F466359

General Info

Members Datasets Scaffolds Average Seq Length
584 318 1168 133

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11018146|Ga0157370_110181462
Length 153
Sequence VISNIDTARKECIVNTHQTPATTRGASNTPTATQQAPARSRYSDAALTPPVDVVEDSGGITLYADLPGVSREKLQLNVEADTLTIEAESALPSPEGLQSSHTEVGLARFRRVFTLSKELDTEQVSAEFAQGVLRLRIPKAQHAQPRRVEVKVG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
171 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
172 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
173 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
174 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
175 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
200 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
225 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
226 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
227 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
228 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
233 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
234 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
276 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
277 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
278 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
279 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
296 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
305 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
306 2643221658 Variovorax sp. Root411 Isolate Unclassified
307 2643221672 Variovorax sp. Root434 Isolate Unclassified
308 2842677519 Variovorax sp. R-72495 Isolate Unclassified
309 2842747753 Variovorax sp. R-72060 Isolate Unclassified
310 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
311 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
312 2904456579 Variovorax sp. 2002 Isolate Unclassified
313 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
314 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
315 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
316 2929520902 Variovorax beijingensis 502 Isolate Unclassified
317 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
318 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 2.4
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.58
Nodule 0.51
Rhizoplane 2.4
Rhizosphere 76.71
Stem 0
Stem Tuber 0
Unclassified 5.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_11018146 3300013104 Bacteria 749
2 JGI25159J45721_1045723 3300002987 Unclassified 618
3 JGI25151J46595_10001326 3300003187 Bacteria 17311
4 rootL2_10138106 3300003322 Bacteria 4710
5 rootL2_10189271 3300003322 Bacteria 4674
6 Ga0006562J51391_1181789 3300003578 Bacteria 2375
7 Ga0006562J51391_1181790 3300003578 Bacteria 2100
8 Ga0055537_1000241 3300003773 Bacteria 40227
9 Ga0055524_1000378 3300003775 Bacteria 38772
10 Ga0055536_1000488 3300003781 Bacteria 27544
11 Ga0055536_1006774 3300003781 Bacteria 5246
12 Ga0055536_1008209 3300003781 Bacteria 4530
13 Ga0055534_1000232 3300003784 Bacteria 40227
14 Ga0055534_1000516 3300003784 Bacteria 20853
15 Ga0055528_1000324 3300003790 Bacteria 40031
16 Ga0055528_1028323 3300003790 Bacteria 1548
17 Ga0055530_10005929 3300003791 Bacteria 5632
18 Ga0055540_1000174 3300003792 Bacteria 63200
19 Ga0055540_1001670 3300003792 Bacteria 12843
20 Ga0055531_10000217 3300003794 Bacteria 63200
21 Ga0065165_1157570 3300005262 Unclassified 526
22 Ga0065714_10002707 3300005288 Bacteria 31240
23 Ga0065704_10096167 3300005289 Bacteria 2455
24 Ga0065707_10200321 3300005295 Bacteria 1314
25 Ga0070658_10266738 3300005327 Bacteria 1455
26 Ga0070676_10143556 3300005328 Bacteria 1522
27 Ga0070676_11157617 3300005328 Unclassified 586
28 Ga0070690_100112696 3300005330 Bacteria 1817
29 Ga0070690_101035656 3300005330 Bacteria 648
30 Ga0070670_100000533 3300005331 Bacteria 30477
31 Ga0070670_100005607 3300005331 Bacteria 10592
32 Ga0070670_100027021 3300005331 Bacteria 4937
33 Ga0070670_100040589 3300005331 Bacteria 4000
34 Ga0068869_100000406 3300005334 Bacteria 23468
35 Ga0068869_100736068 3300005334 Bacteria 843
36 Ga0070680_101678104 3300005336 Unclassified 551
37 Ga0070682_100090713 3300005337 Bacteria 1999
38 Ga0068868_100049985 3300005338 Bacteria 3283
39 Ga0070660_100014671 3300005339 Bacteria 5652
40 Ga0070687_100013309 3300005343 Bacteria 3663
41 Ga0070687_100270753 3300005343 Bacteria 1064
42 Ga0070687_100588948 3300005343 Bacteria 762
43 Ga0070661_100007314 3300005344 Bacteria 7616
44 Ga0070661_100514904 3300005344 Bacteria 959
45 Ga0070668_100017834 3300005347 Bacteria 5325
46 Ga0070668_100122893 3300005347 Bacteria 2077
47 Ga0070668_100449778 3300005347 Bacteria 1107
48 Ga0070669_100001456 3300005353 Bacteria 17135
49 Ga0070669_100008569 3300005353 Bacteria 7299
50 Ga0070669_100012132 3300005353 Bacteria 6116
51 Ga0070669_100642606 3300005353 Bacteria 892
52 Ga0070675_100090529 3300005354 Bacteria 2562
53 Ga0070675_100273330 3300005354 Bacteria 1483
54 Ga0070675_101282440 3300005354 Bacteria 675
55 Ga0070675_101380628 3300005354 Bacteria 649
56 Ga0070671_100043399 3300005355 Bacteria 3736
57 Ga0070671_100380539 3300005355 Bacteria 1206
58 Ga0070671_101481368 3300005355 Bacteria 600
59 Ga0070674_100463617 3300005356 Bacteria 1048
60 Ga0070674_100598455 3300005356 Bacteria 931
61 Ga0070673_100042478 3300005364 Bacteria 3506
62 Ga0070673_100061654 3300005364 Bacteria 2976
63 Ga0070673_100182935 3300005364 Bacteria 1795
64 Ga0070688_100202753 3300005365 Bacteria 1389
65 Ga0070688_100599656 3300005365 Bacteria 843
66 Ga0070659_100023938 3300005366 Bacteria 4678
67 Ga0070659_100614658 3300005366 Bacteria 935
68 Ga0070667_100003620 3300005367 Bacteria 13151
69 Ga0070667_100299802 3300005367 Bacteria 1447
