005834 Unclassified 682
159 Ga0068870_10047043 3300005840 Bacteria 2265
160 Ga0068863_100019063 3300005841 Bacteria 6567
161 Ga0068863_100184095 3300005841 Unclassified 2006
162 Ga0068863_100236045 3300005841 Unclassified 1765
163 Ga0068858_100022316 3300005842 Bacteria 5910
164 Ga0068860_100103788 3300005843 Unclassified 2714
165 Ga0068862_100028772 3300005844 Unclassified 4680
166 Ga0068862_100856742 3300005844 Unclassified 891
167 Ga0070717_10000535 3300006028 Bacteria 24038
168 Ga0070717_10000774 3300006028 Bacteria 20927
169 Ga0070717_10005116 3300006028 Bacteria 9568
170 Ga0070717_10252821 3300006028 Bacteria 1557
171 Ga0070717_10317015 3300006028 Bacteria 1388
172 Ga0070717_10389735 3300006028 Bacteria 1250
173 Ga0070717_10427178 3300006028 Unclassified 1192
174 Ga0070717_10584174 3300006028 Unclassified 1013
175 Ga0070717_10933422 3300006028 Unclassified 790
176 Ga0070715_10019671 3300006163 Bacteria 2594
177 Ga0070715_10057614 3300006163 Unclassified 1693
178 Ga0070716_100000792 3300006173 Bacteria 13578
179 Ga0070716_100003222 3300006173 Bacteria 7658
180 Ga0070716_100100104 3300006173 Bacteria 1775
181 Ga0070716_100123893 3300006173 Bacteria 1622
182 Ga0070716_100155662 3300006173 Bacteria 1475
183 Ga0070716_100328294 3300006173 Bacteria 1075
184 Ga0070716_100367081 3300006173 Unclassified 1024
185 Ga0070716_100490504 3300006173 Unclassified 904
186 Ga0070716_100832908 3300006173 Bacteria 717
187 Ga0070716_101117709 3300006173 Unclassified 629
188 Ga0070712_100033521 3300006175 Bacteria 3476
189 Ga0070712_100084987 3300006175 Bacteria 2302
190 Ga0070712_100098909 3300006175 Bacteria 2152
191 Ga0070712_100125793 3300006175 Bacteria 1936
192 Ga0070712_100844784 3300006175 Bacteria 787
193 Ga0097621_100130082 3300006237 Unclassified 2142
194 Ga0068871_100326392 3300006358 Bacteria 1353
195 Ga0068871_100664804 3300006358 Unclassified 952
196 Ga0068871_100723521 3300006358 Bacteria 913
197 Ga0068865_100328457 3300006881 Unclassified 1232
198 Ga0075436_100003704 3300006914 Bacteria 10475
199 Ga0075436_100064446 3300006914 Bacteria 2533
200 Ga0075436_100132702 3300006914 Unclassified 1747
201 Ga0097620_100108769 3300006931 Bacteria 2833
202 Ga0075435_100506761 3300007076 Unclassified 1044
203 Ga0075435_100784378 3300007076 Bacteria 829
204 Ga0099794_10418028 3300007265 Bacteria 701
205 Ga0105250_10011456 3300009092 Unclassified 3677
206 Ga0105240_10023269 3300009093 Bacteria 8199
207 Ga0105240_10106765 3300009093 Bacteria 3395
208 Ga0105240_10502575 3300009093 Unclassified 1348
209 Ga0105240_10752005 3300009093 Bacteria 1060
210 Ga0111539_10439828 3300009094 Unclassified 1518
211 Ga0105245_10006526 3300009098 Bacteria 10246
212 Ga0105245_10131233 3300009098 Unclassified 2350
213 Ga0105247_10009888 3300009101 Bacteria 5779
214 Ga0105241_10005799 3300009174 Bacteria 9118
215 Ga0105241_10163316 3300009174 Bacteria 1833
216 Ga0105241_10351316 3300009174 Bacteria 1280
217 Ga0105241_11752262 3300009174 Unclassified 605
218 Ga0105242_10039444 3300009176 Bacteria 3801
219 Ga0105248_10158545 3300009177 Unclassified 2553
220 Ga0105248_10891987 3300009177 Unclassified 1004
221 Ga0105237_10101184 3300009545 Bacteria 2874
222 Ga0105238_10132724 3300009551 Bacteria 2469
223 Ga0105238_10515169 3300009551 Unclassified 1198
224 Ga0105238_10690566 3300009551 Bacteria 1032
225 Ga0105249_10045464 3300009553 Unclassified 3993
226 Ga0105249_10058017 3300009553 Unclassified 3548
227 Ga0105239_10007204 3300010375 Bacteria 12783
228 Ga0105239_10193424 3300010375 Bacteria 2277
229 Ga0105239_10400412 3300010375 Unclassified 1553
230 Ga0105239_10549897 3300010375 Bacteria 1315
231 Ga0105239_11902513 3300010375 Unclassified 690
232 Ga0105246_10008559 3300011119 Bacteria 6293
233 Ga0157373_10004453 3300013100 Bacteria 10538
234 Ga0157373_10021421 3300013100 Unclassified 4696
235 Ga0157371_10121856 3300013102 Unclassified 1854
236 Ga0157370_10221475 3300013104 Bacteria 1752
237 Ga0157370_10320992 3300013104 Bacteria 1428
238 Ga0157369_10038570 3300013105 Bacteria 5224
239 Ga0157369_10531212 3300013105 Bacteria 1216
240 Ga0157369_10686189 3300013105 Bacteria 1055
241 Ga0157374_10046865 3300013296 Unclassified 4005
242 Ga0157374_10052978 3300013296 Bacteria 3781
243 Ga0157374_10592784 3300013296 Unclassified 1118
244 Ga0157378_10870689 3300013297 Unclassified 930
245 Ga0163162_10028765 3300013306 Bacteria 5501
246 Ga0163162_10061087 3300013306 Unclassified 3806
247 Ga0157372_10012309 3300013307 Bacteria 9116
248 Ga0157372_10196987 3300013307 Bacteria 2333
249 Ga0157372_10942616 3300013307 Bacteria 1001
250 Ga0157372_11300318 3300013307 Bacteria 839
251 Ga0157375_10018772 3300013308 Bacteria 6275
252 Ga0157375_10731394 3300013308 Unclassified 1142
253 Ga0163163_10006167 3300014325 Bacteria 10450
254 Ga0163163_10008354 3300014325 Bacteria 9195
255 Ga0163163_10030385 3300014325 Bacteria 5206
256 Ga0163163_10089698 3300014325 Bacteria 3087
257 Ga0163163_10438906 3300014325 Unclassified 1365
258 Ga0163163_10670480 3300014325 Unclassified 1100
259 Ga0157380_10102355 3300014326 Bacteria 2388
260 Ga0182008_10015208 3300014497 Unclassified 4018
261 Ga0182008_10213825 3300014497 Unclassified 985
262 Ga0157377_10000586 3300014745 Bacteria 15141
263 Ga0157377_10306086 3300014745 Unclassified 1051
264 Ga0157379_10006714 3300014968 Bacteria 9940
265 Ga0157379_10973366 3300014968 Unclassified 808
266 Ga0157376_10013454 3300014969 Bacteria 6104
267 Ga0157376_10349109 3300014969 Unclassified 1415
268 Ga0157376_10365881 3300014969 Bacteria 1384
269 Ga0182006_1031108 3300015261 Bacteria 2153
270 Ga0182007_10005454 3300015262 Bacteria 5582
271 Ga0182005_1029281 3300015265 Unclassified 1502
272 Ga0182005_1044810 3300015265 Bacteria 1202
273 Ga0163161_10001547 3300017792 Bacteria 16984
274 Ga0224572_1075237 3300024225 Unclassified 623
275 Ga0207656_10124430 3300025321 Bacteria 1203
276 Ga0207656_10135191 3300025321 Unclassified 1158
277 Ga0207682_10016930 3300025893 Bacteria 2845
278 Ga0207692_10064522 3300025898 Bacteria 1907
279 Ga0207692_10065092 3300025898 Bacteria 1900
280 Ga0207692_10147019 3300025898 Unclassified 1346
281 Ga0207642_10049378 3300025899 Unclassified 1891
282 Ga0207710_10018798 3300025900 Unclassified 2942
283 Ga0207688_10012221 3300025901 Unclassified 4669
284 Ga0207680_10504031 3300025903 Unclassified 862
285 Ga0207647_10003396 3300025904 Bacteria 11930
286 Ga0207685_10021556 3300025905 Unclassified 2161
287 Ga0207685_10044952 3300025905 Bacteria 1672
288 Ga0207699_10034920 3300025906 Bacteria 2856
289 Ga0207699_10037774 3300025906 Unclassified 2763
290 Ga0207699_10038036 3300025906 Unclassified 2754
291 Ga0207699_10053062 3300025906 Unclassified 2403
292 Ga0207699_10120381 3300025906 Unclassified 1697
293 Ga0207699_10298717 3300025906 Bacteria 1124
294 Ga0207699_10304448 3300025906 Bacteria 1114
295 Ga0207645_10000551 3300025907 Bacteria 31119
296 Ga0207643_10005881 3300025908 Bacteria 6552
297 Ga0207705_10957682 3300025909 Unclassified 662
298 Ga0207684_10002771 3300025910 Bacteria 17451
299 Ga0207684_10049869 3300025910 Unclassified 3551
300 Ga0207684_10059551 3300025910 Bacteria 3243
301 Ga0207684_10099131 3300025910 Unclassified 2488
