F466377

General Info

Members Datasets Scaffolds Average Seq Length
584 278 584 113

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0581262|Ga0373943_0581262_232_603
Length 123
Sequence LPAPGAGKVKIEGEGKLLRIFVGESDRWHGKPLYQAIVERVRKEGLAGATVIRGIEGFGADSRLHTARILRLSEDLPVLIEIVDSAEQIERILPVLDEMVGEGMVTVERVEVIAYRGSAEPPA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 8.9
Rhizosphere 90.07
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1056351 3300001977 Bacteria 558
2 JGI24739J22299_10081163 3300001989 Bacteria 996
3 JGI24738J21930_10046437 3300002075 Unclassified 884
4 JGI24744J21845_10022103 3300002077 Unclassified 1250
5 JGI24742J22300_10018062 3300002244 Bacteria 1195
6 JGI24751J29686_10067669 3300002459 Unclassified 735
7 rootL2_10222519 3300003322 Unclassified 1121
8 rootH1_10082901 3300003323 Bacteria 1687
9 Ga0070658_10025348 3300005327 Bacteria 4755
10 Ga0070658_10034961 3300005327 Bacteria 4045
11 Ga0070658_10072353 3300005327 Bacteria 2825
12 Ga0070658_11078098 3300005327 Bacteria 699
13 Ga0070676_10340896 3300005328 Bacteria 1028
14 Ga0070683_100020638 3300005329 Bacteria 5864
15 Ga0070683_100056584 3300005329 Bacteria 3642
16 Ga0070683_100279505 3300005329 Bacteria 1588
17 Ga0070683_100282635 3300005329 Bacteria 1578
18 Ga0070683_101411319 3300005329 Bacteria 669
19 Ga0070666_10374062 3300005335 Bacteria 1022
20 Ga0070680_100046229 3300005336 Bacteria 3540
21 Ga0070680_100227411 3300005336 Bacteria 1575
22 Ga0070682_100001777 3300005337 Bacteria 12023
23 Ga0070682_100111523 3300005337 Bacteria 1824
24 Ga0070682_100710191 3300005337 Bacteria 807
25 Ga0068868_101437085 3300005338 Bacteria 644
26 Ga0070660_100001667 3300005339 Bacteria 15251
27 Ga0070660_100048434 3300005339 Bacteria 3264
28 Ga0070691_10030216 3300005341 Bacteria 2537
29 Ga0070691_10132846 3300005341 Bacteria 1263
30 Ga0070661_100005154 3300005344 Bacteria 8997
31 Ga0070661_100145927 3300005344 Bacteria 1786
32 Ga0070669_100529186 3300005353 Bacteria 981
33 Ga0070675_100010398 3300005354 Bacteria 7268
34 Ga0070674_100090866 3300005356 Bacteria 2203
35 Ga0070673_100097751 3300005364 Bacteria 2411
36 Ga0070659_100053595 3300005366 Bacteria 3175
37 Ga0070667_100884313 3300005367 Unclassified 831
38 Ga0070709_10069714 3300005434 Bacteria 2265
39 Ga0070714_100001084 3300005435 Bacteria 19467
40 Ga0070714_100122887 3300005435 Bacteria 2311
41 Ga0070714_100187219 3300005435 Bacteria 1887
42 Ga0070714_100578068 3300005435 Bacteria 1077
43 Ga0070714_100809736 3300005435 Bacteria 907
44 Ga0070713_100068651 3300005436 Bacteria 2987
45 Ga0070713_100174140 3300005436 Bacteria 1929
46 Ga0070713_100191971 3300005436 Bacteria 1841
47 Ga0070710_10002369 3300005437 Bacteria 8922
48 Ga0070710_10010592 3300005437 Bacteria 4532
49 Ga0070710_10561056 3300005437 Bacteria 790
50 Ga0070701_10132412 3300005438 Bacteria 1418
51 Ga0070711_100629175 3300005439 Unclassified 898
52 Ga0070705_100229287 3300005440 Unclassified 1291
53 Ga0070700_100460341 3300005441 Bacteria 970
54 Ga0070708_100003821 3300005445 Bacteria 11819
55 Ga0070708_100006095 3300005445 Bacteria 9595
56 Ga0070708_100376852 3300005445 Bacteria 1338
57 Ga0070708_100565617 3300005445 Bacteria 1072
58 Ga0070678_100005901 3300005456 Bacteria 7121
59 Ga0070678_101198291 3300005456 Bacteria 704
60 Ga0070662_100027799 3300005457 Bacteria 3931
61 Ga0070681_10105612 3300005458 Bacteria 2758
62 Ga0070706_100003177 3300005467 Bacteria 16222
63 Ga0070706_100048569 3300005467 Bacteria 3916
64 Ga0070706_100092971 3300005467 Bacteria 2798
65 Ga0070706_101522081 3300005467 Unclassified 611
66 Ga0070706_101532232 3300005467 Unclassified 609
67 Ga0070707_100005238 3300005468 Bacteria 12134
68 Ga0070707_100634630 3300005468 Bacteria 1031
69 Ga0070707_101127035 3300005468 Bacteria 750
70 Ga0070698_100559570 3300005471 Bacteria 1083
71 Ga0070699_100042211 3300005518 Bacteria 3946
72 Ga0070679_100260126 3300005530 Bacteria 1691
73 Ga0070679_100301259 3300005530 Bacteria 1553
74 Ga0070679_100340311 3300005530 Bacteria 1448
75 Ga0070684_100018603 3300005535 Bacteria 5728
76 Ga0070684_100021102 3300005535 Bacteria 5412
77 Ga0070684_100192086 3300005535 Unclassified 1858
78 Ga0070684_100934005 3300005535 Bacteria 813
79 Ga0070697_101242417 3300005536 Bacteria 664
80 Ga0068853_100004196 3300005539 Bacteria 11115
81 Ga0068853_102014412 3300005539 Bacteria 560
82 Ga0070695_100932745 3300005545 Bacteria 703
83 Ga0070693_100022228 3300005547 Bacteria 3369
84 Ga0070693_100118814 3300005547 Bacteria 1637
85 Ga0068855_100046564 3300005563 Bacteria 5126
86 Ga0068855_100626506 3300005563 Bacteria 1158
87 Ga0068857_100785189 3300005577 Bacteria 909