70 Ga0070667_100386876 3300005367 Bacteria 1271
71 Ga0070667_100498353 3300005367 Bacteria 1116
72 Ga0070667_100538971 3300005367 Unclassified 1072
73 Ga0070667_101325974 3300005367 Bacteria 674
74 Ga0070713_100189900 3300005436 Bacteria 1850
75 Ga0070710_10074023 3300005437 Bacteria 1971
76 Ga0070701_10499957 3300005438 Unclassified 789
77 Ga0070711_100132902 3300005439 Unclassified 1856
78 Ga0070663_101459400 3300005455 Bacteria 607
79 Ga0070663_101784200 3300005455 Unclassified 551
80 Ga0070678_100078238 3300005456 Bacteria 2498
81 Ga0070678_100353695 3300005456 Bacteria 1264
82 Ga0070678_100605245 3300005456 Unclassified 979
83 Ga0070678_100720898 3300005456 Bacteria 900
84 Ga0070678_101480722 3300005456 Bacteria 635
85 Ga0070678_102118239 3300005456 Bacteria 533
86 Ga0070662_100005367 3300005457 Bacteria 8185
87 Ga0070662_100021484 3300005457 Bacteria 4407
88 Ga0070662_100056358 3300005457 Bacteria 2853
89 Ga0068867_100001139 3300005459 Bacteria 18170
90 Ga0068867_100050990 3300005459 Bacteria 3051
91 Ga0068867_100097127 3300005459 Bacteria 2244
92 Ga0068867_100214525 3300005459 Bacteria 1548
93 Ga0068867_101004027 3300005459 Bacteria 757
94 Ga0070679_100434553 3300005530 Unclassified 1258
95 Ga0068853_100210244 3300005539 Bacteria 1773
96 Ga0070672_100000122 3300005543 Bacteria 40112
97 Ga0070672_100030513 3300005543 Bacteria 4051
98 Ga0070672_100229513 3300005543 Bacteria 1559
99 Ga0070686_100205867 3300005544 Bacteria 1413
100 Ga0070695_101391885 3300005545 Unclassified 581
101 Ga0070696_100026951 3300005546 Bacteria 3912
102 Ga0070693_100560166 3300005547 Bacteria 819
103 Ga0070665_100253106 3300005548 Bacteria 1762
104 Ga0070665_100440486 3300005548 Unclassified 1312
105 Ga0070664_100035103 3300005564 Bacteria 4209
106 Ga0070664_100116728 3300005564 Bacteria 2334
107 Ga0070664_100281049 3300005564 Bacteria 1501
108 Ga0070664_100507554 3300005564 Bacteria 1112
109 Ga0068857_100126615 3300005577 Bacteria 2302
110 Ga0068857_100550082 3300005577 Bacteria 1087
111 Ga0068854_100260546 3300005578 Bacteria 1388
112 Ga0070702_100291566 3300005615 Bacteria 1125
113 Ga0068852_102088355 3300005616 Bacteria 588
114 Ga0068859_100040426 3300005617 Bacteria 4681
115 Ga0068859_100394718 3300005617 Bacteria 1479
116 Ga0068859_100744884 3300005617 Bacteria 1069
117 Ga0068859_100994660 3300005617 Unclassified 921
118 Ga0068864_100002029 3300005618 Bacteria 16706
119 Ga0068864_100004785 3300005618 Bacteria 11095
120 Ga0068864_100079774 3300005618 Bacteria 2867
121 Ga0068864_100084323 3300005618 Bacteria 2792
122 Ga0068864_100690169 3300005618 Bacteria 997
123 Ga0068864_101486276 3300005618 Bacteria 680
124 Ga0068866_10015561 3300005718 Bacteria 3381
125 Ga0068861_100012836 3300005719 Bacteria 5852
126 Ga0068861_100926217 3300005719 Bacteria 827
127 Ga0068851_10316999 3300005834 Bacteria 900
128 Ga0068870_10057499 3300005840 Bacteria 2079
129 Ga0068870_10638615 3300005840 Bacteria 728
130 Ga0068870_11043444 3300005840 Bacteria 585
131 Ga0068863_100003307 3300005841 Bacteria 15912
132 Ga0068863_100004930 3300005841 Bacteria 13156
133 Ga0068863_100029728 3300005841 Bacteria 5217
134 Ga0068863_100053951 3300005841 Bacteria 3809
135 Ga0068863_100073543 3300005841 Bacteria 3234
136 Ga0068863_100270775 3300005841 Unclassified 1644
137 Ga0068863_100309115 3300005841 Bacteria 1534
138 Ga0068863_100329851 3300005841 Bacteria 1483
139 Ga0068863_101053259 3300005841 Bacteria 817
140 Ga0068858_100054415 3300005842 Bacteria 3700
141 Ga0068858_100076543 3300005842 Bacteria 3107
142 Ga0068858_100263234 3300005842 Bacteria 1640
143 Ga0068860_100083518 3300005843 Bacteria 3038
144 Ga0068860_100144703 3300005843 Bacteria 2286
145 Ga0068860_100167807 3300005843 Unclassified 2119
146 Ga0068860_100265386 3300005843 Bacteria 1674
147 Ga0068860_100284706 3300005843 Bacteria 1616
148 Ga0068862_100170718 3300005844 Bacteria 1947
149 Ga0068862_100343501 3300005844 Unclassified 1383
150 Ga0068862_100803332 3300005844 Bacteria 919
151 Ga0068862_100865241 3300005844 Bacteria 887
152 Ga0068862_101025205 3300005844 Bacteria 817
153 Ga0075365_10019767 3300006038 Bacteria 4164
154 Ga0075365_10585502 3300006038 Bacteria 789
155 Ga0075368_10242961 3300006042 Bacteria 768
156 Ga0075363_100017059 3300006048 Bacteria 3595
157 Ga0075363_100134273 3300006048 Bacteria 1390
158 Ga0075363_100634715 3300006048 Bacteria 642
159 Ga0075364_10001534 3300006051 Bacteria 12593
160 Ga0075364_10946292 3300006051 Bacteria 586
161 Ga0075432_10015262 3300006058 Bacteria 2619
162 Ga0075432_10016068 3300006058 Bacteria 2556
163 Ga0075362_10005878 3300006177 Bacteria 4528
164 Ga0075362_10018060 3300006177 Bacteria 2914
165 Ga0075362_10160366 3300006177 Bacteria 1083
166 Ga0075362_10197358 3300006177 Bacteria 979
167 Ga0075362_10632702 3300006177 Bacteria 555
168 Ga0075367_10086305 3300006178 Bacteria 1905
169 Ga0075367_10208094 3300006178 Bacteria 1223
170 Ga0075367_10656534 3300006178 Bacteria 667
171 Ga0075369_10031713 3300006186 Bacteria 2232
172 Ga0075369_10199921 3300006186 Bacteria 922
173 Ga0075366_10008816 3300006195 Bacteria 5618
174 Ga0075366_10146196 3300006195 Bacteria 1430
175 Ga0075366_10391574 3300006195 Bacteria 855
176 Ga0075366_10474018 3300006195 Bacteria 773
177 Ga0097621_100072734 3300006237 Bacteria 2844
178 Ga0097621_100320284 3300006237 Bacteria 1373
179 Ga0075370_10000574 3300006353 Bacteria 14126
180 Ga0075370_10006076 3300006353 Bacteria 6051
181 Ga0075370_10044981 3300006353 Bacteria 2496
182 Ga0068871_100067773 3300006358 Bacteria 2929
183 Ga0068871_100295055 3300006358 Bacteria 1422
184 Ga0068871_100495812 3300006358 Bacteria 1100
185 Ga0068871_100776759 3300006358 Bacteria 882