302 Ga0207654_10063715 3300025911 Bacteria 2165
303 Ga0207654_11331277 3300025911 Unclassified 524
304 Ga0207707_10265712 3300025912 Bacteria 1488
305 Ga0207707_11104211 3300025912 Bacteria 646
306 Ga0207695_10026809 3300025913 Bacteria 6426
307 Ga0207695_10067791 3300025913 Unclassified 3659
308 Ga0207693_10000010 3300025915 Bacteria 162031
309 Ga0207693_10002941 3300025915 Bacteria 14743
310 Ga0207693_10043654 3300025915 Bacteria 3525
311 Ga0207693_10055653 3300025915 Bacteria 3103
312 Ga0207693_10161959 3300025915 Bacteria 1760
313 Ga0207663_10000541 3300025916 Bacteria 16618
314 Ga0207663_10065744 3300025916 Bacteria 2319
315 Ga0207663_10249981 3300025916 Unclassified 1304
316 Ga0207662_10000359 3300025918 Bacteria 20504
317 Ga0207657_10006439 3300025919 Bacteria 12168
318 Ga0207657_10330060 3300025919 Bacteria 1205
319 Ga0207649_10000546 3300025920 Bacteria 26008
320 Ga0207649_10065665 3300025920 Bacteria 2298
321 Ga0207652_10562188 3300025921 Unclassified 1024
322 Ga0207646_10010353 3300025922 Bacteria 9120
323 Ga0207646_10078909 3300025922 Bacteria 2943
324 Ga0207646_10131111 3300025922 Bacteria 2256
325 Ga0207646_10131355 3300025922 Bacteria 2254
326 Ga0207646_10134841 3300025922 Bacteria 2223
327 Ga0207646_10173488 3300025922 Bacteria 1947
328 Ga0207681_10123919 3300025923 Bacteria 1900
329 Ga0207681_10466426 3300025923 Unclassified 1029
330 Ga0207694_10694841 3300025924 Unclassified 858
331 Ga0207694_11126135 3300025924 Bacteria 664
332 Ga0207650_10000045 3300025925 Bacteria 181507
333 Ga0207650_10894898 3300025925 Unclassified 754
334 Ga0207659_10866935 3300025926 Unclassified 776
335 Ga0207687_10472409 3300025927 Unclassified 1043
336 Ga0207687_10739471 3300025927 Bacteria 837
337 Ga0207700_10005755 3300025928 Bacteria 7443
338 Ga0207700_10047164 3300025928 Bacteria 3192
339 Ga0207700_10061696 3300025928 Bacteria 2844
340 Ga0207700_10157117 3300025928 Unclassified 1885
341 Ga0207700_10338021 3300025928 Bacteria 1308
342 Ga0207700_10694849 3300025928 Unclassified 908
343 Ga0207700_10772156 3300025928 Unclassified 859
344 Ga0207664_10000084 3300025929 Bacteria 93564
345 Ga0207664_10002513 3300025929 Bacteria 12133
346 Ga0207664_10053970 3300025929 Bacteria 3183
347 Ga0207664_10368861 3300025929 Bacteria 1273
348 Ga0207664_10487527 3300025929 Bacteria 1103
349 Ga0207644_10018085 3300025931 Unclassified 4765
350 Ga0207690_10150412 3300025932 Bacteria 1725
351 Ga0207690_10216747 3300025932 Unclassified 1462
352 Ga0207690_11073472 3300025932 Unclassified 671
353 Ga0207706_10001085 3300025933 Bacteria 27637
354 Ga0207706_10015387 3300025933 Bacteria 6911
355 Ga0207686_11622488 3300025934 Unclassified 534
356 Ga0207670_10290299 3300025936 Unclassified 1277
357 Ga0207669_10605012 3300025937 Unclassified 891
358 Ga0207704_10828483 3300025938 Unclassified 774
359 Ga0207665_10001046 3300025939 Bacteria 18599
360 Ga0207665_10081748 3300025939 Bacteria 2225
361 Ga0207665_10278571 3300025939 Unclassified 1244
362 Ga0207665_10301797 3300025939 Bacteria 1197
363 Ga0207665_11041111 3300025939 Unclassified 652
364 Ga0207691_10001782 3300025940 Bacteria 21176
365 Ga0207689_10001473 3300025942 Bacteria 22547
366 Ga0207661_10000131 3300025944 Bacteria 47673
367 Ga0207661_10193847 3300025944 Unclassified 1783
368 Ga0207679_10000283 3300025945 Bacteria 38405
369 Ga0207667_10356049 3300025949 Unclassified 1492
370 Ga0207667_10415444 3300025949 Bacteria 1369
371 Ga0207667_10683862 3300025949 Bacteria 1029
372 Ga0207651_10009810 3300025960 Bacteria 5267
373 Ga0207712_10030789 3300025961 Unclassified 3609
374 Ga0207668_11562406 3300025972 Unclassified 595
375 Ga0207640_10502092 3300025981 Unclassified 1010
376 Ga0207658_10158695 3300025986 Bacteria 1851
377 Ga0207658_10634869 3300025986 Bacteria 962
378 Ga0207677_10198917 3300026023 Unclassified 1591
379 Ga0207677_10649161 3300026023 Bacteria 931
380 Ga0207703_10045185 3300026035 Bacteria 3542
381 Ga0207639_10265446 3300026041 Bacteria 1503
382 Ga0207639_10595449 3300026041 Unclassified 1019
383 Ga0207678_10001378 3300026067 Bacteria 22391
384 Ga0207678_10232501 3300026067 Unclassified 1578
385 Ga0207702_10050684 3300026078 Bacteria 3505
386 Ga0207702_10108385 3300026078 Bacteria 2464
387 Ga0207702_10279068 3300026078 Unclassified 1579
388 Ga0207702_10586264 3300026078 Bacteria 1093
389 Ga0207641_10000021 3300026088 Bacteria 279851
390 Ga0207641_10196731 3300026088 Unclassified 1856
391 Ga0207641_10676539 3300026088 Bacteria 1015
392 Ga0207641_10906849 3300026088 Unclassified 875
393 Ga0207648_10000611 3300026089 Bacteria 40065
394 Ga0207676_10000096 3300026095 Bacteria 80353
395 Ga0207674_10000246 3300026116 Bacteria 67486
396 Ga0207674_10060331 3300026116 Unclassified 3836
397 Ga0207674_11310567 3300026116 Unclassified 694
398 Ga0207675_100070698 3300026118 Unclassified 3262
399 Ga0207683_10001457 3300026121 Bacteria 21339
400 Ga0207683_10267748 3300026121 Bacteria 1560
401 Ga0207698_10573319 3300026142 Unclassified 1109
402 Ga0207698_10978216 3300026142 Unclassified 856
403 Ga0268266_10005064 3300028379 Bacteria 12430
404 Ga0268265_10003076 3300028380 Bacteria 12174
405 Ga0268264_10047549 3300028381 Unclassified 3567
406 Ga0268264_10084962 3300028381 Unclassified 2715
407 Ga0268264_10325319 3300028381 Bacteria 1455
408 Ga0265338_10014641 3300028800 Bacteria 8701
409 Ga0265338_10170877 3300028800 Bacteria 1667
410 Ga0265338_10175413 3300028800 Bacteria 1639
411 Ga0265338_10227177 3300028800 Bacteria 1390
412 Ga0265338_10604582 3300028800 Bacteria 763
413 Ga0265760_10009710 3300031090 Bacteria 2749
414 Ga0265760_10064166 3300031090 Bacteria 1120
415 Ga0265330_10374219 3300031235 Unclassified 602
416 Ga0265332_10196762 3300031238 Bacteria 838
417 Ga0265328_10011628 3300031239 Bacteria 3512
418 Ga0265328_10040444 3300031239 Bacteria 1718
419 Ga0265325_10007751 3300031241 Bacteria 6397
420 Ga0265325_10009917 3300031241 Bacteria 5542
421 Ga0265325_10031869 3300031241 Unclassified 2817
422 Ga0265325_10052024 3300031241 Bacteria 2104
423 Ga0265325_10078570 3300031241 Bacteria 1643
424 Ga0265329_10092353 3300031242 Bacteria 961
425 Ga0265340_10002683 3300031247 Bacteria 10120
426 Ga0265340_10007178 3300031247 Bacteria 6070
427 Ga0265340_10039294 3300031247 Bacteria 2336
428 Ga0265339_10015912 3300031249 Unclassified 4496
429 Ga0265339_10197445 3300031249 Unclassified 994
430 Ga0265339_10358553 3300031249 Viruses 686
431 Ga0265339_10513629 3300031249 Unclassified 553
432 Ga0265331_10017081 3300031250 Bacteria 3793
433 Ga0265316_10001005 3300031344 Bacteria 30618
434 Ga0265316_10029140 3300031344 Unclassified 4544
435 Ga0265316_10041370 3300031344 Bacteria 3689
436 Ga0265316_10072399 3300031344 Bacteria 2655
437 Ga0265313_10013056 3300031595 Bacteria 5020
438 Ga0265313_10075770 3300031595 Bacteria 1539
439 Ga0265314_10081206 3300031711 Bacteria 2137
440 Ga0265314_10105524 3300031711 Unclassified 1801
441 Ga0265314_10364258 3300031711 Bacteria 791
442 Ga0265342_10043479 3300031712 Unclassified 2711
443 Ga0316214_1005815 3300033545 Unclassified 1621
444 Ga0373926_0019860 3300035083 Bacteria 2319
445 Ga0373926_0326391 3300035083 Unclassified 601
446 Ga0373934_0006504 3300035086 Bacteria 4336
447 Ga0373944_0060904 3300035089 Unclassified 1211