88 Ga0068856_100046444 3300005614 Bacteria 4277
89 Ga0068856_100063637 3300005614 Bacteria 3644
90 Ga0068856_100195891 3300005614 Bacteria 2034
91 Ga0070702_100012411 3300005615 Bacteria 4269
92 Ga0070702_100835118 3300005615 Unclassified 716
93 Ga0068852_100218638 3300005616 Bacteria 1811
94 Ga0068864_100708591 3300005618 Bacteria 984
95 Ga0068861_100801923 3300005719 Bacteria 884
96 Ga0068863_100064638 3300005841 Bacteria 3460
97 Ga0070717_10008478 3300006028 Bacteria 7677
98 Ga0070717_10022452 3300006028 Bacteria 4986
99 Ga0070717_10033324 3300006028 Bacteria 4156
100 Ga0070717_11443819 3300006028 Bacteria 624
101 Ga0075364_10060448 3300006051 Bacteria 2485
102 Ga0070716_100166880 3300006173 Bacteria 1432
103 Ga0070712_100071321 3300006175 Bacteria 2485
104 Ga0070712_101219126 3300006175 Bacteria 655
105 Ga0068865_100725637 3300006881 Bacteria 851
106 Ga0075436_100252464 3300006914 Unclassified 1256
107 Ga0075435_100033009 3300007076 Bacteria 4090
108 Ga0075435_101727951 3300007076 Unclassified 549
109 Ga0105240_10047426 3300009093 Bacteria 5436
110 Ga0105240_10286390 3300009093 Bacteria 1891
111 Ga0105240_11415239 3300009093 Bacteria 731
112 Ga0105245_10133547 3300009098 Bacteria 2330
113 Ga0105245_10259688 3300009098 Bacteria 1690
114 Ga0105245_10504591 3300009098 Bacteria 1226
115 Ga0105245_12597904 3300009098 Bacteria 560
116 Ga0105243_11114334 3300009148 Bacteria 798
117 Ga0105242_10002465 3300009176 Bacteria 14522
118 Ga0105248_10139561 3300009177 Bacteria 2734
119 Ga0105237_11343631 3300009545 Bacteria 721
120 Ga0105238_10078199 3300009551 Bacteria 3299
121 Ga0105238_12429870 3300009551 Bacteria 560
122 Ga0105249_11435644 3300009553 Bacteria 762
123 Ga0105239_10049506 3300010375 Bacteria 4608
124 Ga0105239_10362992 3300010375 Bacteria 1636
125 Ga0105246_10220955 3300011119 Bacteria 1485
126 Ga0157371_10003757 3300013102 Bacteria 13588
127 Ga0157370_10064913 3300013104 Bacteria 3454
128 Ga0157370_10175761 3300013104 Bacteria 1990
129 Ga0157370_11602700 3300013104 Bacteria 585
130 Ga0157369_10004049 3300013105 Bacteria 17368
131 Ga0157369_10005636 3300013105 Bacteria 14546
132 Ga0157369_10057858 3300013105 Bacteria 4181
133 Ga0157369_10424013 3300013105 Bacteria 1379
134 Ga0157374_10092619 3300013296 Bacteria 2884
135 Ga0157374_10251669 3300013296 Bacteria 1739
136 Ga0157374_11161348 3300013296 Bacteria 793
137 Ga0157378_10265593 3300013297 Bacteria 1648
138 Ga0157372_10174350 3300013307 Bacteria 2489
139 Ga0157372_10683535 3300013307 Bacteria 1195
140 Ga0163163_10222868 3300014325 Bacteria 1935
141 Ga0163163_10514677 3300014325 Bacteria 1259
142 Ga0157380_11351325 3300014326 Bacteria 761
143 Ga0182008_10240795 3300014497 Bacteria 931
144 Ga0182008_10451297 3300014497 Unclassified 699
145 Ga0157377_10644330 3300014745 Bacteria 762
146 Ga0157376_10100171 3300014969 Bacteria 2529
147 Ga0182007_10215731 3300015262 Bacteria 676
148 Ga0163161_11544454 3300017792 Bacteria 584
149 Ga0206356_11138035 3300020070 Bacteria 555
150 Ga0206353_11109881 3300020082 Bacteria 1900
151 Ga0207692_10006084 3300025898 Bacteria 4881
152 Ga0207692_10094975 3300025898 Bacteria 1625
153 Ga0207692_10135079 3300025898 Bacteria 1397
154 Ga0207680_10513643 3300025903 Bacteria 854
155 Ga0207699_10297779 3300025906 Bacteria 1126
156 Ga0207699_10388100 3300025906 Bacteria 992
157 Ga0207699_10422622 3300025906 Bacteria 952
158 Ga0207705_10051423 3300025909 Bacteria 2965
159 Ga0207705_10194384 3300025909 Bacteria 1535
160 Ga0207705_10255317 3300025909 Bacteria 1337
161 Ga0207705_10334827 3300025909 Bacteria 1164
162 Ga0207684_10003165 3300025910 Bacteria 16190
163 Ga0207684_10871270 3300025910 Bacteria 758
164 Ga0207684_11402588 3300025910 Unclassified 572
165 Ga0207707_10271357 3300025912 Bacteria 1470
166 Ga0207695_11556293 3300025913 Unclassified 542
167 Ga0207693_10008397 3300025915 Bacteria 8449
168 Ga0207663_10013008 3300025916 Bacteria 4512
169 Ga0207660_10183966 3300025917 Bacteria 1624
170 Ga0207660_11441222 3300025917 Bacteria 557
171 Ga0207657_10014505 3300025919 Bacteria 7685
172 Ga0207649_10212791 3300025920 Bacteria 1372
173 Ga0207652_10536487 3300025921 Bacteria 1052
174 Ga0207652_10596123 3300025921 Bacteria 991
175 Ga0207652_11714794 3300025921 Bacteria 533
176 Ga0207646_10077956 3300025922 Unclassified 2961
177 Ga0207694_10102522 3300025924 Bacteria 2269
178 Ga0207694_10898214 3300025924 Bacteria 749
179 Ga0207687_10029148 3300025927 Bacteria 3711
180 Ga0207700_10005417 3300025928 Bacteria 7631
181 Ga0207700_10040824 3300025928 Bacteria 3389
182 Ga0207664_10034034 3300025929 Bacteria 3921
183 Ga0207664_10192035 3300025929 Bacteria 1758
184 Ga0207664_10266567 3300025929 Bacteria 1499