186 Ga0075431_100974927 3300006847 Bacteria 815
187 Ga0075434_100230568 3300006871 Bacteria 1871
188 Ga0068865_100044739 3300006881 Bacteria 3032
189 Ga0068865_100114582 3300006881 Bacteria 1994
190 Ga0068865_101146802 3300006881 Unclassified 686
191 Ga0097620_100040424 3300006931 Bacteria 4681
192 Ga0097620_100394728 3300006931 Bacteria 1479
193 Ga0097620_100744885 3300006931 Bacteria 1069
194 Ga0097620_100994421 3300006931 Unclassified 921
195 Ga0099826_10007477 3300006948 Bacteria 8062
196 Ga0099826_10081533 3300006948 Bacteria 2013
197 Ga0105251_10075188 3300009011 Bacteria 1569
198 Ga0105244_10000473 3300009036 Bacteria 36586
199 Ga0105240_10752336 3300009093 Bacteria 1059
200 Ga0105245_11622759 3300009098 Bacteria 698
201 Ga0105247_10105670 3300009101 Bacteria 1805
202 Ga0105243_10017643 3300009148 Bacteria 5398
203 Ga0105241_10821638 3300009174 Unclassified 857
204 Ga0105248_10045430 3300009177 Bacteria 4926
205 Ga0105248_10421215 3300009177 Bacteria 1504
206 Ga0105237_10938300 3300009545 Bacteria 872
207 Ga0105238_10166661 3300009551 Bacteria 2179
208 Ga0105249_10938226 3300009553 Bacteria 933
209 Ga0105249_11852762 3300009553 Bacteria 676
210 Ga0105239_10127965 3300010375 Bacteria 2824
211 Ga0105239_10931854 3300010375 Bacteria 997
212 Ga0157373_10044079 3300013100 Bacteria 3185
213 Ga0157374_10133865 3300013296 Bacteria 2401
214 Ga0157374_11513265 3300013296 Bacteria 694
215 Ga0157378_10049080 3300013297 Bacteria 3755
216 Ga0157378_10075997 3300013297 Bacteria 3025
217 Ga0157378_11044904 3300013297 Unclassified 852
218 Ga0157378_12609901 3300013297 Bacteria 558
219 Ga0163162_10186921 3300013306 Bacteria 2199
220 Ga0163162_10195652 3300013306 Bacteria 2150
221 Ga0163162_10829743 3300013306 Bacteria 1040
222 Ga0157375_10023821 3300013308 Bacteria 5656
223 Ga0157375_10033632 3300013308 Bacteria 4874
224 Ga0157375_10172419 3300013308 Bacteria 2311
225 Ga0157375_10211196 3300013308 Bacteria 2098
226 Ga0157375_12719727 3300013308 Bacteria 592
227 Ga0163163_10014439 3300014325 Bacteria 7260
228 Ga0163163_10028813 3300014325 Bacteria 5337
229 Ga0163163_11258405 3300014325 Bacteria 802
230 Ga0157380_10032686 3300014326 Bacteria 4005
231 Ga0182008_10000374 3300014497 Bacteria 34622
232 Ga0182008_10000675 3300014497 Bacteria 24682
233 Ga0182008_10002559 3300014497 Bacteria 11328
234 Ga0182008_10019529 3300014497 Bacteria 3497
235 Ga0182008_10048929 3300014497 Bacteria 2099
236 Ga0182008_10113869 3300014497 Bacteria 1341
237 Ga0157379_10000458 3300014968 Bacteria 33058
238 Ga0157379_11539449 3300014968 Bacteria 648
239 Ga0157376_10056473 3300014969 Bacteria 3280
240 Ga0157376_10175160 3300014969 Bacteria 1956
241 Ga0157376_10234995 3300014969 Bacteria 1705
242 Ga0157376_10669715 3300014969 Bacteria 1040
243 Ga0157376_11099282 3300014969 Bacteria 821
244 Ga0182006_1010239 3300015261 Bacteria 4177
245 Ga0182006_1026985 3300015261 Bacteria 2347
246 Ga0182006_1094806 3300015261 Bacteria 1068
247 Ga0182006_1254925 3300015261 Bacteria 576
248 Ga0182007_10000192 3300015262 Bacteria 41119
249 Ga0182007_10000630 3300015262 Bacteria 20540
250 Ga0182007_10085958 3300015262 Bacteria 1033
251 Ga0182005_1032295 3300015265 Bacteria 1425
252 Ga0183362_10002 3300015683 Bacteria 1432711
253 Ga0163161_10019186 3300017792 Bacteria 4795
254 Ga0163161_10084397 3300017792 Bacteria 2342
255 Ga0224712_10062083 3300022467 Bacteria 1492
256 Ga0209565_1000269 3300025263 Bacteria 52870
257 Ga0209565_1016792 3300025263 Bacteria 1620
258 Ga0209673_1000640 3300025273 Bacteria 52870
259 Ga0209673_1004228 3300025273 Bacteria 7816
260 Ga0209130_1001875 3300025284 Bacteria 11986
261 Ga0209675_1000252 3300025291 Bacteria 52870
262 Ga0209675_1001009 3300025291 Bacteria 17677
263 Ga0209675_1011408 3300025291 Bacteria 2948
264 Ga0209676_1000152 3300025292 Bacteria 166700
265 Ga0209676_1001899 3300025292 Bacteria 17035
266 Ga0209676_1075433 3300025292 Bacteria 786
267 Ga0209676_1101651 3300025292 Bacteria 611
268 Ga0209025_1000973 3300025294 Bacteria 42929
269 Ga0209025_1006234 3300025294 Bacteria 9344
270 Ga0209025_1026745 3300025294 Bacteria 2885
271 Ga0209050_1000210 3300025298 Bacteria 129834
272 Ga0209050_1005555 3300025298 Bacteria 7857
273 Ga0209256_1000092 3300025299 Bacteria 210547
274 Ga0209051_1000074 3300025303 Bacteria 208667
275 Ga0209051_1000397 3300025303 Bacteria 60597
276 Ga0209051_1004338 3300025303 Bacteria 8797
277 Ga0209051_1121512 3300025303 Bacteria 662
278 Ga0209257_1000072 3300025304 Bacteria 332791
279 Ga0209257_1012460 3300025304 Bacteria 3924
280 Ga0207697_10105967 3300025315 Bacteria 1201
281 Ga0207655_1003447 3300025728 Bacteria 11763
282 Ga0207688_10495819 3300025901 Bacteria 764
283 Ga0207645_10139830 3300025907 Bacteria 1577
284 Ga0207645_10185669 3300025907 Bacteria 1365
285 Ga0207643_10106404 3300025908 Bacteria 1649
286 Ga0207643_10846655 3300025908 Unclassified 593
287 Ga0207671_10965514 3300025914 Bacteria 672
288 Ga0207662_10484563 3300025918 Bacteria 850
289 Ga0207662_10619647 3300025918 Bacteria 754
290 Ga0207657_10016643 3300025919 Bacteria 7084
291 Ga0207649_10003885 3300025920 Bacteria 8150
292 Ga0207652_10452266 3300025921 Unclassified 1158
293 Ga0207681_10006381 3300025923 Bacteria 7240
294 Ga0207681_10018212 3300025923 Bacteria 4423
295 Ga0207694_10178499 3300025924 Bacteria 1721
296 Ga0207650_10004071 3300025925 Bacteria 9992
297 Ga0207650_10036909 3300025925 Bacteria 3557
298 Ga0207650_10065500 3300025925 Bacteria 2723
299 Ga0207650_10304063 3300025925 Bacteria 1303
300 Ga0207650_11236665 3300025925 Bacteria 636
301 Ga0207659_10408638 3300025926 Bacteria 1137
302 Ga0207659_10680902 3300025926 Bacteria 880
303 Ga0207687_11493552 3300025927 Bacteria 580