448 Ga0373923_0007452 3300035111 Bacteria 3848
449 Ga0373923_0108618 3300035111 Unclassified 1230
450 Ga0373936_0004722 3300035113 Bacteria 5147
451 Ga0373945_0004249 3300035116 Bacteria 4540
452 Ga0373945_0234865 3300035116 Unclassified 770
453 Ga0373953_0032634 3300035117 Bacteria 2032
454 Ga0373954_0026687 3300035118 Bacteria 2648
455 Ga0373956_0179157 3300035119 Unclassified 1001
456 Ga0373957_0008137 3300035120 Bacteria 3386
457 Ga0373943_0000009 3300035170 Bacteria 67175
458 Ga0373946_0003102 3300035171 Bacteria 5888
459 Ga0373946_0277915 3300035171 Unclassified 823
460 Ga0373955_0007748 3300035172 Bacteria 4947
461 Ga0373924_0062920 3300035410 Unclassified 1555
462 Ga0373935_0001716 3300035692 Bacteria 12271
463 Ga0373935_0290796 3300035692 Bacteria 1153
464 Ga0373927_0000539 3300035695 Bacteria 28719
465 Ga0373927_0183464 3300035695 Bacteria 1373
466 Ga0373933_0117306 3300035724 Bacteria 1664
467 Ga0373933_0401360 3300035724 Bacteria 894
468 Ga0373947_0002046 3300035725 Bacteria 12302
469 Ga0373937_0070951 3300036401 Bacteria 3213
470 Ga0373937_0277585 3300036401 Bacteria 1582
471 Ga0373937_0413943 3300036401 Unclassified 1279
472 Ga0373937_1149568 3300036401 Bacteria 725
473 Ga0373925_0001274 3300037068 Bacteria 22247
474 Ga0373925_0026898 3300037068 Unclassified 4212
475 Ga0373925_0146207 3300037068 Bacteria 1853
476 Ga0373925_1053402 3300037068 Unclassified 669
477 Ga0436360_0105454 3300039438 Unclassified 746
478 Ga0436360_1075001 3300039438 Bacteria 623
479 Ga0436361_0434841 3300039447 Unclassified 535
480 Ga0436362_1177367 3300039453 Bacteria 6689
481 Ga0453683_0425474 3300044673 Bacteria 857
482 Ga0466963_0076802 3300044694 Bacteria 2256
483 Ga0466964_0290260 3300044706 Unclassified 821
484 Ga0453684_1012298 3300044712 Unclassified 883
485 Ga0466959_0002571 3300045049 Bacteria 11651
486 Ga0466959_0907550 3300045049 Unclassified 588
487 Ga0451576_0733048 3300045051 Unclassified 1038
488 Ga0466967_0467208 3300045976 Unclassified 1235
489 Ga0495603_0025471 3300046455 Unclassified 3578
490 Ga0495629_0065411 3300046459 Bacteria 2538
491 Ga0495629_0077451 3300046459 Bacteria 2321
492 Ga0495629_0587236 3300046459 Unclassified 746
493 Ga0495580_0001237 3300046472 Bacteria 22525
494 Ga0495580_0003245 3300046472 Bacteria 13908
495 Ga0495580_0014786 3300046472 Bacteria 5914
496 Ga0495580_0021375 3300046472 Bacteria 4775
497 Ga0495580_0041517 3300046472 Bacteria 3281
498 Ga0495580_0050161 3300046472 Bacteria 2951
499 Ga0495580_0077047 3300046472 Bacteria 2326
500 Ga0495580_0458938 3300046472 Bacteria 854
501 Ga0495582_0026810 3300046473 Bacteria 3158
502 Ga0495582_0349379 3300046473 Unclassified 852
503 Ga0495582_0650051 3300046473 Bacteria 610
504 Ga0495639_0067979 3300046475 Bacteria 1642
505 Ga0495664_0014988 3300046477 Bacteria 4401
506 Ga0495664_0066801 3300046477 Bacteria 2145
507 Ga0495664_0115237 3300046477 Bacteria 1624
508 Ga0495608_0163243 3300046511 Unclassified 1416
509 Ga0495630_0227859 3300046517 Unclassified 1423
510 Ga0495630_0699364 3300046517 Unclassified 776
511 Ga0495652_0437554 3300046529 Unclassified 918
512 Ga0495652_0881575 3300046529 Unclassified 591
513 Ga0495665_0037026 3300046531 Unclassified 2604
514 Ga0495665_0088960 3300046531 Bacteria 1623
515 Ga0495586_0371796 3300046535 Unclassified 822
516 Ga0495586_0461053 3300046535 Unclassified 733
517 Ga0495667_0287029 3300046559 Unclassified 1044
518 Ga0495668_0515746 3300046616 Bacteria 659
519 Ga0495635_0172917 3300046663 Unclassified 1469
520 Ga0495635_0394975 3300046663 Unclassified 919
521 Ga0495657_0269339 3300046675 Unclassified 1022
522 Ga0495657_0309718 3300046675 Bacteria 940
523 Ga0495657_0394050 3300046675 Bacteria 816
524 Ga0495599_0068244 3300046678 Bacteria 2220
525 Ga0495599_0232282 3300046678 Unclassified 1126
526 Ga0495646_0141496 3300046680 Unclassified 1345
527 Ga0495647_0213318 3300046681 Unclassified 850
528 Ga0495658_0031119 3300046683 Bacteria 2904
529 Ga0495669_0028174 3300046684 Bacteria 2459
530 Ga0495669_0095019 3300046684 Unclassified 1380
531 Ga0495624_0617558 3300046690 Unclassified 646
532 Ga0495624_0641295 3300046690 Unclassified 632
533 Ga0495600_0863131 3300046809 Unclassified 536
534 Ga0495581_0104238 3300047315 Bacteria 1648
535 Ga0495674_0002665 3300047319 Bacteria 17375
536 Ga0495674_0051738 3300047319 Unclassified 3620
537 Ga0495674_0082459 3300047319 Bacteria 2757
538 Ga0495674_0979027 3300047319 Unclassified 649
539 Ga0495676_0303748 3300047321 Bacteria 1076
540 Ga0495680_0220513 3300047322 Unclassified 1354
541 Ga0495684_0317018 3300047471 Unclassified 1116
542 Ga0495593_0541224 3300047673 Unclassified 584
543 Ga0495602_0379598 3300048088 Unclassified 1013
544 Ga0496101_0287148 3300048904 Unclassified 1287
545 Ga0496102_0234468 3300048905 Unclassified 1730
546 Ga0496104_0058718 3300048907 Bacteria 3642
547 Ga0496104_0999178 3300048907 Unclassified 741
548 Ga0496105_0144510 3300048908 Bacteria 1957
549 Ga0496105_0490360 3300048908 Unclassified 966
550 Ga0496105_0499014 3300048908 Unclassified 956
551 Ga0496106_0152915 3300048909 Bacteria 1821
552 Ga0496106_0958538 3300048909 Unclassified 674
553 Ga0496108_0000605 3300048911 Bacteria 28095
554 Ga0496108_0259665 3300048911 Unclassified 1512
555 Ga0496108_0389845 3300048911 Unclassified 1216
556 Ga0496109_0000749 3300048912 Bacteria 27009
557 Ga0496109_0026423 3300048912 Bacteria 5177
558 Ga0496109_0282572 3300048912 Unclassified 1564
559 Ga0496110_0001050 3300048913 Bacteria 19502
560 Ga0496111_0009969 3300048914 Bacteria 6355
561 Ga0496111_0363528 3300048914 Unclassified 1071
562 Ga0496112_0001655 3300048915 Bacteria 17320
563 Ga0496112_0575983 3300048915 Unclassified 1058
564 Ga0496112_1506245 3300048915 Unclassified 586
565 Ga0496113_0000468 3300048916 Bacteria 19787
566 Ga0496113_0103173 3300048916 Unclassified 2212
567 Ga0496113_0255495 3300048916 Bacteria 1399
568 Ga0496114_0881984 3300048917 Unclassified 775
569 Ga0496115_0057439 3300048918 Unclassified 3130
570 Ga0501290_041103 3300049513 Bacteria 693
571 Ga0501297_026448 3300049520 Bacteria 752
572 Ga0501298_010063 3300049521 Unclassified 1620
573 Ga0501299_068509 3300049522 Bacteria 765
574 Ga0501235_109734 3300049669 Bacteria 681
575 Ga0501259_046300 3300049688 Bacteria 871
576 Ga0501225_0059416 3300049705 Bacteria 1074
577 nmdc:mga08y16_622594_c1 3300050511 Unclassified 1086
578 nmdc:mga0rr50_14918_c1 3300050513 Bacteria 5113
579 nmdc:mga0rr50_1502540_c1 3300050513 Unclassified 569
580 nmdc:mga0rr50_614018_c1 3300050513 Unclassified 927
581 nmdc:mga0rr50_759084_c1 3300050513 Bacteria 828
582 nmdc:mga08x19_215104_c1 3300050514 Bacteria 1320
583 Ga0495612_0093460 3300053078 Unclassified 1276
584 Ga0495619_0055687 3300053085 Bacteria 2620

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10472409 Ga0207687_104724091 113
2 3300028381 Ga0268264_10325319 Ga0268264_103253191 122
3 3300005435 Ga0070714_100119958 Ga0070714_1001199582 132
4 3300005435 Ga0070714_100198829 Ga0070714_1001988292 132
5 3300005435 Ga0070714_100429680 Ga0070714_1004296803 132
6 3300005435 Ga0070714_101503227 Ga0070714_1015032271 132
7 3300005436 Ga0070713_100001604 Ga0070713_10000160410 132