185 Ga0207664_10393757 3300025929 Bacteria 1231
186 Ga0207690_10013235 3300025932 Bacteria 4953
187 Ga0207690_10066178 3300025932 Bacteria 2474
188 Ga0207706_10005943 3300025933 Bacteria 11353
189 Ga0207686_10010949 3300025934 Bacteria 4947
190 Ga0207709_10148055 3300025935 Bacteria 1623
191 Ga0207669_10338826 3300025937 Bacteria 1157
192 Ga0207704_10399442 3300025938 Bacteria 1084
193 Ga0207665_10081749 3300025939 Bacteria 2225
194 Ga0207711_10430420 3300025941 Bacteria 1228
195 Ga0207689_10119513 3300025942 Bacteria 2168
196 Ga0207661_10021882 3300025944 Bacteria 4800
197 Ga0207661_10085383 3300025944 Bacteria 2616
198 Ga0207661_10099039 3300025944 Bacteria 2444
199 Ga0207661_10357645 3300025944 Bacteria 1318
200 Ga0207661_10490939 3300025944 Bacteria 1122
201 Ga0207679_10734249 3300025945 Bacteria 897
202 Ga0207667_10128179 3300025949 Bacteria 2614
203 Ga0207667_10571068 3300025949 Bacteria 1142
204 Ga0207712_10945270 3300025961 Bacteria 763
205 Ga0207640_10490020 3300025981 Bacteria 1021
206 Ga0207677_11401554 3300026023 Bacteria 644
207 Ga0207639_10146371 3300026041 Bacteria 1974
208 Ga0207708_10292205 3300026075 Bacteria 1323
209 Ga0207702_10092963 3300026078 Bacteria 2644
210 Ga0207648_10147560 3300026089 Bacteria 2075
211 Ga0207674_10319859 3300026116 Bacteria 1501
212 Ga0207683_10013282 3300026121 Bacteria 7021
213 Ga0207698_10109302 3300026142 Bacteria 2313
214 Ga0265337_1003753 3300028556 Bacteria 6480
215 Ga0265337_1013098 3300028556 Bacteria 2798
216 Ga0265326_10000698 3300028558 Bacteria 12443
217 Ga0265326_10007464 3300028558 Bacteria 3353
218 Ga0265326_10027996 3300028558 Bacteria 1606
219 Ga0265319_1000067 3300028563 Bacteria 82947
220 Ga0265319_1000408 3300028563 Bacteria 30993
221 Ga0265319_1002042 3300028563 Bacteria 11359
222 Ga0265319_1012536 3300028563 Bacteria 3424
223 Ga0265319_1053723 3300028563 Bacteria 1323
224 Ga0265319_1256639 3300028563 Bacteria 532
225 Ga0265334_10007750 3300028573 Bacteria 4598
226 Ga0265334_10032888 3300028573 Bacteria 2066
227 Ga0265318_10006922 3300028577 Bacteria 5170
228 Ga0265318_10012770 3300028577 Unclassified 3563
229 Ga0265318_10148189 3300028577 Unclassified 861
230 Ga0265323_10000491 3300028653 Bacteria 22283
231 Ga0265322_10000759 3300028654 Bacteria 11705
232 Ga0265322_10043357 3300028654 Bacteria 1281
233 Ga0265336_10000067 3300028666 Bacteria 93268
234 Ga0265336_10118795 3300028666 Bacteria 787
235 Ga0265338_10000126 3300028800 Bacteria 140495
236 Ga0265338_10009097 3300028800 Bacteria 11937
237 Ga0265338_10009434 3300028800 Bacteria 11631
238 Ga0265338_10011608 3300028800 Bacteria 10152
239 Ga0265338_10014199 3300028800 Bacteria 8894
240 Ga0265338_10024476 3300028800 Bacteria 6167
241 Ga0265338_10518331 3300028800 Unclassified 838
242 Ga0265338_10627927 3300028800 Bacteria 746
243 Ga0265324_10002147 3300029957 Bacteria 10356
244 Ga0265324_10008640 3300029957 Bacteria 4031
245 Ga0265324_10053614 3300029957 Bacteria 1384
246 Ga0265324_10283562 3300029957 Bacteria 563
247 Ga0265330_10000150 3300031235 Bacteria 56333
248 Ga0265332_10000306 3300031238 Bacteria 37911
249 Ga0265328_10008178 3300031239 Bacteria 4327
250 Ga0265320_10000275 3300031240 Bacteria 42230
251 Ga0265320_10005196 3300031240 Bacteria 8399
252 Ga0265320_10193903 3300031240 Unclassified 908
253 Ga0265325_10005197 3300031241 Bacteria 8087
254 Ga0265325_10123670 3300031241 Bacteria 1244
255 Ga0265329_10000181 3300031242 Bacteria 32113
256 Ga0265329_10043569 3300031242 Bacteria 1435
257 Ga0265340_10008924 3300031247 Bacteria 5401
258 Ga0265340_10029483 3300031247 Bacteria 2755
259 Ga0265339_10000097 3300031249 Bacteria 73931
260 Ga0265339_10056040 3300031249 Bacteria 2136
261 Ga0265331_10000322 3300031250 Bacteria 51785
262 Ga0265331_10193979 3300031250 Unclassified 916
263 Ga0265316_10001497 3300031344 Bacteria 25056
264 Ga0265316_10002531 3300031344 Bacteria 18899
265 Ga0265316_10221143 3300031344 Bacteria 1397
266 Ga0265313_10001271 3300031595 Bacteria 23915
267 Ga0265313_10049400 3300031595 Bacteria 2024
268 Ga0265314_10000337 3300031711 Bacteria 65738
269 Ga0265342_10000999 3300031712 Bacteria 27871
270 Ga0265342_10001401 3300031712 Bacteria 22534
271 Ga0316578_10020473 3300031728 Bacteria 3656
272 Ga0316578_10430808 3300031728 Unclassified 780
273 Ga0307415_100242864 3300032126 Bacteria 1458
274 Ga0316580_10290121 3300032139 Unclassified 508
275 Ga0373956_0585789 3300035119 Unclassified 532
276 Ga0373957_0125300 3300035120 Unclassified 1042
277 Ga0373943_0581262 3300035170 Unclassified 659
278 Ga0373943_0697530 3300035170 Bacteria 601
279 Ga0373955_0584515 3300035172 Bacteria 684