304 Ga0207644_10029426 3300025931 Bacteria 3811
305 Ga0207690_10010241 3300025932 Bacteria 5567
306 Ga0207690_10715639 3300025932 Bacteria 824
307 Ga0207706_10012799 3300025933 Bacteria 7634
308 Ga0207686_10846617 3300025934 Bacteria 735
309 Ga0207709_10000793 3300025935 Bacteria 24654
310 Ga0207704_10099725 3300025938 Bacteria 1933
311 Ga0207704_10409435 3300025938 Bacteria 1072
312 Ga0207691_10001269 3300025940 Bacteria 25255
313 Ga0207691_10242089 3300025940 Bacteria 1559
314 Ga0207711_10028427 3300025941 Bacteria 4705
315 Ga0207711_10400307 3300025941 Bacteria 1276
316 Ga0207711_10809168 3300025941 Unclassified 873
317 Ga0207689_10211384 3300025942 Bacteria 1603
318 Ga0207689_10360279 3300025942 Bacteria 1209
319 Ga0207689_10994590 3300025942 Bacteria 707
320 Ga0207679_10002279 3300025945 Bacteria 11836
321 Ga0207679_10388559 3300025945 Bacteria 1225
322 Ga0207679_10814964 3300025945 Bacteria 851
323 Ga0207651_10016089 3300025960 Bacteria 4369
324 Ga0207651_10030527 3300025960 Bacteria 3433
325 Ga0207651_10494912 3300025960 Bacteria 1056
326 Ga0207668_10002175 3300025972 Bacteria 11442
327 Ga0207668_10215271 3300025972 Bacteria 1539
328 Ga0207668_10238781 3300025972 Bacteria 1469
329 Ga0207658_10026500 3300025986 Bacteria 4064
330 Ga0207658_10029174 3300025986 Bacteria 3893
331 Ga0207658_10291038 3300025986 Bacteria 1404
332 Ga0207677_10045500 3300026023 Bacteria 2931
333 Ga0207639_10432561 3300026041 Bacteria 1192
334 Ga0207678_10329572 3300026067 Bacteria 1314
335 Ga0207708_10481969 3300026075 Bacteria 1037
336 Ga0207641_10005203 3300026088 Bacteria 11123
337 Ga0207641_10103199 3300026088 Bacteria 2515
338 Ga0207641_10571363 3300026088 Unclassified 1104
339 Ga0207641_10747187 3300026088 Bacteria 965
340 Ga0207641_10953351 3300026088 Unclassified 853
341 Ga0207641_11029959 3300026088 Bacteria 820
342 Ga0207648_10011353 3300026089 Bacteria 8398
343 Ga0207648_10154622 3300026089 Bacteria 2024
344 Ga0207648_10224129 3300026089 Bacteria 1671
345 Ga0207648_11168374 3300026089 Bacteria 723
346 Ga0207676_10002773 3300026095 Bacteria 12461
347 Ga0207676_10067022 3300026095 Bacteria 2866
348 Ga0207676_10521367 3300026095 Bacteria 1131
349 Ga0207675_101286864 3300026118 Bacteria 752
350 Ga0207675_101667957 3300026118 Bacteria 657
351 Ga0207683_10035169 3300026121 Bacteria 4357
352 Ga0207683_10577310 3300026121 Bacteria 1040
353 Ga0207683_10821804 3300026121 Bacteria 863
354 Ga0207683_10973805 3300026121 Unclassified 788
355 Ga0207698_10930496 3300026142 Bacteria 877
356 Ga0209973_1007964 3300027252 Bacteria 1197
357 Ga0209983_1008978 3300027665 Bacteria 2043
358 Ga0209282_1004503 3300027666 Bacteria 8406
359 Ga0209813_10117890 3300027866 Bacteria 921
360 Ga0207428_10142336 3300027907 Bacteria 1829
361 Ga0268266_10009652 3300028379 Bacteria 8487
362 Ga0268265_10112944 3300028380 Bacteria 2222
363 Ga0268265_10159718 3300028380 Bacteria 1913
364 Ga0268264_10045905 3300028381 Bacteria 3628
365 Ga0268264_10160046 3300028381 Bacteria 2027
366 Ga0268264_10261451 3300028381 Unclassified 1612
367 Ga0268264_10278590 3300028381 Bacteria 1565
368 Ga0268264_11510152 3300028381 Unclassified 682
369 Ga0316177_1064101 3300030731 Bacteria 1286
370 Ga0316176_1095815 3300030732 Bacteria 7945
371 Ga0314311_1187413 3300030733 Bacteria 4069
372 Ga0316179_1108004 3300030734 Bacteria 2296
373 Ga0316178_1073154 3300030735 Bacteria 8992
374 Ga0316180_1106339 3300030736 Bacteria 1394
375 Ga0316183_1037632 3300030742 Bacteria 7342
376 Ga0316183_1071558 3300030742 Bacteria 4635
377 Ga0316181_1032171 3300030744 Bacteria 4225
378 Ga0316181_1196510 3300030744 Bacteria 863
379 Ga0316182_1397043 3300030745 Bacteria 3744
380 Ga0265332_10009346 3300031238 Bacteria 4379
381 Ga0307513_10292932 3300031456 Bacteria 1398
382 Ga0307408_100006090 3300031548 Bacteria 8020
383 Ga0307408_100237352 3300031548 Bacteria 1496
384 Ga0307408_100299510 3300031548 Bacteria 1346
385 Ga0307408_101357582 3300031548 Bacteria 668
386 Ga0265313_10066529 3300031595 Bacteria 1670
387 Ga0307514_10002271 3300031649 Bacteria 20395
388 Ga0307514_10030669 3300031649 Bacteria 4315
389 Ga0316575_10156966 3300031665 Bacteria 940
390 Ga0316579_10000031 3300031691 Bacteria 32051
391 Ga0316579_10022550 3300031691 Unclassified 2816
392 Ga0316578_10009234 3300031728 Bacteria 5063
393 Ga0307516_10000497 3300031730 Bacteria 52295
394 Ga0307405_10185802 3300031731 Bacteria 1496
395 Ga0307405_10402858 3300031731 Bacteria 1071
396 Ga0307405_10581436 3300031731 Bacteria 911
397 Ga0307405_10608725 3300031731 Bacteria 892
398 Ga0307405_11156511 3300031731 Bacteria 667
399 Ga0316577_10050834 3300031733 Bacteria 2314
400 Ga0307413_10256059 3300031824 Bacteria 1302
401 Ga0307406_10017287 3300031901 Bacteria 4199
402 Ga0307406_10145519 3300031901 Bacteria 1683
403 Ga0307407_10123187 3300031903 Bacteria 1647
404 Ga0307412_10099584 3300031911 Bacteria 2053
405 Ga0307412_10215434 3300031911 Bacteria 1468
406 Ga0307412_10296651 3300031911 Bacteria 1276
407 Ga0307412_10444558 3300031911 Bacteria 1066
408 Ga0307412_11556679 3300031911 Bacteria 602
409 Ga0307412_11780004 3300031911 Bacteria 566
410 Ga0307412_12048322 3300031911 Bacteria 530
411 Ga0307409_100290249 3300031995 Bacteria 1517
412 Ga0307416_100215494 3300032002 Bacteria 1836
413 Ga0307416_101811752 3300032002 Bacteria 714
414 Ga0307414_10482449 3300032004 Bacteria 1093
415 Ga0307414_10715744 3300032004 Bacteria 907
416 Ga0307414_11276756 3300032004 Bacteria 681
417 Ga0307411_10279208 3300032005 Bacteria 1328
418 Ga0307411_10559543 3300032005 Bacteria 977
419 Ga0307411_10598671 3300032005 Bacteria 947
420 Ga0307415_100226450 3300032126 Bacteria 1503
421 Ga0316583_10009548 3300032133 Bacteria 3494