8 3300005436 Ga0070713_100569262 Ga0070713_1005692622 132
9 3300005437 Ga0070710_10032334 Ga0070710_100323342 132
10 3300005439 Ga0070711_100039044 Ga0070711_1000390443 132
11 3300005439 Ga0070711_101056692 Ga0070711_1010566921 132
12 3300005458 Ga0070681_11406604 Ga0070681_114066041 132
13 3300005518 Ga0070699_100793074 Ga0070699_1007930741 132
14 3300005530 Ga0070679_100306637 Ga0070679_1003066372 132
15 3300005545 Ga0070695_101241229 Ga0070695_1012412291 132
16 3300006028 Ga0070717_10252821 Ga0070717_102528212 132
17 3300006175 Ga0070712_100844784 Ga0070712_1008447842 132
18 3300006914 Ga0075436_100003704 Ga0075436_1000037048 132
19 3300006914 Ga0075436_100064446 Ga0075436_1000644462 132
20 3300006914 Ga0075436_100132702 Ga0075436_1001327021 132
21 3300009093 Ga0105240_10023269 Ga0105240_100232692 132
22 3300013104 Ga0157370_10221475 Ga0157370_102214753 132
23 3300013104 Ga0157370_10320992 Ga0157370_103209922 132
24 3300013307 Ga0157372_10942616 Ga0157372_109426162 132
25 3300025898 Ga0207692_10064522 Ga0207692_100645222 132
26 3300025906 Ga0207699_10038036 Ga0207699_100380364 132
27 3300025916 Ga0207663_10065744 Ga0207663_100657442 132
28 3300025928 Ga0207700_10005755 Ga0207700_100057555 132
29 3300025929 Ga0207664_10002513 Ga0207664_100025132 132
30 3300025929 Ga0207664_10368861 Ga0207664_103688612 132
31 3300049513 Ga0501290_041103 Ga0501290_041103_262_678 132
32 3300049520 Ga0501297_026448 Ga0501297_026448_121_537 132
33 3300049521 Ga0501298_010063 Ga0501298_010063_894_1310 132
34 3300049522 Ga0501299_068509 Ga0501299_068509_159_575 132
35 3300049669 Ga0501235_109734 Ga0501235_109734_145_561 132
36 3300049688 Ga0501259_046300 Ga0501259_046300_436_852 132
37 3300049705 Ga0501225_0059416 Ga0501225_0059416_600_1016 132
38 3300050513 nmdc:mga0rr50_14918_c1 nmdc:mga0rr50_14918_c1_3515_3919 132
39 3300050514 nmdc:mga08x19_215104_c1 nmdc:mga08x19_215104_c1_895_1299 132
40 3300005367 Ga0070667_102205286 Ga0070667_1022052861 133
41 3300005434 Ga0070709_10101181 Ga0070709_101011813 133
42 3300005435 Ga0070714_100009246 Ga0070714_1000092465 133
43 3300005435 Ga0070714_102087367 Ga0070714_1020873671 133
44 3300005436 Ga0070713_100000432 Ga0070713_10000043226 133
45 3300005436 Ga0070713_100180065 Ga0070713_1001800652 133
46 3300005436 Ga0070713_100338289 Ga0070713_1003382892 133
47 3300005437 Ga0070710_10239318 Ga0070710_102393181 133
48 3300005439 Ga0070711_100000340 Ga0070711_10000034023 133
49 3300005445 Ga0070708_101489142 Ga0070708_1014891422 133
50 3300005458 Ga0070681_11067802 Ga0070681_110678022 133
51 3300005467 Ga0070706_100071686 Ga0070706_1000716862 133
52 3300005468 Ga0070707_100193914 Ga0070707_1001939142 133
53 3300005468 Ga0070707_100249291 Ga0070707_1002492911 133
54 3300005468 Ga0070707_100379607 Ga0070707_1003796072 133
55 3300005468 Ga0070707_100849896 Ga0070707_1008498962 133
56 3300005471 Ga0070698_100064327 Ga0070698_1000643271 133
57 3300005518 Ga0070699_100644604 Ga0070699_1006446042 133
58 3300005518 Ga0070699_101354503 Ga0070699_1013545031 133
59 3300005518 Ga0070699_101821952 Ga0070699_1018219521 133
60 3300005536 Ga0070697_100415627 Ga0070697_1004156272 133
61 3300005536 Ga0070697_100703548 Ga0070697_1007035482 133
62 3300005536 Ga0070697_100905908 Ga0070697_1009059081 133
63 3300005563 Ga0068855_100444416 Ga0068855_1004444162 133
64 3300005577 Ga0068857_102299117 Ga0068857_1022991171 133
65 3300005614 Ga0068856_100343659 Ga0068856_1003436592 133
66 3300005618 Ga0068864_101587147 Ga0068864_1015871471 133
67 3300006028 Ga0070717_10000535 Ga0070717_1000053510 133
68 3300006028 Ga0070717_10000774 Ga0070717_1000077420 133
69 3300006028 Ga0070717_10005116 Ga0070717_100051169 133
70 3300006028 Ga0070717_10427178 Ga0070717_104271782 133
71 3300006028 Ga0070717_10584174 Ga0070717_105841742 133
72 3300006163 Ga0070715_10057614 Ga0070715_100576143 133
73 3300006173 Ga0070716_100000792 Ga0070716_1000007925 133
74 3300006173 Ga0070716_100123893 Ga0070716_1001238932 133
75 3300006173 Ga0070716_100490504 Ga0070716_1004905042 133
76 3300006173 Ga0070716_100832908 Ga0070716_1008329082 133
77 3300006173 Ga0070716_101117709 Ga0070716_1011177092 133
78 3300006175 Ga0070712_100033521 Ga0070712_1000335212 133
79 3300006175 Ga0070712_100084987 Ga0070712_1000849873 133
80 3300006358 Ga0068871_100723521 Ga0068871_1007235211 133
81 3300009093 Ga0105240_10752005 Ga0105240_107520052 133
82 3300009174 Ga0105241_10163316 Ga0105241_101633164 133
83 3300009551 Ga0105238_10690566 Ga0105238_106905661 133
84 3300013105 Ga0157369_10531212 Ga0157369_105312122 133
85 3300013307 Ga0157372_11300318 Ga0157372_113003181 133
86 3300014325 Ga0163163_10006167 Ga0163163_100061673 133
87 3300014325 Ga0163163_10089698 Ga0163163_100896981 133
88 3300014968 Ga0157379_10973366 Ga0157379_109733661 133
89 3300014969 Ga0157376_10349109 Ga0157376_103491092 133
90 3300014969 Ga0157376_10365881 Ga0157376_103658812 133
91 3300025905 Ga0207685_10021556 Ga0207685_100215563 133
92 3300025906 Ga0207699_10037774 Ga0207699_100377743 133
93 3300025906 Ga0207699_10053062 Ga0207699_100530623 133
94 3300025906 Ga0207699_10298717 Ga0207699_102987172 133
95 3300025910 Ga0207684_10059551 Ga0207684_100595513 133
96 3300025911 Ga0207654_10063715 Ga0207654_100637153 133
97 3300025915 Ga0207693_10000010 Ga0207693_10000010104 133
98 3300025915 Ga0207693_10055653 Ga0207693_100556533 133
99 3300025916 Ga0207663_10000541 Ga0207663_1000054117 133
100 3300025922 Ga0207646_10131111 Ga0207646_101311112 133
101 3300025922 Ga0207646_10134841 Ga0207646_101348412 133
102 3300025924 Ga0207694_11126135 Ga0207694_111261352 133
103 3300025928 Ga0207700_10157117 Ga0207700_101571173 133
104 3300025928 Ga0207700_10338021 Ga0207700_103380212 133
105 3300025928 Ga0207700_10694849 Ga0207700_106948492 133
106 3300025929 Ga0207664_10053970 Ga0207664_100539703 133
107 3300025939 Ga0207665_10001046 Ga0207665_100010468 133
108 3300025949 Ga0207667_10415444 Ga0207667_104154443 133
109 3300026078 Ga0207702_10586264 Ga0207702_105862642 133
110 3300028800 Ga0265338_10014641 Ga0265338_1001464110 133
111 3300028800 Ga0265338_10170877 Ga0265338_101708772 133
112 3300028800 Ga0265338_10175413 Ga0265338_101754132 133
113 3300031090 Ga0265760_10064166 Ga0265760_100641662 133
114 3300031235 Ga0265330_10374219 Ga0265330_103742192 133
115 3300031238 Ga0265332_10196762 Ga0265332_101967622 133
116 3300031239 Ga0265328_10011628 Ga0265328_100116285 133
117 3300031239 Ga0265328_10040444 Ga0265328_100404442 133
118 3300031241 Ga0265325_10007751 Ga0265325_100077513 133
119 3300031241 Ga0265325_10009917 Ga0265325_100099176 133
120 3300031241 Ga0265325_10052024 Ga0265325_100520242 133
121 3300031242 Ga0265329_10092353 Ga0265329_100923532 133
122 3300031247 Ga0265340_10002683 Ga0265340_1000268312 133
123 3300031247 Ga0265340_10039294 Ga0265340_100392941 133
124 3300031249 Ga0265339_10015912 Ga0265339_100159124 133
125 3300031249 Ga0265339_10197445 Ga0265339_101974452 133
126 3300031249 Ga0265339_10358553 Ga0265339_103585531 133
127 3300031249 Ga0265339_10513629 Ga0265339_105136291 133
128 3300031250 Ga0265331_10017081 Ga0265331_100170812 133
129 3300031344 Ga0265316_10001005 Ga0265316_1000100512 133
130 3300031344 Ga0265316_10029140 Ga0265316_100291403 133