280 Ga0316574_0031411 3300035398 Bacteria 3222
281 Ga0316574_0227821 3300035398 Bacteria 1193
282 Ga0373935_0789371 3300035692 Bacteria 701
283 Ga0373933_0608401 3300035724 Bacteria 718
284 Ga0373933_0625578 3300035724 Bacteria 707
285 Ga0373933_0851959 3300035724 Unclassified 600
286 Ga0373947_1216977 3300035725 Bacteria 513
287 Ga0373937_0020040 3300036401 Bacteria 5991
288 Ga0373937_0917015 3300036401 Bacteria 825
289 Ga0316582_0224388 3300036647 Bacteria 1285
290 Ga0316584_0089118 3300036712 Bacteria 2310
291 Ga0373925_0252810 3300037068 Bacteria 1414
292 Ga0373925_1555015 3300037068 Bacteria 541
293 Ga0373925_1702713 3300037068 Unclassified 515
294 Ga0395899_0352103 3300037312 Bacteria 985
295 Ga0395899_0428366 3300037312 Bacteria 870
296 Ga0395900_0017157 3300037418 Bacteria 7389
297 Ga0395900_0108231 3300037418 Bacteria 2856
298 Ga0395900_1802112 3300037418 Unclassified 523
299 Ga0395898_0252650 3300037466 Bacteria 1681
300 Ga0395898_0565211 3300037466 Bacteria 1080
301 Ga0395898_1529388 3300037466 Bacteria 593
302 Ga0395905_0645554 3300037471 Bacteria 960
303 Ga0395901_0010671 3300038443 Bacteria 9312
304 Ga0395901_0059057 3300038443 Bacteria 3990
305 Ga0395901_1493945 3300038443 Bacteria 632
306 Ga0451791_0561320 3300041451 Bacteria 720
307 Ga0451807_0123002 3300041486 Bacteria 730
308 Ga0451807_1286079 3300041486 Bacteria 1838
309 Ga0451839_1262289 3300041496 Bacteria 500
310 Ga0451853_1143151 3300041512 Bacteria 615
311 Ga0466972_0056516 3300044658 Bacteria 1887
312 Ga0466965_0015015 3300044683 Bacteria 3674
313 Ga0466965_0135246 3300044683 Bacteria 1280
314 Ga0466966_0662914 3300044684 Bacteria 629
315 Ga0466961_0265145 3300044693 Bacteria 1053
316 Ga0466961_0314462 3300044693 Bacteria 955
317 Ga0466963_0000430 3300044694 Bacteria 19359
318 Ga0466963_0008450 3300044694 Bacteria 6170
319 Ga0466963_0008744 3300044694 Bacteria 6080
320 Ga0466963_0010043 3300044694 Bacteria 5723
321 Ga0466963_0012753 3300044694 Bacteria 5148
322 Ga0466963_0040503 3300044694 Bacteria 3053
323 Ga0466963_0051773 3300044694 Bacteria 2722
324 Ga0466963_0111939 3300044694 Unclassified 1874
325 Ga0466963_0737618 3300044694 Bacteria 695
326 Ga0466964_0006969 3300044706 Bacteria 4225
327 Ga0466964_0023847 3300044706 Unclassified 2381
328 Ga0466964_0107014 3300044706 Bacteria 1242
329 Ga0466964_0119350 3300044706 Bacteria 1187
330 Ga0466964_0121091 3300044706 Bacteria 1180
331 Ga0466964_0122446 3300044706 Bacteria 1174
332 Ga0466964_0156318 3300044706 Bacteria 1062
333 Ga0466964_0207970 3300044706 Bacteria 943
334 Ga0466964_0735132 3300044706 Bacteria 553
335 Ga0466964_0842852 3300044706 Bacteria 521
336 Ga0453684_1161235 3300044712 Bacteria 813
337 Ga0466971_0000571 3300044719 Bacteria 14575
338 Ga0466971_0015039 3300044719 Bacteria 3404
339 Ga0466971_0089392 3300044719 Bacteria 1410
340 Ga0466971_0134837 3300044719 Bacteria 1148
341 Ga0466968_0001271 3300044735 Bacteria 8983
342 Ga0466968_0014588 3300044735 Bacteria 3106
343 Ga0466968_0059896 3300044735 Archaea 1640
344 Ga0466968_0124558 3300044735 Unclassified 1168
345 Ga0466968_0661833 3300044735 Bacteria 531
346 Ga0466970_0041403 3300044765 Bacteria 2448
347 Ga0466970_0046352 3300044765 Bacteria 2315
348 Ga0466957_0001386 3300044842 Bacteria 12643
349 Ga0466957_0024346 3300044842 Bacteria 3582
350 Ga0466957_0066360 3300044842 Bacteria 2224
351 Ga0466957_0241166 3300044842 Bacteria 1199
352 Ga0466957_0799746 3300044842 Unclassified 670
353 Ga0466960_0005128 3300044901 Bacteria 5184
354 Ga0466960_0093661 3300044901 Bacteria 1536
355 Ga0466959_0004364 3300045049 Bacteria 9464
356 Ga0466959_0085927 3300045049 Bacteria 2263
357 Ga0466959_0447148 3300045049 Unclassified 876
358 Ga0451576_1302310 3300045051 Bacteria 757
359 Ga0466958_0007198 3300045836 Bacteria 6099
360 Ga0466958_0022021 3300045836 Unclassified 3728
361 Ga0466958_0065326 3300045836 Bacteria 2220
362 Ga0466958_0089702 3300045836 Bacteria 1901
363 Ga0466958_0093100 3300045836 Bacteria 1866
364 Ga0466958_0103337 3300045836 Bacteria 1774
365 Ga0466958_0246419 3300045836 Bacteria 1142
366 Ga0466967_0006144 3300045976 Bacteria 8454
367 Ga0466967_0016339 3300045976 Bacteria 5850
368 Ga0466967_0019641 3300045976 Bacteria 5439
369 Ga0466967_0022601 3300045976 Bacteria 5135
370 Ga0466967_0041398 3300045976 Bacteria 3971
371 Ga0466967_0066749 3300045976 Bacteria 3206
372 Ga0466967_0096844 3300045976 Bacteria 2692
373 Ga0466967_0180391 3300045976 Bacteria 1991
374 Ga0466967_0198086 3300045976 Bacteria 1901
375 Ga0466967_0283617 3300045976 Bacteria 1590
376 Ga0466967_0311815 3300045976 Bacteria 1515
377 Ga0466967_0503714 3300045976 Bacteria 1188
378 Ga0466967_0900358 3300045976 Bacteria 880