422 Ga0316583_10034495 3300032133 Bacteria 1795
423 Ga0316583_10281273 3300032133 Unclassified 576
424 Ga0316593_10026821 3300032168 Bacteria 1844
425 Ga0316593_10028851 3300032168 Bacteria 1791
426 Ga0316593_10047561 3300032168 Bacteria 1443
427 Ga0316593_10124615 3300032168 Unclassified 927
428 Ga0316574_0056355 3300035398 Bacteria 2459
429 Ga0316582_0002941 3300036647 Bacteria 8195
430 Ga0316582_0092144 3300036647 Bacteria 1996
431 Ga0316584_0023830 3300036712 Bacteria 4472
432 Ga0316584_0413979 3300036712 Bacteria 958
433 Ga0395899_0219850 3300037312 Bacteria 1316
434 Ga0395899_0228049 3300037312 Bacteria 1287
435 Ga0395900_0023607 3300037418 Bacteria 6292
436 Ga0395905_0000455 3300037471 Bacteria 57161
437 Ga0395905_0014027 3300037471 Bacteria 7662
438 Ga0395905_0029176 3300037471 Bacteria 5199
439 Ga0316581_0010445 3300037588 Bacteria 2574
440 Ga0395901_0605522 3300038443 Bacteria 1104
441 Ga0439436_0103098 3300041404 Bacteria 795
442 Ga0439461_0025782 3300041410 Bacteria 1196
443 Ga0439466_0025115 3300041411 Bacteria 2082
444 Ga0439465_0050740 3300041413 Bacteria 1358
445 Ga0439465_0071484 3300041413 Bacteria 1163
446 Ga0451791_0231617 3300041451 Bacteria 945
447 Ga0451793_1676247 3300041452 Bacteria 898
448 Ga0451797_0485924 3300041453 Bacteria 742
449 Ga0451795_1550194 3300041456 Bacteria 793
450 Ga0451802_0805532 3300041460 Bacteria 1132
451 Ga0451802_1837356 3300041460 Bacteria 576
452 Ga0451807_0023713 3300041486 Bacteria 3638
453 Ga0451843_0193779 3300041509 Bacteria 569
454 Ga0439431_0149367 3300041997 Bacteria 663
455 Ga0439437_038609 3300042000 Bacteria 615
456 Ga0439442_024383 3300042002 Bacteria 1258
457 Ga0439445_0073181 3300042004 Bacteria 950
458 Ga0450919_006111 3300042121 Bacteria 1431
459 Ga0450923_011732 3300042125 Bacteria 1582
460 Ga0450890_039348 3300042127 Bacteria 695
461 Ga0450894_006032 3300042131 Bacteria 1567
462 Ga0450896_063960 3300042133 Bacteria 602
463 Ga0450906_003616 3300042145 Bacteria 3302
464 Ga0450910_003638 3300042147 Bacteria 2053
465 Ga0439446_0010182 3300042156 Bacteria 2530
466 Ga0439446_0026896 3300042156 Bacteria 1650
467 Ga0439446_0084780 3300042156 Bacteria 985
468 Ga0450908_030040 3300042184 Bacteria 944
469 Ga0439434_0001996 3300042435 Bacteria 5901
470 Ga0439434_0107969 3300042435 Bacteria 900
471 Ga0439444_0197363 3300042437 Bacteria 506
472 Ga0450918_000965 3300042531 Bacteria 5995
473 Ga0450893_0017575 3300042532 Bacteria 1215
474 Ga0450893_0136812 3300042532 Bacteria 520
475 Ga0451577_0121026 3300042876 Bacteria 2344
476 Ga0451577_1039927 3300042876 Bacteria 734
477 Ga0466969_0052549 3300044656 Bacteria 2002
478 Ga0466972_0000073 3300044658 Bacteria 96438
479 Ga0466972_0321334 3300044658 Bacteria 723
480 Ga0453683_0389715 3300044673 Unclassified 897
481 Ga0466965_0025588 3300044683 Bacteria 2857
482 Ga0466966_0090907 3300044684 Bacteria 1895
483 Ga0466961_0239704 3300044693 Bacteria 1115
484 Ga0466961_0455503 3300044693 Bacteria 774
485 Ga0466964_0043257 3300044706 Bacteria 1826
486 Ga0453684_0000163 3300044712 Bacteria 296196
487 Ga0453684_0031445 3300044712 Bacteria 7460
488 Ga0466971_0031657 3300044719 Bacteria 2369
489 Ga0466960_0075337 3300044901 Bacteria 1688
490 Ga0466959_0037184 3300045049 Bacteria 3597
491 Ga0466959_0100718 3300045049 Bacteria 2068
492 Ga0451576_0010764 3300045051 Bacteria 10469
493 Ga0451576_0101670 3300045051 Bacteria 2989
494 Ga0451576_0483065 3300045051 Bacteria 1301
495 Ga0495650_0017971 3300046471 Bacteria 3529
496 Ga0495643_0026684 3300046522 Bacteria 3255
497 Ga0495642_0008464 3300046528 Bacteria 3936
498 Ga0495654_0154246 3300046530 Bacteria 1013
499 Ga0495597_0083934 3300046542 Bacteria 1359
500 Ga0495625_0000012 3300046660 Bacteria 363006
501 Ga0495687_017881 3300047443 Bacteria 3520
502 Ga0495687_034200 3300047443 Bacteria 2298
503 Ga0496102_0165509 3300048905 Bacteria 2081
504 Ga0496103_0283746 3300048906 Bacteria 1065
505 Ga0496112_0073060 3300048915 Bacteria 3391
506 Ga0496113_1050740 3300048916 Bacteria 640
507 Ga0496113_1448588 3300048916 Bacteria 531
508 Ga0496114_0001657 3300048917 Bacteria 16887
509 Ga0496114_1500718 3300048917 Bacteria 562
510 Ga0496116_0014631 3300048919 Bacteria 6253
511 Ga0496117_0022808 3300048920 Bacteria 5013
512 Ga0496118_0006217 3300048921 Bacteria 13211
513 Ga0496121_0002968 3300048924 Bacteria 24705
514 Ga0496121_0249340 3300048924 Bacteria 1232
515 Ga0496122_0000039 3300048925 Bacteria 295352
516 Ga0496123_0000026 3300048926 Bacteria 318040
517 Ga0496124_0032772 3300048927 Bacteria 4582
518 Ga0496124_0306117 3300048927 Bacteria 1145
519 Ga0496125_0058334 3300048928 Bacteria 3119
520 Ga0496125_0114347 3300048928 Bacteria 1944
521 Ga0501037_0649407 3300049573 Unclassified 705
522 Ga0501038_0202790 3300049574 Bacteria 1591
523 Ga0501039_0359806 3300049575 Bacteria 1143
524 Ga0501043_0465413 3300049579 Unclassified 948
525 Ga0501046_0757373 3300049580 Bacteria 682
526 Ga0501249_001839 3300049679 Bacteria 4321
527 Ga0501221_038092 3300049704 Bacteria 1038
528 Ga0501225_0009489 3300049705 Bacteria 2768
529 Ga0501262_000042 3300049759 Bacteria 16776
530 Ga0501269_006202 3300049766 Bacteria 1440
531 Ga0501035_0019463 3300049822 Bacteria 6242
532 Ga0501044_0020301 3300049823 Bacteria 7091
533 nmdc:mga03683_150667_c1 3300050489 Bacteria 1049
534 nmdc:mga03683_229473_c1 3300050489 Bacteria 858
535 nmdc:mga03683_270092_c1 3300050489 Bacteria 793
536 nmdc:mga03683_348860_c1 3300050489 Bacteria 700
537 nmdc:mga03683_667476_c1 3300050489 Bacteria 513
538 nmdc:mga03n38_198939_c1 3300050490 Bacteria 1036
539 nmdc:mga03n38_54842_c1 3300050490 Bacteria 1793
540 nmdc:mga00v17_5334_c1 3300050491 Bacteria 6771