131 3300031344 Ga0265316_10041370 Ga0265316_100413702 133
132 3300031344 Ga0265316_10072399 Ga0265316_100723993 133
133 3300031595 Ga0265313_10013056 Ga0265313_100130566 133
134 3300031711 Ga0265314_10081206 Ga0265314_100812062 133
135 3300031711 Ga0265314_10105524 Ga0265314_101055242 133
136 3300031711 Ga0265314_10364258 Ga0265314_103642581 133
137 3300033545 Ga0316214_1005815 Ga0316214_10058152 133
138 3300035083 Ga0373926_0326391 Ga0373926_0326391_165_566 133
139 3300035111 Ga0373923_0108618 Ga0373923_0108618_443_844 133
140 3300035116 Ga0373945_0234865 Ga0373945_0234865_119_520 133
141 3300035119 Ga0373956_0179157 Ga0373956_0179157_21_422 133
142 3300035171 Ga0373946_0277915 Ga0373946_0277915_31_432 133
143 3300035410 Ga0373924_0062920 Ga0373924_0062920_378_779 133
144 3300035692 Ga0373935_0290796 Ga0373935_0290796_380_781 133
145 3300035695 Ga0373927_0183464 Ga0373927_0183464_80_481 133
146 3300036401 Ga0373937_0070951 Ga0373937_0070951_905_1306 133
147 3300036401 Ga0373937_0277585 Ga0373937_0277585_919_1323 133
148 3300036401 Ga0373937_0413943 Ga0373937_0413943_467_868 133
149 3300037068 Ga0373925_0026898 Ga0373925_0026898_436_837 133
150 3300037068 Ga0373925_0146207 Ga0373925_0146207_1374_1775 133
151 3300037068 Ga0373925_1053402 Ga0373925_1053402_32_436 133
152 3300039438 Ga0436360_0105454 Ga0436360_0105454_233_646 133
153 3300039447 Ga0436361_0434841 Ga0436361_0434841_85_495 133
154 3300044694 Ga0466963_0076802 Ga0466963_0076802_1527_1931 133
155 3300045049 Ga0466959_0002571 Ga0466959_0002571_4680_5084 133
156 3300046455 Ga0495603_0025471 Ga0495603_0025471_1394_1798 133
157 3300046459 Ga0495629_0065411 Ga0495629_0065411_1745_2146 133
158 3300046459 Ga0495629_0077451 Ga0495629_0077451_239_643 133
159 3300046472 Ga0495580_0001237 Ga0495580_0001237_10711_11112 133
160 3300046472 Ga0495580_0014786 Ga0495580_0014786_2736_3140 133
161 3300046472 Ga0495580_0021375 Ga0495580_0021375_2462_2863 133
162 3300046472 Ga0495580_0050161 Ga0495580_0050161_264_668 133
163 3300046472 Ga0495580_0077047 Ga0495580_0077047_1054_1455 133
164 3300046472 Ga0495580_0458938 Ga0495580_0458938_21_422 133
165 3300046473 Ga0495582_0026810 Ga0495582_0026810_296_697 133
166 3300046473 Ga0495582_0349379 Ga0495582_0349379_343_747 133
167 3300046473 Ga0495582_0650051 Ga0495582_0650051_100_501 133
168 3300046475 Ga0495639_0067979 Ga0495639_0067979_776_1180 133
169 3300046477 Ga0495664_0066801 Ga0495664_0066801_1571_1975 133
170 3300046477 Ga0495664_0115237 Ga0495664_0115237_1040_1441 133
171 3300046517 Ga0495630_0699364 Ga0495630_0699364_22_423 133
172 3300046529 Ga0495652_0437554 Ga0495652_0437554_125_526 133
173 3300046529 Ga0495652_0881575 Ga0495652_0881575_16_417 133
174 3300046531 Ga0495665_0037026 Ga0495665_0037026_86_490 133
175 3300046535 Ga0495586_0371796 Ga0495586_0371796_238_639 133
176 3300046663 Ga0495635_0394975 Ga0495635_0394975_157_561 133
177 3300046675 Ga0495657_0309718 Ga0495657_0309718_410_814 133
178 3300046675 Ga0495657_0394050 Ga0495657_0394050_364_765 133
179 3300046678 Ga0495599_0232282 Ga0495599_0232282_133_534 133
180 3300046683 Ga0495658_0031119 Ga0495658_0031119_735_1136 133
181 3300046690 Ga0495624_0617558 Ga0495624_0617558_129_533 133
182 3300046690 Ga0495624_0641295 Ga0495624_0641295_125_526 133
183 3300046809 Ga0495600_0863131 Ga0495600_0863131_109_510 133
184 3300047315 Ga0495581_0104238 Ga0495581_0104238_179_583 133
185 3300047319 Ga0495674_0051738 Ga0495674_0051738_2213_2614 133
186 3300047319 Ga0495674_0082459 Ga0495674_0082459_2328_2729 133
187 3300047319 Ga0495674_0979027 Ga0495674_0979027_34_438 133
188 3300047321 Ga0495676_0303748 Ga0495676_0303748_385_786 133
189 3300048088 Ga0495602_0379598 Ga0495602_0379598_76_480 133
190 3300048908 Ga0496105_0144510 Ga0496105_0144510_677_1078 133
191 3300048917 Ga0496114_0881984 Ga0496114_0881984_43_444 133
192 3300048918 Ga0496115_0057439 Ga0496115_0057439_156_557 133
193 3300050513 nmdc:mga0rr50_1502540_c1 nmdc:mga0rr50_1502540_c1_100_501 133
194 3300053078 Ga0495612_0093460 Ga0495612_0093460_394_795 133
195 3300053085 Ga0495619_0055687 Ga0495619_0055687_440_844 133
196 2162886012 MBSR1b_contig_1520736 MBSR1b_0965.00005160 134
197 3300001990 JGI24737J22298_10022550 JGI24737J22298_100225503 134
198 3300001991 JGI24743J22301_10003486 JGI24743J22301_100034862 134
199 3300002076 JGI24749J21850_1060864 JGI24749J21850_10608641 134
200 3300002155 JGI24033J26618_1012010 JGI24033J26618_10120102 134
201 3300002239 JGI24034J26672_10000499 JGI24034J26672_100004995 134
202 3300002459 JGI24751J29686_10029447 JGI24751J29686_100294472 134
203 3300004798 Ga0058859_11757536 Ga0058859_117575361 134
204 3300005293 Ga0065715_10139428 Ga0065715_101394282 134
205 3300005293 Ga0065715_10185347 Ga0065715_101853473 134
206 3300005295 Ga0065707_10558169 Ga0065707_105581691 134
207 3300005327 Ga0070658_10320289 Ga0070658_103202891 134
208 3300005327 Ga0070658_10575654 Ga0070658_105756542 134
209 3300005328 Ga0070676_10025389 Ga0070676_100253892 134
210 3300005329 Ga0070683_100005697 Ga0070683_1000056972 134
211 3300005329 Ga0070683_100334469 Ga0070683_1003344693 134
212 3300005330 Ga0070690_100095705 Ga0070690_1000957053 134
213 3300005330 Ga0070690_100368272 Ga0070690_1003682721 134
214 3300005330 Ga0070690_100629758 Ga0070690_1006297581 134
215 3300005331 Ga0070670_100014577 Ga0070670_1000145772 134
216 3300005331 Ga0070670_100208770 Ga0070670_1002087703 134
217 3300005333 Ga0070677_10008576 Ga0070677_100085761 134
218 3300005335 Ga0070666_10971088 Ga0070666_109710881 134
219 3300005336 Ga0070680_100162813 Ga0070680_1001628132 134
220 3300005337 Ga0070682_100064445 Ga0070682_1000644453 134
221 3300005337 Ga0070682_100183926 Ga0070682_1001839263 134
222 3300005338 Ga0068868_100256623 Ga0068868_1002566232 134
223 3300005338 Ga0068868_100846152 Ga0068868_1008461522 134
224 3300005339 Ga0070660_100006500 Ga0070660_1000065003 134
225 3300005339 Ga0070660_100024092 Ga0070660_1000240923 134
226 3300005340 Ga0070689_100091819 Ga0070689_1000918192 134
227 3300005343 Ga0070687_100012916 Ga0070687_1000129161 134
228 3300005343 Ga0070687_100928477 Ga0070687_1009284771 134
229 3300005344 Ga0070661_100067292 Ga0070661_1000672923 134
230 3300005345 Ga0070692_11384734 Ga0070692_113847341 134
231 3300005347 Ga0070668_100014961 Ga0070668_1000149613 134
232 3300005353 Ga0070669_100013115 Ga0070669_1000131154 134
233 3300005353 Ga0070669_100139972 Ga0070669_1001399723 134
234 3300005354 Ga0070675_100055816 Ga0070675_1000558163 134
235 3300005354 Ga0070675_100621997 Ga0070675_1006219972 134
236 3300005355 Ga0070671_100116805 Ga0070671_1001168053 134
237 3300005355 Ga0070671_101085981 Ga0070671_1010859811 134
238 3300005356 Ga0070674_100476135 Ga0070674_1004761352 134
239 3300005366 Ga0070659_100003497 Ga0070659_1000034974 134
240 3300005366 Ga0070659_100120492 Ga0070659_1001204923 134
241 3300005367 Ga0070667_100018641 Ga0070667_1000186416 134
242 3300005434 Ga0070709_10002104 Ga0070709_100021042 134
243 3300005434 Ga0070709_10006371 Ga0070709_100063718 134
244 3300005435 Ga0070714_100000069 Ga0070714_10000006925 134
245 3300005435 Ga0070714_100276818 Ga0070714_1002768183 134
246 3300005435 Ga0070714_100396486 Ga0070714_1003964862 134