379 Ga0466967_1703025 3300045976 Bacteria 628
380 Ga0495592_0000125 3300046454 Bacteria 68045
381 Ga0495592_0070954 3300046454 Unclassified 2536
382 Ga0495592_0171381 3300046454 Bacteria 1486
383 Ga0495603_0005954 3300046455 Bacteria 7290
384 Ga0495603_0153756 3300046455 Bacteria 1336
385 Ga0495641_0016970 3300046461 Bacteria 3813
386 Ga0495641_0042670 3300046461 Bacteria 2100
387 Ga0495641_0142598 3300046461 Unclassified 1070
388 Ga0495641_0368857 3300046461 Bacteria 650
389 Ga0495651_0000104 3300046462 Bacteria 61716
390 Ga0495651_0002454 3300046462 Bacteria 14323
391 Ga0495653_0004604 3300046463 Bacteria 11155
392 Ga0495653_0005005 3300046463 Bacteria 10755
393 Ga0495653_0575691 3300046463 Bacteria 694
394 Ga0495653_0692850 3300046463 Bacteria 619
395 Ga0495582_0086405 3300046473 Bacteria 1745
396 Ga0495582_0215053 3300046473 Bacteria 1099
397 Ga0495582_0325359 3300046473 Unclassified 885
398 Ga0495582_0758769 3300046473 Unclassified 561
399 Ga0495605_0018697 3300046474 Bacteria 3709
400 Ga0495662_0111343 3300046476 Unclassified 1342
401 Ga0495664_0205705 3300046477 Bacteria 1192
402 Ga0495664_0282007 3300046477 Bacteria 1004
403 Ga0495664_0534164 3300046477 Bacteria 699
404 Ga0495585_0400382 3300046492 Bacteria 661
405 Ga0495594_0346948 3300046499 Bacteria 845
406 Ga0495596_0053900 3300046500 Bacteria 1573
407 Ga0495607_0019154 3300046501 Bacteria 4352
408 Ga0495608_0000595 3300046511 Bacteria 24865
409 Ga0495608_0017819 3300046511 Bacteria 4909
410 Ga0495608_0055966 3300046511 Unclassified 2606
411 Ga0495618_0006629 3300046514 Bacteria 7016
412 Ga0495618_0161361 3300046514 Unclassified 1429
413 Ga0495628_0000040 3300046516 Bacteria 104506
414 Ga0495628_0000132 3300046516 Bacteria 63426
415 Ga0495628_0040955 3300046516 Bacteria 3698
416 Ga0495628_0312062 3300046516 Unclassified 1162
417 Ga0495630_0028971 3300046517 Bacteria 4115
418 Ga0495630_0080084 3300046517 Bacteria 2464
419 Ga0495630_0223759 3300046517 Unclassified 1437
420 Ga0495630_0226861 3300046517 Bacteria 1426
421 Ga0495631_0128527 3300046518 Bacteria 1089
422 Ga0495637_0262360 3300046520 Bacteria 620
423 Ga0495644_0003396 3300046523 Bacteria 6296
424 Ga0495652_0000298 3300046529 Bacteria 59074
425 Ga0495652_0051510 3300046529 Unclassified 3515
426 Ga0495652_0126873 3300046529 Bacteria 2026
427 Ga0495652_0150585 3300046529 Bacteria 1818
428 Ga0495640_0044854 3300046533 Bacteria 3071
429 Ga0495640_0400325 3300046533 Bacteria 843
430 Ga0495586_0028540 3300046535 Bacteria 2985
431 Ga0495586_0144077 3300046535 Unclassified 1338
432 Ga0495587_0000212 3300046536 Bacteria 43340
433 Ga0495587_0039869 3300046536 Unclassified 2809
434 Ga0495645_0000035 3300046543 Bacteria 102305
435 Ga0495645_0240680 3300046543 Bacteria 1207
436 Ga0495645_0403540 3300046543 Unclassified 870
437 Ga0495633_0085483 3300046558 Bacteria 1467
438 Ga0495667_0084109 3300046559 Bacteria 2066
439 Ga0495667_0151715 3300046559 Unclassified 1492
440 Ga0495667_0279664 3300046559 Unclassified 1059
441 Ga0495656_0003461 3300046615 Bacteria 5338
442 Ga0495634_0093851 3300046642 Bacteria 1945
443 Ga0495611_0219422 3300046648 Bacteria 885
444 Ga0495635_0039927 3300046663 Unclassified 3245
445 Ga0495635_0246121 3300046663 Bacteria 1206
446 Ga0495659_0011040 3300046664 Bacteria 2909
447 Ga0495657_0002891 3300046675 Bacteria 14255
448 Ga0495657_0046888 3300046675 Unclassified 2924
449 Ga0495657_0060447 3300046675 Bacteria 2510
450 Ga0495657_0122223 3300046675 Bacteria 1639
451 Ga0495657_0145568 3300046675 Bacteria 1474
452 Ga0495599_0000009 3300046678 Bacteria 217299
453 Ga0495599_0007227 3300046678 Bacteria 6728
454 Ga0495599_0520074 3300046678 Bacteria 699
455 Ga0495623_0001465 3300046679 Bacteria 15981
456 Ga0495623_0216639 3300046679 Bacteria 1093
457 Ga0495646_0006560 3300046680 Bacteria 7385
458 Ga0495646_0342497 3300046680 Bacteria 784
459 Ga0495647_0042402 3300046681 Bacteria 1737
460 Ga0495647_0088988 3300046681 Bacteria 1263
461 Ga0495658_0012076 3300046683 Bacteria 4363
462 Ga0495658_0111163 3300046683 Bacteria 1648
463 Ga0495669_0562664 3300046684 Bacteria 555
464 Ga0495613_0017635 3300046689 Bacteria 5316
465 Ga0495613_0084261 3300046689 Bacteria 2308
466 Ga0495624_0024201 3300046690 Bacteria 3997
467 Ga0495589_0229501 3300046794 Bacteria 871
468 Ga0495600_0459409 3300046809 Bacteria 786
469 Ga0495581_0015527 3300047315 Bacteria 4421
470 Ga0495604_0000120 3300047317 Bacteria 66462
471 Ga0495604_0254492 3300047317 Bacteria 1196
472 Ga0495604_0985894 3300047317 Bacteria 522
473 Ga0495674_0087891 3300047319 Bacteria 2659
474 Ga0495674_0113279 3300047319 Unclassified 2297
475 Ga0495674_0399764 3300047319 Unclassified 1109