541 nmdc:mga0yw44_251023_c1 3300050492 Bacteria 1177
542 nmdc:mga0yw44_86079_c1 3300050492 Bacteria 1979
543 nmdc:mga0k408_302159_c1 3300050493 Bacteria 955
544 nmdc:mga0k408_34685_c1 3300050493 Bacteria 770
545 nmdc:mga0k408_418613_c1 3300050493 Bacteria 797
546 nmdc:mga06z11_143642_c1 3300050494 Bacteria 1351
547 nmdc:mga04h51_138621_c1 3300050495 Bacteria 921
548 nmdc:mga07m45_145905_c1 3300050496 Bacteria 1372
549 nmdc:mga07m45_154243_c1 3300050496 Bacteria 1332
550 nmdc:mga07m45_159_c1 3300050496 Bacteria 27066
551 nmdc:mga07m45_88067_c1 3300050496 Bacteria 1777
552 nmdc:mga0n895_229076_c1 3300050512 Bacteria 1886
553 nmdc:mga0sz30_81306_c1 3300050516 Bacteria 1402
554 Ga0500646_0065757 3300053090 Bacteria 1077
555 Ga0500658_0489332 3300053134 Bacteria 558
556 Ga0500616_0068248 3300053153 Bacteria 1822
557 Ga0500616_0191940 3300053153 Bacteria 911
558 Ga0500627_0225180 3300053158 Bacteria 836
559 Ga0590071_011503 3300059421 Bacteria 2070
560 Ga0590075_048819 3300059424 Bacteria 1085
561 Ga0587077_009298 3300059493 Bacteria 1488
562 Ga0587082_080726 3300059504 Bacteria 677
563 Ga0587090_006132 3300059510 Bacteria 1533
564 Ga0587090_010198 3300059510 Bacteria 1299
565 Ga0587128_007279 3300059630 Bacteria 1392
566 Ga0587128_012315 3300059630 Bacteria 1186
567 Ga0587075_007701 3300059644 Bacteria 1359
568 Ga0466962_0062261 3300061719 Bacteria 1781
569 Ga0466962_0183128 3300061719 Bacteria 1021
570 2513229022 2513020051 Bacteria 6053213
571 2644162526 2643221628 Bacteria 5745828
572 2644329090 2643221658 Bacteria 6064537
573 2644401817 2643221672 Bacteria 6322190
574 2842678446 2842677519 Bacteria 5615038
575 2842750328 2842747753 Bacteria 5578255
576 2881930594 2881927736 Bacteria 3993927
577 2904455000 2904449895 Bacteria 6927402
578 2904457362 2904456579 Bacteria 6819253
579 2904550059 2904541872 Bacteria 8915136
580 2919465128 2919462493 Bacteria 5817112
581 2929166553 2929160207 Bacteria 9075316
582 2929525208 2929520902 Bacteria 6765052
583 2945977841 2945972063 Bacteria 6086495
584 2954772796 2954767861 Bacteria 5535784
585 Ga0157370_11018146
586 JGI25159J45721_1045723
587 JGI25151J46595_10001326
588 rootL2_10138106
589 rootL2_10189271
590 Ga0006562J51391_1181789
591 Ga0006562J51391_1181790
592 Ga0055537_1000241
593 Ga0055524_1000378
594 Ga0055536_1000488
595 Ga0055536_1006774
596 Ga0055536_1008209
597 Ga0055534_1000232
598 Ga0055534_1000516
599 Ga0055528_1000324
600 Ga0055528_1028323
601 Ga0055530_10005929
602 Ga0055540_1000174
603 Ga0055540_1001670
604 Ga0055531_10000217
605 Ga0065165_1157570
606 Ga0065714_10002707
607 Ga0065704_10096167
608 Ga0065707_10200321
609 Ga0070658_10266738
610 Ga0070676_10143556
611 Ga0070676_11157617
612 Ga0070690_100112696
613 Ga0070690_101035656
614 Ga0070670_100000533
615 Ga0070670_100005607
616 Ga0070670_100027021
617 Ga0070670_100040589
618 Ga0068869_100000406
619 Ga0068869_100736068
620 Ga0070680_101678104
621 Ga0070682_100090713
622 Ga0068868_100049985
623 Ga0070660_100014671
624 Ga0070687_100013309
625 Ga0070687_100270753
626 Ga0070687_100588948
627 Ga0070661_100007314
628 Ga0070661_100514904
629 Ga0070668_100017834
630 Ga0070668_100122893
631 Ga0070668_100449778
632 Ga0070669_100001456
633 Ga0070669_100008569
634 Ga0070669_100012132
635 Ga0070669_100642606
636 Ga0070675_100090529
637 Ga0070675_100273330
638 Ga0070675_101282440
639 Ga0070675_101380628
640 Ga0070671_100043399
641 Ga0070671_100380539
642 Ga0070671_101481368
643 Ga0070674_100463617
644 Ga0070674_100598455
645 Ga0070673_100042478
646 Ga0070673_100061654
647 Ga0070673_100182935
648 Ga0070688_100202753
649 Ga0070688_100599656
650 Ga0070659_100023938
651 Ga0070659_100614658
652 Ga0070667_100003620
653 Ga0070667_100299802
654 Ga0070667_100386876
655 Ga0070667_100498353
656 Ga0070667_100538971
657 Ga0070667_101325974
658 Ga0070713_100189900
659 Ga0070710_10074023
660 Ga0070701_10499957
661 Ga0070711_100132902
662 Ga0070663_101459400
663 Ga0070663_101784200
664 Ga0070678_100078238
665 Ga0070678_100353695
666 Ga0070678_100605245
667 Ga0070678_100720898
668 Ga0070678_101480722
669 Ga0070678_102118239
670 Ga0070662_100005367
671 Ga0070662_100021484
672 Ga0070662_100056358
673 Ga0068867_100001139
674 Ga0068867_100050990
675 Ga0068867_100097127
676 Ga0068867_100214525
677 Ga0068867_101004027
678 Ga0070679_100434553
679 Ga0068853_100210244
680 Ga0070672_100000122
681 Ga0070672_100030513
682 Ga0070672_100229513
683 Ga0070686_100205867
684 Ga0070695_101391885
685 Ga0070696_100026951
686 Ga0070693_100560166
687 Ga0070665_100253106
688 Ga0070665_100440486
689 Ga0070664_100035103
690 Ga0070664_100116728
691 Ga0070664_100281049
692 Ga0070664_100507554
693 Ga0068857_100126615
694 Ga0068857_100550082
695 Ga0068854_100260546
696 Ga0070702_100291566
697 Ga0068852_102088355
698 Ga0068859_100040426
699 Ga0068859_100394718
700 Ga0068859_100744884
701 Ga0068859_100994660
702 Ga0068864_100002029
703 Ga0068864_100004785
704 Ga0068864_100079774
705 Ga0068864_100084323
706 Ga0068864_100690169
707 Ga0068864_101486276
708 Ga0068866_10015561
709 Ga0068861_100012836
710 Ga0068861_100926217
711 Ga0068851_10316999
712 Ga0068870_10057499
713 Ga0068870_10638615
714 Ga0068870_11043444
715 Ga0068863_100003307
716 Ga0068863_100004930
717 Ga0068863_100029728
718 Ga0068863_100053951
719 Ga0068863_100073543
720 Ga0068863_100270775
721 Ga0068863_100309115
722 Ga0068863_100329851
723 Ga0068863_101053259
724 Ga0068858_100054415
725 Ga0068858_100076543
726 Ga0068858_100263234
727 Ga0068860_100083518
728 Ga0068860_100144703
729 Ga0068860_100167807
730 Ga0068860_100265386
731 Ga0068860_100284706
732 Ga0068862_100170718
733 Ga0068862_100343501
734 Ga0068862_100803332
735 Ga0068862_100865241