247 3300005436 Ga0070713_100025744 Ga0070713_1000257443 134
248 3300005436 Ga0070713_100115756 Ga0070713_1001157563 134
249 3300005436 Ga0070713_100259256 Ga0070713_1002592562 134
250 3300005437 Ga0070710_10095114 Ga0070710_100951141 134
251 3300005438 Ga0070701_10035493 Ga0070701_100354932 134
252 3300005439 Ga0070711_100069569 Ga0070711_1000695692 134
253 3300005439 Ga0070711_100412032 Ga0070711_1004120322 134
254 3300005439 Ga0070711_101474866 Ga0070711_1014748661 134
255 3300005441 Ga0070700_100235392 Ga0070700_1002353922 134
256 3300005445 Ga0070708_100012763 Ga0070708_1000127637 134
257 3300005445 Ga0070708_100041792 Ga0070708_1000417922 134
258 3300005445 Ga0070708_100073284 Ga0070708_1000732842 134
259 3300005455 Ga0070663_100132557 Ga0070663_1001325573 134
260 3300005455 Ga0070663_100154652 Ga0070663_1001546522 134
261 3300005456 Ga0070678_100001279 Ga0070678_1000012795 134
262 3300005456 Ga0070678_100325364 Ga0070678_1003253642 134
263 3300005457 Ga0070662_100072154 Ga0070662_1000721542 134
264 3300005458 Ga0070681_10015039 Ga0070681_100150397 134
265 3300005458 Ga0070681_10137981 Ga0070681_101379813 134
266 3300005458 Ga0070681_10316890 Ga0070681_103168903 134
267 3300005466 Ga0070685_10006488 Ga0070685_100064883 134
268 3300005467 Ga0070706_100010487 Ga0070706_1000104874 134
269 3300005467 Ga0070706_100069388 Ga0070706_1000693883 134
270 3300005467 Ga0070706_100135894 Ga0070706_1001358942 134
271 3300005468 Ga0070707_100006096 Ga0070707_1000060969 134
272 3300005468 Ga0070707_100009485 Ga0070707_1000094858 134
273 3300005468 Ga0070707_100092063 Ga0070707_1000920634 134
274 3300005468 Ga0070707_100124956 Ga0070707_1001249562 134
275 3300005471 Ga0070698_100030770 Ga0070698_1000307704 134
276 3300005471 Ga0070698_100166792 Ga0070698_1001667921 134
277 3300005518 Ga0070699_100001027 Ga0070699_10000102715 134
278 3300005518 Ga0070699_100008978 Ga0070699_1000089782 134
279 3300005518 Ga0070699_101352983 Ga0070699_1013529831 134
280 3300005530 Ga0070679_100356680 Ga0070679_1003566803 134
281 3300005530 Ga0070679_101054760 Ga0070679_1010547602 134
282 3300005535 Ga0070684_100008190 Ga0070684_1000081903 134
283 3300005535 Ga0070684_100058238 Ga0070684_1000582382 134
284 3300005536 Ga0070697_100005514 Ga0070697_1000055147 134
285 3300005536 Ga0070697_100038998 Ga0070697_1000389983 134
286 3300005539 Ga0068853_100007763 Ga0068853_1000077638 134
287 3300005539 Ga0068853_100030992 Ga0068853_1000309925 134
288 3300005539 Ga0068853_101225314 Ga0068853_1012253142 134
289 3300005543 Ga0070672_100106557 Ga0070672_1001065572 134
290 3300005544 Ga0070686_100278841 Ga0070686_1002788411 134
291 3300005544 Ga0070686_100379598 Ga0070686_1003795982 134
292 3300005547 Ga0070693_100059055 Ga0070693_1000590553 134
293 3300005563 Ga0068855_100029998 Ga0068855_1000299986 134
294 3300005563 Ga0068855_100467719 Ga0068855_1004677192 134
295 3300005563 Ga0068855_100830688 Ga0068855_1008306882 134
296 3300005564 Ga0070664_100453641 Ga0070664_1004536412 134
297 3300005577 Ga0068857_100149834 Ga0068857_1001498344 134
298 3300005577 Ga0068857_100833958 Ga0068857_1008339582 134
299 3300005578 Ga0068854_100147293 Ga0068854_1001472933 134
300 3300005578 Ga0068854_100676058 Ga0068854_1006760581 134
301 3300005578 Ga0068854_101015950 Ga0068854_1010159502 134
302 3300005614 Ga0068856_100002427 Ga0068856_10000242716 134
303 3300005614 Ga0068856_100040140 Ga0068856_1000401403 134
304 3300005614 Ga0068856_100293226 Ga0068856_1002932263 134
305 3300005615 Ga0070702_100599296 Ga0070702_1005992961 134
306 3300005616 Ga0068852_100033406 Ga0068852_1000334062 134
307 3300005616 Ga0068852_100198010 Ga0068852_1001980103 134
308 3300005617 Ga0068859_100108769 Ga0068859_1001087692 134
309 3300005618 Ga0068864_100117827 Ga0068864_1001178273 134
310 3300005718 Ga0068866_10004876 Ga0068866_100048765 134
311 3300005719 Ga0068861_102532556 Ga0068861_1025325561 134
312 3300005834 Ga0068851_10038726 Ga0068851_100387263 134
313 3300005834 Ga0068851_10576531 Ga0068851_105765311 134
314 3300005840 Ga0068870_10047043 Ga0068870_100470432 134
315 3300005841 Ga0068863_100019063 Ga0068863_1000190635 134
316 3300005841 Ga0068863_100184095 Ga0068863_1001840953 134
317 3300005841 Ga0068863_100236045 Ga0068863_1002360451 134
318 3300005842 Ga0068858_100022316 Ga0068858_1000223164 134
319 3300005843 Ga0068860_100103788 Ga0068860_1001037884 134
320 3300005844 Ga0068862_100028772 Ga0068862_1000287724 134
321 3300005844 Ga0068862_100856742 Ga0068862_1008567422 134
322 3300006028 Ga0070717_10317015 Ga0070717_103170151 134
323 3300006028 Ga0070717_10389735 Ga0070717_103897352 134
324 3300006028 Ga0070717_10933422 Ga0070717_109334221 134
325 3300006163 Ga0070715_10019671 Ga0070715_100196713 134
326 3300006173 Ga0070716_100003222 Ga0070716_1000032223 134
327 3300006173 Ga0070716_100100104 Ga0070716_1001001043 134
328 3300006173 Ga0070716_100155662 Ga0070716_1001556622 134
329 3300006173 Ga0070716_100328294 Ga0070716_1003282942 134
330 3300006173 Ga0070716_100367081 Ga0070716_1003670811 134
331 3300006175 Ga0070712_100098909 Ga0070712_1000989093 134
332 3300006175 Ga0070712_100125793 Ga0070712_1001257932 134
333 3300006237 Ga0097621_100130082 Ga0097621_1001300824 134
334 3300006358 Ga0068871_100326392 Ga0068871_1003263922 134
335 3300006358 Ga0068871_100664804 Ga0068871_1006648041 134
336 3300006881 Ga0068865_100328457 Ga0068865_1003284571 134
337 3300006931 Ga0097620_100108769 Ga0097620_1001087692 134
338 3300007076 Ga0075435_100506761 Ga0075435_1005067612 134
339 3300007076 Ga0075435_100784378 Ga0075435_1007843782 134
340 3300007265 Ga0099794_10418028 Ga0099794_104180282 134
341 3300009092 Ga0105250_10011456 Ga0105250_100114563 134
342 3300009093 Ga0105240_10106765 Ga0105240_101067654 134
343 3300009093 Ga0105240_10502575 Ga0105240_105025752 134
344 3300009094 Ga0111539_10439828 Ga0111539_104398281 134
345 3300009098 Ga0105245_10006526 Ga0105245_100065261 134
346 3300009098 Ga0105245_10131233 Ga0105245_101312332 134
347 3300009101 Ga0105247_10009888 Ga0105247_100098881 134
348 3300009174 Ga0105241_10005799 Ga0105241_100057997 134
349 3300009174 Ga0105241_10351316 Ga0105241_103513162 134
350 3300009174 Ga0105241_11752262 Ga0105241_117522621 134
351 3300009176 Ga0105242_10039444 Ga0105242_100394444 134
352 3300009177 Ga0105248_10158545 Ga0105248_101585452 134
353 3300009177 Ga0105248_10891987 Ga0105248_108919871 134
354 3300009545 Ga0105237_10101184 Ga0105237_101011842 134
355 3300009551 Ga0105238_10132724 Ga0105238_101327244 134
356 3300009551 Ga0105238_10515169 Ga0105238_105151691 134
357 3300009553 Ga0105249_10045464 Ga0105249_100454642 134
358 3300009553 Ga0105249_10058017 Ga0105249_100580173 134
359 3300010375 Ga0105239_10007204 Ga0105239_1000720413 134
360 3300010375 Ga0105239_10193424 Ga0105239_101934242 134
361 3300010375 Ga0105239_10400412 Ga0105239_104004122 134
362 3300010375 Ga0105239_10549897 Ga0105239_105498972 134
363 3300010375 Ga0105239_11902513 Ga0105239_119025131 134
364 3300011119 Ga0105246_10008559 Ga0105246_100085595 134
365 3300013100 Ga0157373_10004453 Ga0157373_100044538 134
366 3300013100 Ga0157373_10021421 Ga0157373_100214215 134