476 Ga0495676_0066924 3300047321 Bacteria 2781
477 Ga0495676_0333475 3300047321 Unclassified 1017
478 Ga0495676_0589648 3300047321 Bacteria 724
479 Ga0495676_0856271 3300047321 Bacteria 583
480 Ga0495676_0935647 3300047321 Bacteria 554
481 Ga0495676_0936631 3300047321 Bacteria 554
482 Ga0495680_0008617 3300047322 Bacteria 9258
483 Ga0495680_0013033 3300047322 Bacteria 7272
484 Ga0495680_0014726 3300047322 Bacteria 6761
485 Ga0495683_0309248 3300047323 Bacteria 677
486 Ga0495675_0000137 3300047444 Bacteria 50947
487 Ga0495684_0018258 3300047471 Bacteria 5405
488 Ga0495684_0917614 3300047471 Bacteria 563
489 Ga0495593_0220071 3300047673 Bacteria 953
490 Ga0495602_0001635 3300048088 Bacteria 22289
491 Ga0495602_0055163 3300048088 Unclassified 3501
492 Ga0496101_0115934 3300048904 Unclassified 2021
493 Ga0496101_0122749 3300048904 Bacteria 1965
494 Ga0496101_0173891 3300048904 Bacteria 1656
495 Ga0496101_0561989 3300048904 Bacteria 902
496 Ga0496102_0382910 3300048905 Bacteria 1324
497 Ga0496104_0008275 3300048907 Bacteria 9236
498 Ga0496104_0012649 3300048907 Bacteria 7598
499 Ga0496104_0127077 3300048907 Bacteria 2448
500 Ga0496104_0157469 3300048907 Bacteria 2179
501 Ga0496105_0004281 3300048908 Bacteria 10741
502 Ga0496105_0004966 3300048908 Bacteria 10056
503 Ga0496105_0021299 3300048908 Bacteria 5245
504 Ga0496105_0086357 3300048908 Bacteria 2593
505 Ga0496106_0184562 3300048909 Unclassified 1657
506 Ga0496106_0396019 3300048909 Bacteria 1110
507 Ga0496107_0056669 3300048910 Bacteria 2832
508 Ga0496107_0089025 3300048910 Bacteria 2254
509 Ga0496107_0190218 3300048910 Bacteria 1525
510 Ga0496108_0005783 3300048911 Bacteria 10018
511 Ga0496108_0008784 3300048911 Bacteria 8191
512 Ga0496108_0356810 3300048911 Bacteria 1276
513 Ga0496108_0411891 3300048911 Bacteria 1180
514 Ga0496109_0012652 3300048912 Bacteria 7289
515 Ga0496109_0055216 3300048912 Bacteria 3623
516 Ga0496109_0068252 3300048912 Bacteria 3259
517 Ga0496109_0280886 3300048912 Bacteria 1569
518 Ga0496109_0424163 3300048912 Bacteria 1256
519 Ga0496109_0550347 3300048912 Bacteria 1088
520 Ga0496109_0833664 3300048912 Unclassified 860
521 Ga0496109_0840038 3300048912 Bacteria 856
522 Ga0496110_0208367 3300048913 Bacteria 1777
523 Ga0496110_0666786 3300048913 Bacteria 940
524 Ga0496111_0049379 3300048914 Bacteria 3034
525 Ga0496111_0067617 3300048914 Bacteria 2596
526 Ga0496111_0982622 3300048914 Bacteria 605
527 Ga0496112_0176334 3300048915 Bacteria 2102
528 Ga0496112_0296151 3300048915 Bacteria 1564
529 Ga0496112_0598514 3300048915 Bacteria 1034
530 Ga0496113_0019636 3300048916 Bacteria 4731
531 Ga0496113_0120797 3300048916 Bacteria 2048
532 Ga0496113_0153644 3300048916 Bacteria 1817
533 Ga0496113_0386660 3300048916 Bacteria 1123
534 Ga0496113_0783262 3300048916 Bacteria 758
535 Ga0496114_0122336 3300048917 Bacteria 2239
536 Ga0496114_0231967 3300048917 Bacteria 1622
537 Ga0496115_0035995 3300048918 Bacteria 3918
538 Ga0496115_0041338 3300048918 Bacteria 3669
539 Ga0496115_0088486 3300048918 Bacteria 2528
540 Ga0496115_0478835 3300048918 Bacteria 1003
541 Ga0501040_0375131 3300049576 Bacteria 1020
542 Ga0501040_1054099 3300049576 Bacteria 590
543 Ga0501047_0073280 3300049581 Bacteria 3297
544 Ga0501067_0002687 3300049583 Bacteria 9820
545 Ga0501067_0020950 3300049583 Bacteria 3617
546 Ga0501067_0031748 3300049583 Bacteria 2931
547 Ga0501067_0060497 3300049583 Unclassified 2096
548 Ga0501068_0018353 3300049584 Bacteria 4051
549 Ga0501068_0328462 3300049584 Bacteria 981
550 Ga0501069_0001737 3300049585 Bacteria 10870
551 Ga0501069_0009778 3300049585 Bacteria 5069
552 Ga0501069_0065803 3300049585 Bacteria 2027
553 Ga0501070_0138846 3300049586 Bacteria 2007
554 Ga0501070_1391165 3300049586 Unclassified 533
555 Ga0501071_1019015 3300049587 Bacteria 639
556 Ga0501072_0255024 3300049588 Bacteria 1397
557 Ga0501073_1278461 3300049589 Bacteria 503
558 Ga0501075_0288237 3300049591 Bacteria 1251
559 Ga0501076_0182966 3300049592 Bacteria 1709
560 Ga0501080_0589336 3300049742 Bacteria 988
561 Ga0501080_1692176 3300049742 Unclassified 534
562 nmdc:mga00v17_51010_c1 3300050491 Bacteria 2515
563 nmdc:mga0rr50_505101_c1 3300050513 Bacteria 1028
564 Ga0495601_0000983 3300053077 Bacteria 15574
565 Ga0495601_0104266 3300053077 Bacteria 1833
566 Ga0495601_0106827 3300053077 Unclassified 1810
567 Ga0495601_0398422 3300053077 Bacteria 892
568 Ga0495612_0084162 3300053078 Bacteria 1339
569 Ga0495612_0358996 3300053078 Bacteria 658
570 Ga0495595_0002532 3300053084 Bacteria 7168
571 Ga0495595_0008406 3300053084 Bacteria 4233
572 Ga0495619_0003772 3300053085 Bacteria 9744