736 Ga0068862_101025205
737 Ga0075365_10019767
738 Ga0075365_10585502
739 Ga0075368_10242961
740 Ga0075363_100017059
741 Ga0075363_100134273
742 Ga0075363_100634715
743 Ga0075364_10001534
744 Ga0075364_10946292
745 Ga0075432_10015262
746 Ga0075432_10016068
747 Ga0075362_10005878
748 Ga0075362_10018060
749 Ga0075362_10160366
750 Ga0075362_10197358
751 Ga0075362_10632702
752 Ga0075367_10086305
753 Ga0075367_10208094
754 Ga0075367_10656534
755 Ga0075369_10031713
756 Ga0075369_10199921
757 Ga0075366_10008816
758 Ga0075366_10146196
759 Ga0075366_10391574
760 Ga0075366_10474018
761 Ga0097621_100072734
762 Ga0097621_100320284
763 Ga0075370_10000574
764 Ga0075370_10006076
765 Ga0075370_10044981
766 Ga0068871_100067773
767 Ga0068871_100295055
768 Ga0068871_100495812
769 Ga0068871_100776759
770 Ga0075431_100974927
771 Ga0075434_100230568
772 Ga0068865_100044739
773 Ga0068865_100114582
774 Ga0068865_101146802
775 Ga0097620_100040424
776 Ga0097620_100394728
777 Ga0097620_100744885
778 Ga0097620_100994421
779 Ga0099826_10007477
780 Ga0099826_10081533
781 Ga0105251_10075188
782 Ga0105244_10000473
783 Ga0105240_10752336
784 Ga0105245_11622759
785 Ga0105247_10105670
786 Ga0105243_10017643
787 Ga0105241_10821638
788 Ga0105248_10045430
789 Ga0105248_10421215
790 Ga0105237_10938300
791 Ga0105238_10166661
792 Ga0105249_10938226
793 Ga0105249_11852762
794 Ga0105239_10127965
795 Ga0105239_10931854
796 Ga0157373_10044079
797 Ga0157374_10133865
798 Ga0157374_11513265
799 Ga0157378_10049080
800 Ga0157378_10075997
801 Ga0157378_11044904
802 Ga0157378_12609901
803 Ga0163162_10186921
804 Ga0163162_10195652
805 Ga0163162_10829743
806 Ga0157375_10023821
807 Ga0157375_10033632
808 Ga0157375_10172419
809 Ga0157375_10211196
810 Ga0157375_12719727
811 Ga0163163_10014439
812 Ga0163163_10028813
813 Ga0163163_11258405
814 Ga0157380_10032686
815 Ga0182008_10000374
816 Ga0182008_10000675
817 Ga0182008_10002559
818 Ga0182008_10019529
819 Ga0182008_10048929
820 Ga0182008_10113869
821 Ga0157379_10000458
822 Ga0157379_11539449
823 Ga0157376_10056473
824 Ga0157376_10175160
825 Ga0157376_10234995
826 Ga0157376_10669715
827 Ga0157376_11099282
828 Ga0182006_1010239
829 Ga0182006_1026985
830 Ga0182006_1094806
831 Ga0182006_1254925
832 Ga0182007_10000192
833 Ga0182007_10000630
834 Ga0182007_10085958
835 Ga0182005_1032295
836 Ga0183362_10002
837 Ga0163161_10019186
838 Ga0163161_10084397
839 Ga0224712_10062083
840 Ga0209565_1000269
841 Ga0209565_1016792
842 Ga0209673_1000640
843 Ga0209673_1004228
844 Ga0209130_1001875
845 Ga0209675_1000252
846 Ga0209675_1001009
847 Ga0209675_1011408
848 Ga0209676_1000152
849 Ga0209676_1001899
850 Ga0209676_1075433
851 Ga0209676_1101651
852 Ga0209025_1000973
853 Ga0209025_1006234
854 Ga0209025_1026745
855 Ga0209050_1000210
856 Ga0209050_1005555
857 Ga0209256_1000092
858 Ga0209051_1000074
859 Ga0209051_1000397
860 Ga0209051_1004338
861 Ga0209051_1121512
862 Ga0209257_1000072
863 Ga0209257_1012460
864 Ga0207697_10105967
865 Ga0207655_1003447
866 Ga0207688_10495819
867 Ga0207645_10139830
868 Ga0207645_10185669
869 Ga0207643_10106404
870 Ga0207643_10846655
871 Ga0207671_10965514
872 Ga0207662_10484563
873 Ga0207662_10619647
874 Ga0207657_10016643
875 Ga0207649_10003885
876 Ga0207652_10452266
877 Ga0207681_10006381
878 Ga0207681_10018212
879 Ga0207694_10178499
880 Ga0207650_10004071
881 Ga0207650_10036909
882 Ga0207650_10065500
883 Ga0207650_10304063
884 Ga0207650_11236665
885 Ga0207659_10408638
886 Ga0207659_10680902
887 Ga0207687_11493552
888 Ga0207644_10029426
889 Ga0207690_10010241
890 Ga0207690_10715639
891 Ga0207706_10012799
892 Ga0207686_10846617
893 Ga0207709_10000793
894 Ga0207704_10099725
895 Ga0207704_10409435
896 Ga0207691_10001269
897 Ga0207691_10242089
898 Ga0207711_10028427
899 Ga0207711_10400307
900 Ga0207711_10809168
901 Ga0207689_10211384
902 Ga0207689_10360279
903 Ga0207689_10994590
904 Ga0207679_10002279
905 Ga0207679_10388559
906 Ga0207679_10814964
907 Ga0207651_10016089
908 Ga0207651_10030527
909 Ga0207651_10494912
910 Ga0207668_10002175
911 Ga0207668_10215271
912 Ga0207668_10238781
913 Ga0207658_10026500
914 Ga0207658_10029174
915 Ga0207658_10291038
916 Ga0207677_10045500
917 Ga0207639_10432561
918 Ga0207678_10329572
919 Ga0207708_10481969
920 Ga0207641_10005203
921 Ga0207641_10103199
922 Ga0207641_10571363
923 Ga0207641_10747187
924 Ga0207641_10953351
925 Ga0207641_11029959
926 Ga0207648_10011353
927 Ga0207648_10154622
928 Ga0207648_10224129
929 Ga0207648_11168374
930 Ga0207676_10002773
931 Ga0207676_10067022
932 Ga0207676_10521367
933 Ga0207675_101286864
934 Ga0207675_101667957
935 Ga0207683_10035169
936 Ga0207683_10577310
937 Ga0207683_10821804
938 Ga0207683_10973805
939 Ga0207698_10930496
940 Ga0209973_1007964
941 Ga0209983_1008978
942 Ga0209282_1004503
943 Ga0209813_10117890
944 Ga0207428_10142336
945 Ga0268266_10009652
946 Ga0268265_10112944
947 Ga0268265_10159718
948 Ga0268264_10045905
949 Ga0268264_10160046
950 Ga0268264_10261451
951 Ga0268264_10278590
952 Ga0268264_11510152
953 Ga0316177_1064101
954 Ga0316176_1095815
955 Ga0314311_1187413
956 Ga0316179_1108004
957 Ga0316178_1073154
958 Ga0316180_1106339
959 Ga0316183_1037632
960 Ga0316183_1071558
961 Ga0316181_1032171
962 Ga0316181_1196510
963 Ga0316182_1397043
964 Ga0265332_10009346
965 Ga0307513_10292932
966 Ga0307408_100006090
967 Ga0307408_100237352
968 Ga0307408_100299510
969 Ga0307408_101357582
970 Ga0265313_10066529
971 Ga0307514_10002271
972 Ga0307514_10030669
973 Ga0316575_10156966
974 Ga0316579_10000031
975 Ga0316579_10022550
976 Ga0316578_10009234
977 Ga0307516_10000497
978 Ga0307405_10185802
979 Ga0307405_10402858
980 Ga0307405_10581436
981 Ga0307405_10608725
982 Ga0307405_11156511