367 3300013102 Ga0157371_10121856 Ga0157371_101218562 134
368 3300013105 Ga0157369_10038570 Ga0157369_100385705 134
369 3300013105 Ga0157369_10686189 Ga0157369_106861892 134
370 3300013296 Ga0157374_10046865 Ga0157374_100468655 134
371 3300013296 Ga0157374_10052978 Ga0157374_100529784 134
372 3300013296 Ga0157374_10592784 Ga0157374_105927841 134
373 3300013297 Ga0157378_10870689 Ga0157378_108706891 134
374 3300013306 Ga0163162_10028765 Ga0163162_100287651 134
375 3300013306 Ga0163162_10061087 Ga0163162_100610873 134
376 3300013307 Ga0157372_10012309 Ga0157372_100123097 134
377 3300013307 Ga0157372_10196987 Ga0157372_101969873 134
378 3300013308 Ga0157375_10018772 Ga0157375_100187722 134
379 3300013308 Ga0157375_10731394 Ga0157375_107313943 134
380 3300014325 Ga0163163_10008354 Ga0163163_1000835411 134
381 3300014325 Ga0163163_10030385 Ga0163163_100303853 134
382 3300014325 Ga0163163_10438906 Ga0163163_104389062 134
383 3300014325 Ga0163163_10670480 Ga0163163_106704802 134
384 3300014326 Ga0157380_10102355 Ga0157380_101023552 134
385 3300014497 Ga0182008_10015208 Ga0182008_100152085 134
386 3300014497 Ga0182008_10213825 Ga0182008_102138252 134
387 3300014745 Ga0157377_10000586 Ga0157377_100005866 134
388 3300014745 Ga0157377_10306086 Ga0157377_103060862 134
389 3300014968 Ga0157379_10006714 Ga0157379_100067145 134
390 3300014969 Ga0157376_10013454 Ga0157376_100134543 134
391 3300015261 Ga0182006_1031108 Ga0182006_10311082 134
392 3300015262 Ga0182007_10005454 Ga0182007_100054546 134
393 3300015265 Ga0182005_1029281 Ga0182005_10292812 134
394 3300015265 Ga0182005_1044810 Ga0182005_10448102 134
395 3300017792 Ga0163161_10001547 Ga0163161_100015479 134
396 3300024225 Ga0224572_1075237 Ga0224572_10752371 134
397 3300025321 Ga0207656_10124430 Ga0207656_101244301 134
398 3300025321 Ga0207656_10135191 Ga0207656_101351912 134
399 3300025893 Ga0207682_10016930 Ga0207682_100169303 134
400 3300025898 Ga0207692_10065092 Ga0207692_100650922 134
401 3300025898 Ga0207692_10147019 Ga0207692_101470192 134
402 3300025899 Ga0207642_10049378 Ga0207642_100493781 134
403 3300025900 Ga0207710_10018798 Ga0207710_100187981 134
404 3300025901 Ga0207688_10012221 Ga0207688_100122214 134
405 3300025903 Ga0207680_10504031 Ga0207680_105040311 134
406 3300025904 Ga0207647_10003396 Ga0207647_100033963 134
407 3300025905 Ga0207685_10044952 Ga0207685_100449522 134
408 3300025906 Ga0207699_10034920 Ga0207699_100349203 134
409 3300025906 Ga0207699_10120381 Ga0207699_101203812 134
410 3300025906 Ga0207699_10304448 Ga0207699_103044483 134
411 3300025907 Ga0207645_10000551 Ga0207645_1000055134 134
412 3300025908 Ga0207643_10005881 Ga0207643_100058812 134
413 3300025909 Ga0207705_10957682 Ga0207705_109576821 134
414 3300025910 Ga0207684_10002771 Ga0207684_100027718 134
415 3300025910 Ga0207684_10049869 Ga0207684_100498693 134
416 3300025910 Ga0207684_10099131 Ga0207684_100991313 134
417 3300025911 Ga0207654_11331277 Ga0207654_113312771 134
418 3300025912 Ga0207707_10265712 Ga0207707_102657121 134
419 3300025912 Ga0207707_11104211 Ga0207707_111042111 134
420 3300025913 Ga0207695_10026809 Ga0207695_100268094 134
421 3300025913 Ga0207695_10067791 Ga0207695_100677914 134
422 3300025915 Ga0207693_10002941 Ga0207693_1000294114 134
423 3300025915 Ga0207693_10043654 Ga0207693_100436544 134
424 3300025915 Ga0207693_10161959 Ga0207693_101619591 134
425 3300025916 Ga0207663_10249981 Ga0207663_102499812 134
426 3300025918 Ga0207662_10000359 Ga0207662_100003598 134
427 3300025919 Ga0207657_10006439 Ga0207657_100064392 134
428 3300025919 Ga0207657_10330060 Ga0207657_103300602 134
429 3300025920 Ga0207649_10000546 Ga0207649_1000054611 134
430 3300025920 Ga0207649_10065665 Ga0207649_100656653 134
431 3300025921 Ga0207652_10562188 Ga0207652_105621881 134
432 3300025922 Ga0207646_10010353 Ga0207646_100103535 134
433 3300025922 Ga0207646_10078909 Ga0207646_100789092 134
434 3300025922 Ga0207646_10131355 Ga0207646_101313552 134
435 3300025922 Ga0207646_10173488 Ga0207646_101734882 134
436 3300025923 Ga0207681_10123919 Ga0207681_101239193 134
437 3300025923 Ga0207681_10466426 Ga0207681_104664261 134
438 3300025924 Ga0207694_10694841 Ga0207694_106948411 134
439 3300025925 Ga0207650_10000045 Ga0207650_10000045160 134
440 3300025925 Ga0207650_10894898 Ga0207650_108948981 134
441 3300025926 Ga0207659_10866935 Ga0207659_108669351 134
442 3300025927 Ga0207687_10739471 Ga0207687_107394711 134
443 3300025928 Ga0207700_10047164 Ga0207700_100471642 134
444 3300025928 Ga0207700_10061696 Ga0207700_100616963 134
445 3300025928 Ga0207700_10772156 Ga0207700_107721562 134
446 3300025929 Ga0207664_10000084 Ga0207664_1000008424 134
447 3300025929 Ga0207664_10487527 Ga0207664_104875272 134
448 3300025931 Ga0207644_10018085 Ga0207644_100180854 134
449 3300025932 Ga0207690_10150412 Ga0207690_101504123 134
450 3300025932 Ga0207690_10216747 Ga0207690_102167472 134
451 3300025932 Ga0207690_11073472 Ga0207690_110734722 134
452 3300025933 Ga0207706_10001085 Ga0207706_1000108519 134
453 3300025933 Ga0207706_10015387 Ga0207706_100153873 134
454 3300025934 Ga0207686_11622488 Ga0207686_116224881 134
455 3300025936 Ga0207670_10290299 Ga0207670_102902991 134
456 3300025937 Ga0207669_10605012 Ga0207669_106050121 134
457 3300025938 Ga0207704_10828483 Ga0207704_108284831 134
458 3300025939 Ga0207665_10081748 Ga0207665_100817483 134
459 3300025939 Ga0207665_10278571 Ga0207665_102785713 134
460 3300025939 Ga0207665_10301797 Ga0207665_103017972 134
461 3300025939 Ga0207665_11041111 Ga0207665_110411111 134
462 3300025940 Ga0207691_10001782 Ga0207691_1000178213 134
463 3300025942 Ga0207689_10001473 Ga0207689_100014739 134
464 3300025944 Ga0207661_10000131 Ga0207661_1000013137 134
465 3300025944 Ga0207661_10193847 Ga0207661_101938472 134
466 3300025945 Ga0207679_10000283 Ga0207679_1000028330 134
467 3300025949 Ga0207667_10356049 Ga0207667_103560492 134
468 3300025949 Ga0207667_10683862 Ga0207667_106838622 134
469 3300025960 Ga0207651_10009810 Ga0207651_100098102 134
470 3300025961 Ga0207712_10030789 Ga0207712_100307894 134
471 3300025972 Ga0207668_11562406 Ga0207668_115624061 134
472 3300025981 Ga0207640_10502092 Ga0207640_105020922 134
473 3300025986 Ga0207658_10158695 Ga0207658_101586952 134
474 3300025986 Ga0207658_10634869 Ga0207658_106348692 134
475 3300026023 Ga0207677_10198917 Ga0207677_101989171 134
476 3300026023 Ga0207677_10649161 Ga0207677_106491612 134
477 3300026035 Ga0207703_10045185 Ga0207703_100451853 134
478 3300026041 Ga0207639_10265446 Ga0207639_102654463 134
479 3300026041 Ga0207639_10595449 Ga0207639_105954491 134
480 3300026067 Ga0207678_10001378 Ga0207678_1000137813 134
481 3300026067 Ga0207678_10232501 Ga0207678_102325013 134
482 3300026078 Ga0207702_10050684 Ga0207702_100506841 134
483 3300026078 Ga0207702_10108385 Ga0207702_101083853 134
484 3300026078 Ga0207702_10279068 Ga0207702_102790681 134
485 3300026088 Ga0207641_10000021 Ga0207641_1000002129 134
486 3300026088 Ga0207641_10196731 Ga0207641_101967313 134
487 3300026088 Ga0207641_10676539 Ga0207641_106765391 134
488 3300026088 Ga0207641_10906849 Ga0207641_109068491 134
489 3300026089 Ga0207648_10000611 Ga0207648_1000061112 134
490 3300026095 Ga0207676_10000096 Ga0207676_1000009611 134