573 Ga0495619_0025735 3300053085 Bacteria 3781
574 Ga0495619_0443274 3300053085 Bacteria 895
575 Ga0495619_0651618 3300053085 Bacteria 718
576 Ga0495619_0879457 3300053085 Unclassified 603
577 Ga0495619_0915616 3300053085 Bacteria 589
578 Ga0501084_1303273 3300054114 Bacteria 609
579 Ga0501082_1692672 3300060353 Unclassified 552
580 Ga0466962_0004435 3300061719 Bacteria 6725
581 Ga0466962_0626642 3300061719 Bacteria 549
582 Ga0530510_0015632 3300061734 Bacteria 5363
583 Ga0530510_0183466 3300061734 Bacteria 1552
584 Ga0530510_0405787 3300061734 Bacteria 1028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100033009 Ga0075435_1000330094 98
2 3300028577 Ga0265318_10012770 Ga0265318_100127703 99
3 3300028556 Ga0265337_1003753 Ga0265337_10037531 108
4 3300028558 Ga0265326_10027996 Ga0265326_100279961 108
5 3300028563 Ga0265319_1002042 Ga0265319_10020425 108
6 3300028573 Ga0265334_10032888 Ga0265334_100328882 108
7 3300028800 Ga0265338_10011608 Ga0265338_100116085 108
8 3300005327 Ga0070658_10025348 Ga0070658_100253485 111
9 3300005329 Ga0070683_100056584 Ga0070683_1000565844 111
10 3300005530 Ga0070679_100301259 Ga0070679_1003012592 111
11 3300005841 Ga0068863_100064638 Ga0068863_1000646384 111
12 3300009093 Ga0105240_10047426 Ga0105240_100474262 111
13 3300009098 Ga0105245_10259688 Ga0105245_102596883 111
14 3300013104 Ga0157370_10064913 Ga0157370_100649133 111
15 3300014497 Ga0182008_10451297 Ga0182008_104512971 111
16 3300025909 Ga0207705_10051423 Ga0207705_100514233 111
17 3300025921 Ga0207652_11714794 Ga0207652_117147942 111
18 3300025944 Ga0207661_10085383 Ga0207661_100853833 111
19 3300028556 Ga0265337_1013098 Ga0265337_10130983 111
20 3300028558 Ga0265326_10000698 Ga0265326_100006987 111
21 3300028558 Ga0265326_10007464 Ga0265326_100074645 111
22 3300028563 Ga0265319_1000067 Ga0265319_100006721 111
23 3300028563 Ga0265319_1000408 Ga0265319_100040823 111
24 3300028563 Ga0265319_1012536 Ga0265319_10125363 111
25 3300028563 Ga0265319_1053723 Ga0265319_10537232 111
26 3300028573 Ga0265334_10007750 Ga0265334_100077503 111
27 3300028577 Ga0265318_10006922 Ga0265318_100069223 111
28 3300028577 Ga0265318_10148189 Ga0265318_101481892 111
29 3300028653 Ga0265323_10000491 Ga0265323_1000049122 111
30 3300028654 Ga0265322_10000759 Ga0265322_100007594 111
31 3300028666 Ga0265336_10000067 Ga0265336_1000006720 111
32 3300028666 Ga0265336_10118795 Ga0265336_101187952 111
33 3300028800 Ga0265338_10000126 Ga0265338_1000012676 111
34 3300028800 Ga0265338_10009097 Ga0265338_100090973 111
35 3300028800 Ga0265338_10009434 Ga0265338_100094348 111
36 3300028800 Ga0265338_10014199 Ga0265338_100141993 111
37 3300029957 Ga0265324_10002147 Ga0265324_100021478 111
38 3300029957 Ga0265324_10008640 Ga0265324_100086401 111
39 3300029957 Ga0265324_10053614 Ga0265324_100536143 111
40 3300031235 Ga0265330_10000150 Ga0265330_1000015033 111
41 3300031238 Ga0265332_10000306 Ga0265332_1000030624 111
42 3300031239 Ga0265328_10008178 Ga0265328_100081785 111
43 3300031240 Ga0265320_10000275 Ga0265320_1000027523 111
44 3300031240 Ga0265320_10005196 Ga0265320_100051968 111
45 3300031241 Ga0265325_10005197 Ga0265325_1000519710 111
46 3300031241 Ga0265325_10123670 Ga0265325_101236702 111
47 3300031242 Ga0265329_10000181 Ga0265329_1000018121 111
48 3300031247 Ga0265340_10008924 Ga0265340_100089243 111
49 3300031247 Ga0265340_10029483 Ga0265340_100294833 111
50 3300031249 Ga0265339_10000097 Ga0265339_1000009723 111
51 3300031249 Ga0265339_10056040 Ga0265339_100560402 111
52 3300031250 Ga0265331_10000322 Ga0265331_1000032232 111
53 3300031250 Ga0265331_10193979 Ga0265331_101939792 111
54 3300031344 Ga0265316_10001497 Ga0265316_1000149722 111
55 3300031344 Ga0265316_10002531 Ga0265316_100025317 111
56 3300031595 Ga0265313_10001271 Ga0265313_100012718 111
57 3300031595 Ga0265313_10049400 Ga0265313_100494003 111
58 3300031711 Ga0265314_10000337 Ga0265314_1000033722 111
59 3300031712 Ga0265342_10000999 Ga0265342_1000099910 111
60 3300031712 Ga0265342_10001401 Ga0265342_1000140112 111
61 3300035398 Ga0316574_0227821 Ga0316574_0227821_340_690 111
62 3300037312 Ga0395899_0428366 Ga0395899_0428366_286_624 111
63 3300037418 Ga0395900_0017157 Ga0395900_0017157_91_429 111
64 3300037466 Ga0395898_0252650 Ga0395898_0252650_1174_1512 111
65 3300038443 Ga0395901_0010671 Ga0395901_0010671_7679_8017 111
66 3300048909 Ga0496106_0184562 Ga0496106_0184562_738_1073 111
67 3300048918 Ga0496115_0478835 Ga0496115_0478835_134_472 111
68 3300049583 Ga0501067_0002687 Ga0501067_0002687_5894_6241 111
69 3300049583 Ga0501067_0031748 Ga0501067_0031748_1107_1442 111
70 3300049583 Ga0501067_0060497 Ga0501067_0060497_1344_1679 111