983 Ga0316577_10050834
984 Ga0307413_10256059
985 Ga0307406_10017287
986 Ga0307406_10145519
987 Ga0307407_10123187
988 Ga0307412_10099584
989 Ga0307412_10215434
990 Ga0307412_10296651
991 Ga0307412_10444558
992 Ga0307412_11556679
993 Ga0307412_11780004
994 Ga0307412_12048322
995 Ga0307409_100290249
996 Ga0307416_100215494
997 Ga0307416_101811752
998 Ga0307414_10482449
999 Ga0307414_10715744
1000 Ga0307414_11276756
1001 Ga0307411_10279208
1002 Ga0307411_10559543
1003 Ga0307411_10598671
1004 Ga0307415_100226450
1005 Ga0316583_10009548
1006 Ga0316583_10034495
1007 Ga0316583_10281273
1008 Ga0316593_10026821
1009 Ga0316593_10028851
1010 Ga0316593_10047561
1011 Ga0316593_10124615
1012 Ga0316574_0056355
1013 Ga0316582_0002941
1014 Ga0316582_0092144
1015 Ga0316584_0023830
1016 Ga0316584_0413979
1017 Ga0395899_0219850
1018 Ga0395899_0228049
1019 Ga0395900_0023607
1020 Ga0395905_0000455
1021 Ga0395905_0014027
1022 Ga0395905_0029176
1023 Ga0316581_0010445
1024 Ga0395901_0605522
1025 Ga0439436_0103098
1026 Ga0439461_0025782
1027 Ga0439466_0025115
1028 Ga0439465_0050740
1029 Ga0439465_0071484
1030 Ga0451791_0231617
1031 Ga0451793_1676247
1032 Ga0451797_0485924
1033 Ga0451795_1550194
1034 Ga0451802_0805532
1035 Ga0451802_1837356
1036 Ga0451807_0023713
1037 Ga0451843_0193779
1038 Ga0439431_0149367
1039 Ga0439437_038609
1040 Ga0439442_024383
1041 Ga0439445_0073181
1042 Ga0450919_006111
1043 Ga0450923_011732
1044 Ga0450890_039348
1045 Ga0450894_006032
1046 Ga0450896_063960
1047 Ga0450906_003616
1048 Ga0450910_003638
1049 Ga0439446_0010182
1050 Ga0439446_0026896
1051 Ga0439446_0084780
1052 Ga0450908_030040
1053 Ga0439434_0001996
1054 Ga0439434_0107969
1055 Ga0439444_0197363
1056 Ga0450918_000965
1057 Ga0450893_0017575
1058 Ga0450893_0136812
1059 Ga0451577_0121026
1060 Ga0451577_1039927
1061 Ga0466969_0052549
1062 Ga0466972_0000073
1063 Ga0466972_0321334
1064 Ga0453683_0389715
1065 Ga0466965_0025588
1066 Ga0466966_0090907
1067 Ga0466961_0239704
1068 Ga0466961_0455503
1069 Ga0466964_0043257
1070 Ga0453684_0000163
1071 Ga0453684_0031445
1072 Ga0466971_0031657
1073 Ga0466960_0075337
1074 Ga0466959_0037184
1075 Ga0466959_0100718
1076 Ga0451576_0010764
1077 Ga0451576_0101670
1078 Ga0451576_0483065
1079 Ga0495650_0017971
1080 Ga0495643_0026684
1081 Ga0495642_0008464
1082 Ga0495654_0154246
1083 Ga0495597_0083934
1084 Ga0495625_0000012
1085 Ga0495687_017881
1086 Ga0495687_034200
1087 Ga0496102_0165509
1088 Ga0496103_0283746
1089 Ga0496112_0073060
1090 Ga0496113_1050740
1091 Ga0496113_1448588
1092 Ga0496114_0001657
1093 Ga0496114_1500718
1094 Ga0496116_0014631
1095 Ga0496117_0022808
1096 Ga0496118_0006217
1097 Ga0496121_0002968
1098 Ga0496121_0249340
1099 Ga0496122_0000039
1100 Ga0496123_0000026
1101 Ga0496124_0032772
1102 Ga0496124_0306117
1103 Ga0496125_0058334
1104 Ga0496125_0114347
1105 Ga0501037_0649407
1106 Ga0501038_0202790
1107 Ga0501039_0359806
1108 Ga0501043_0465413
1109 Ga0501046_0757373
1110 Ga0501249_001839
1111 Ga0501221_038092
1112 Ga0501225_0009489
1113 Ga0501262_000042
1114 Ga0501269_006202
1115 Ga0501035_0019463
1116 Ga0501044_0020301
1117 nmdc:mga03683_150667_c1
1118 nmdc:mga03683_229473_c1
1119 nmdc:mga03683_270092_c1
1120 nmdc:mga03683_348860_c1
1121 nmdc:mga03683_667476_c1
1122 nmdc:mga03n38_198939_c1
1123 nmdc:mga03n38_54842_c1
1124 nmdc:mga00v17_5334_c1
1125 nmdc:mga0yw44_251023_c1
1126 nmdc:mga0yw44_86079_c1
1127 nmdc:mga0k408_302159_c1
1128 nmdc:mga0k408_34685_c1
1129 nmdc:mga0k408_418613_c1
1130 nmdc:mga06z11_143642_c1
1131 nmdc:mga04h51_138621_c1
1132 nmdc:mga07m45_145905_c1
1133 nmdc:mga07m45_154243_c1
1134 nmdc:mga07m45_159_c1
1135 nmdc:mga07m45_88067_c1
1136 nmdc:mga0n895_229076_c1
1137 nmdc:mga0sz30_81306_c1
1138 Ga0500646_0065757
1139 Ga0500658_0489332
1140 Ga0500616_0068248
1141 Ga0500616_0191940
1142 Ga0500627_0225180
1143 Ga0590071_011503
1144 Ga0590075_048819
1145 Ga0587077_009298
1146 Ga0587082_080726
1147 Ga0587090_006132
1148 Ga0587090_010198
1149 Ga0587128_007279
1150 Ga0587128_012315
1151 Ga0587075_007701
1152 Ga0466962_0062261
1153 Ga0466962_0183128
1154 2513229022
1155 2644162526
1156 2644329090
1157 2644401817
1158 2842678446
1159 2842750328
1160 2881930594
1161 2904455000
1162 2904457362
1163 2904550059
1164 2919465128
1165 2929166553
1166 2929525208
1167 2945977841
1168 2954772796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

57

137

0.96

PF00011

HSP20

Hsp20/alpha crystallin family

52

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n3e-assembly1.cif.gz_B zebrafish alphaa crystallin 0.855 32 123
2cg9-assembly1.cif.gz_Y crystal structure of an hsp90-sba1 closed chaperone complex 0.8523 30 122
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8442 30 121
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8413 30 120
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8351 32 121
ID Description Score Start End Superfamily
af_A0A0R0GKS6_4_99_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8902 31 115 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8738 31 121 2.60.40.790
af_I1MKZ4_1_104_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8629 31 121 2.60.40.790
af_F1QZY5_45_141_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8613 31 123 2.60.40.790
2cg9Y01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8523 30 122 2.60.40.790
ID Description Score Start End GO Terms
AF-D5BZM4-F1-model_v4 Heat shock protein Hsp20 0.8633 22 135
AF-C4ANX2-F1-model_v4 deleted 0.8531 34 135
AF-A0A3A4R451-F1-model_v4 Hsp20/alpha crystallin family protein 0.8493 30 136
AF-A0A7Y4RBM7-F1-model_v4 Hsp20/alpha crystallin family protein 0.8486 30 135
AF-A0A7C6DJZ5-F1-model_v4 Hsp20/alpha crystallin family protein 0.8389 31 133

Map