491 3300026116 Ga0207674_10000246 Ga0207674_1000024611 134
492 3300026116 Ga0207674_10060331 Ga0207674_100603313 134
493 3300026116 Ga0207674_11310567 Ga0207674_113105672 134
494 3300026118 Ga0207675_100070698 Ga0207675_1000706984 134
495 3300026121 Ga0207683_10001457 Ga0207683_1000145713 134
496 3300026121 Ga0207683_10267748 Ga0207683_102677482 134
497 3300026142 Ga0207698_10573319 Ga0207698_105733192 134
498 3300026142 Ga0207698_10978216 Ga0207698_109782161 134
499 3300028379 Ga0268266_10005064 Ga0268266_100050644 134
500 3300028380 Ga0268265_10003076 Ga0268265_1000307614 134
501 3300028381 Ga0268264_10047549 Ga0268264_100475492 134
502 3300028381 Ga0268264_10084962 Ga0268264_100849622 134
503 3300028800 Ga0265338_10227177 Ga0265338_102271772 134
504 3300028800 Ga0265338_10604582 Ga0265338_106045821 134
505 3300031090 Ga0265760_10009710 Ga0265760_100097102 134
506 3300031241 Ga0265325_10031869 Ga0265325_100318692 134
507 3300031241 Ga0265325_10078570 Ga0265325_100785702 134
508 3300031247 Ga0265340_10007178 Ga0265340_100071785 134
509 3300031595 Ga0265313_10075770 Ga0265313_100757701 134
510 3300031712 Ga0265342_10043479 Ga0265342_100434791 134
511 3300035083 Ga0373926_0019860 Ga0373926_0019860_946_1350 134
512 3300035086 Ga0373934_0006504 Ga0373934_0006504_2326_2730 134
513 3300035089 Ga0373944_0060904 Ga0373944_0060904_529_933 134
514 3300035111 Ga0373923_0007452 Ga0373923_0007452_419_823 134
515 3300035113 Ga0373936_0004722 Ga0373936_0004722_128_532 134
516 3300035116 Ga0373945_0004249 Ga0373945_0004249_3161_3565 134
517 3300035117 Ga0373953_0032634 Ga0373953_0032634_1278_1682 134
518 3300035118 Ga0373954_0026687 Ga0373954_0026687_408_812 134
519 3300035120 Ga0373957_0008137 Ga0373957_0008137_351_755 134
520 3300035170 Ga0373943_0000009 Ga0373943_0000009_25274_25678 134
521 3300035171 Ga0373946_0003102 Ga0373946_0003102_1326_1730 134
522 3300035172 Ga0373955_0007748 Ga0373955_0007748_1479_1883 134
523 3300035692 Ga0373935_0001716 Ga0373935_0001716_2236_2640 134
524 3300035695 Ga0373927_0000539 Ga0373927_0000539_433_837 134
525 3300035724 Ga0373933_0117306 Ga0373933_0117306_190_594 134
526 3300035724 Ga0373933_0401360 Ga0373933_0401360_388_822 134
527 3300035725 Ga0373947_0002046 Ga0373947_0002046_3301_3705 134
528 3300036401 Ga0373937_1149568 Ga0373937_1149568_149_562 134
529 3300037068 Ga0373925_0001274 Ga0373925_0001274_9407_9811 134
530 3300039438 Ga0436360_1075001 Ga0436360_1075001_107_532 134
531 3300039453 Ga0436362_1177367 Ga0436362_1177367_2481_2915 134
532 3300044673 Ga0453683_0425474 Ga0453683_0425474_246_662 134
533 3300044706 Ga0466964_0290260 Ga0466964_0290260_392_796 134
534 3300044712 Ga0453684_1012298 Ga0453684_1012298_437_847 134
535 3300045049 Ga0466959_0907550 Ga0466959_0907550_89_523 134
536 3300045051 Ga0451576_0733048 Ga0451576_0733048_114_524 134
537 3300045976 Ga0466967_0467208 Ga0466967_0467208_155_559 134
538 3300046459 Ga0495629_0587236 Ga0495629_0587236_95_499 134
539 3300046472 Ga0495580_0003245 Ga0495580_0003245_6098_6511 134
540 3300046472 Ga0495580_0041517 Ga0495580_0041517_1293_1697 134
541 3300046477 Ga0495664_0014988 Ga0495664_0014988_2886_3290 134
542 3300046511 Ga0495608_0163243 Ga0495608_0163243_887_1291 134
543 3300046517 Ga0495630_0227859 Ga0495630_0227859_511_915 134
544 3300046531 Ga0495665_0088960 Ga0495665_0088960_1021_1434 134
545 3300046535 Ga0495586_0461053 Ga0495586_0461053_291_707 134
546 3300046559 Ga0495667_0287029 Ga0495667_0287029_303_707 134
547 3300046616 Ga0495668_0515746 Ga0495668_0515746_63_476 134
548 3300046663 Ga0495635_0172917 Ga0495635_0172917_245_649 134
549 3300046675 Ga0495657_0269339 Ga0495657_0269339_93_497 134
550 3300046678 Ga0495599_0068244 Ga0495599_0068244_1756_2160 134
551 3300046680 Ga0495646_0141496 Ga0495646_0141496_672_1076 134
552 3300046681 Ga0495647_0213318 Ga0495647_0213318_430_834 134
553 3300046684 Ga0495669_0028174 Ga0495669_0028174_763_1176 134
554 3300046684 Ga0495669_0095019 Ga0495669_0095019_633_1043 134
555 3300047319 Ga0495674_0002665 Ga0495674_0002665_1118_1522 134
556 3300047322 Ga0495680_0220513 Ga0495680_0220513_215_619 134
557 3300047471 Ga0495684_0317018 Ga0495684_0317018_572_976 134
558 3300047673 Ga0495593_0541224 Ga0495593_0541224_156_560 134
559 3300048904 Ga0496101_0287148 Ga0496101_0287148_483_887 134
560 3300048905 Ga0496102_0234468 Ga0496102_0234468_1173_1577 134
561 3300048907 Ga0496104_0058718 Ga0496104_0058718_1258_1746 134
562 3300048907 Ga0496104_0999178 Ga0496104_0999178_198_602 134
563 3300048908 Ga0496105_0490360 Ga0496105_0490360_19_423 134
564 3300048908 Ga0496105_0499014 Ga0496105_0499014_54_476 134
565 3300048909 Ga0496106_0152915 Ga0496106_0152915_767_1255 134
566 3300048909 Ga0496106_0958538 Ga0496106_0958538_35_445 134
567 3300048911 Ga0496108_0000605 Ga0496108_0000605_26193_26597 134
568 3300048911 Ga0496108_0259665 Ga0496108_0259665_142_552 134
569 3300048911 Ga0496108_0389845 Ga0496108_0389845_383_871 134
570 3300048912 Ga0496109_0000749 Ga0496109_0000749_14791_15195 134
571 3300048912 Ga0496109_0026423 Ga0496109_0026423_1190_1612 134
572 3300048912 Ga0496109_0282572 Ga0496109_0282572_316_726 134
573 3300048913 Ga0496110_0001050 Ga0496110_0001050_11763_12167 134
574 3300048914 Ga0496111_0009969 Ga0496111_0009969_298_786 134
575 3300048914 Ga0496111_0363528 Ga0496111_0363528_614_1018 134
576 3300048915 Ga0496112_0001655 Ga0496112_0001655_5204_5608 134
577 3300048915 Ga0496112_0575983 Ga0496112_0575983_633_1043 134
578 3300048915 Ga0496112_1506245 Ga0496112_1506245_49_537 134
579 3300048916 Ga0496113_0000468 Ga0496113_0000468_7528_7932 134
580 3300048916 Ga0496113_0103173 Ga0496113_0103173_544_954 134
581 3300048916 Ga0496113_0255495 Ga0496113_0255495_438_926 134
582 3300050511 nmdc:mga08y16_622594_c1 nmdc:mga08y16_622594_c1_97_501 134
583 3300050513 nmdc:mga0rr50_614018_c1 nmdc:mga0rr50_614018_c1_487_891 134
584 3300050513 nmdc:mga0rr50_759084_c1 nmdc:mga0rr50_759084_c1_285_689 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

62

161

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9028 3 132
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8897 3 132
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8883 1 133
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.888 1 131
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.878 4 130
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9217 36 133 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8981 1 133 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8951 36 133 3.30.300.20
1ml8A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8877 3 34 2.20.25.10
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8866 36 132 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V9KAK9-F1-model_v4 Osmotically inducible protein OsmC 0.9921 42 131
AF-A0A321LZJ6-F1-model_v4 Osmotically inducible protein OsmC 0.9916 24 132
AF-A0A2V9W1K5-F1-model_v4 Osmotically inducible protein OsmC 0.99 1 133
AF-A0A4R1LA32-F1-model_v4 Putative redox protein 0.9896 3 132
AF-A0A7C5CIB6-F1-model_v4 OsmC family peroxiredoxin 0.9889 39 131

Feature Viewer

pLDDT pTM Quality
95.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map