71 3300049584 Ga0501068_0018353 Ga0501068_0018353_1362_1697 111
72 3300049585 Ga0501069_0001737 Ga0501069_0001737_5778_6125 111
73 3300049585 Ga0501069_0065803 Ga0501069_0065803_682_1017 111
74 3300049586 Ga0501070_0138846 Ga0501070_0138846_1566_1913 111
75 3300061734 Ga0530510_0015632 Ga0530510_0015632_2771_3118 111
76 3300061734 Ga0530510_0405787 Ga0530510_0405787_288_623 111
77 3300002077 JGI24744J21845_10022103 JGI24744J21845_100221032 112
78 3300003323 rootH1_10082901 rootH1_100829013 112
79 3300005327 Ga0070658_10034961 Ga0070658_100349616 112
80 3300005327 Ga0070658_11078098 Ga0070658_110780981 112
81 3300005329 Ga0070683_100020638 Ga0070683_1000206384 112
82 3300005336 Ga0070680_100046229 Ga0070680_1000462295 112
83 3300005337 Ga0070682_100111523 Ga0070682_1001115233 112
84 3300005339 Ga0070660_100048434 Ga0070660_1000484345 112
85 3300005341 Ga0070691_10132846 Ga0070691_101328463 112
86 3300005344 Ga0070661_100145927 Ga0070661_1001459272 112
87 3300005366 Ga0070659_100053595 Ga0070659_1000535952 112
88 3300005435 Ga0070714_100001084 Ga0070714_10000108418 112
89 3300005435 Ga0070714_100122887 Ga0070714_1001228874 112
90 3300005435 Ga0070714_100809736 Ga0070714_1008097362 112
91 3300005436 Ga0070713_100174140 Ga0070713_1001741403 112
92 3300005437 Ga0070710_10002369 Ga0070710_100023699 112
93 3300005437 Ga0070710_10561056 Ga0070710_105610562 112
94 3300005456 Ga0070678_101198291 Ga0070678_1011982912 112
95 3300005458 Ga0070681_10105612 Ga0070681_101056123 112
96 3300005467 Ga0070706_101522081 Ga0070706_1015220811 112
97 3300005530 Ga0070679_100340311 Ga0070679_1003403112 112
98 3300005535 Ga0070684_100021102 Ga0070684_1000211024 112
99 3300005535 Ga0070684_100192086 Ga0070684_1001920862 112
100 3300005539 Ga0068853_102014412 Ga0068853_1020144121 112
101 3300005545 Ga0070695_100932745 Ga0070695_1009327452 112
102 3300005547 Ga0070693_100118814 Ga0070693_1001188142 112
103 3300005563 Ga0068855_100046564 Ga0068855_1000465646 112
104 3300005577 Ga0068857_100785189 Ga0068857_1007851892 112
105 3300005614 Ga0068856_100063637 Ga0068856_1000636373 112
106 3300005614 Ga0068856_100195891 Ga0068856_1001958912 112
107 3300005615 Ga0070702_100835118 Ga0070702_1008351182 112
108 3300005616 Ga0068852_100218638 Ga0068852_1002186383 112
109 3300006028 Ga0070717_10008478 Ga0070717_100084785 112
110 3300006028 Ga0070717_10022452 Ga0070717_100224525 112
111 3300006028 Ga0070717_10033324 Ga0070717_100333243 112
112 3300006173 Ga0070716_100166880 Ga0070716_1001668803 112
113 3300006175 Ga0070712_100071321 Ga0070712_1000713213 112
114 3300006175 Ga0070712_101219126 Ga0070712_1012191261 112
115 3300006881 Ga0068865_100725637 Ga0068865_1007256372 112
116 3300006914 Ga0075436_100252464 Ga0075436_1002524642 112
117 3300009098 Ga0105245_10504591 Ga0105245_105045912 112
118 3300009551 Ga0105238_10078199 Ga0105238_100781995 112
119 3300009551 Ga0105238_12429870 Ga0105238_124298702 112
120 3300010375 Ga0105239_10362992 Ga0105239_103629923 112
121 3300013104 Ga0157370_11602700 Ga0157370_116027002 112
122 3300013105 Ga0157369_10057858 Ga0157369_100578583 112
123 3300013105 Ga0157369_10424013 Ga0157369_104240132 112
124 3300013296 Ga0157374_10251669 Ga0157374_102516694 112
125 3300013296 Ga0157374_11161348 Ga0157374_111613481 112
126 3300013307 Ga0157372_10174350 Ga0157372_101743502 112
127 3300013307 Ga0157372_10683535 Ga0157372_106835353 112
128 3300014497 Ga0182008_10240795 Ga0182008_102407952 112
129 3300014745 Ga0157377_10644330 Ga0157377_106443302 112
130 3300014969 Ga0157376_10100171 Ga0157376_101001713 112
131 3300015262 Ga0182007_10215731 Ga0182007_102157311 112
132 3300017792 Ga0163161_11544454 Ga0163161_115444542 112
133 3300020070 Ga0206356_11138035 Ga0206356_111380352 112
134 3300025898 Ga0207692_10094975 Ga0207692_100949753 112
135 3300025898 Ga0207692_10135079 Ga0207692_101350792 112
136 3300025906 Ga0207699_10388100 Ga0207699_103881002 112
137 3300025906 Ga0207699_10422622 Ga0207699_104226222 112
138 3300025909 Ga0207705_10194384 Ga0207705_101943844 112
139 3300025912 Ga0207707_10271357 Ga0207707_102713573 112
140 3300025915 Ga0207693_10008397 Ga0207693_100083974 112
141 3300025916 Ga0207663_10013008 Ga0207663_100130083 112
142 3300025917 Ga0207660_10183966 Ga0207660_101839662 112
143 3300025919 Ga0207657_10014505 Ga0207657_100145055 112
144 3300025920 Ga0207649_10212791 Ga0207649_102127912 112
145 3300025921 Ga0207652_10536487 Ga0207652_105364872 112
146 3300025924 Ga0207694_10102522 Ga0207694_101025223 112
147 3300025928 Ga0207700_10005417 Ga0207700_100054178 112
148 3300025929 Ga0207664_10192035 Ga0207664_101920352 112
149 3300025929 Ga0207664_10393757 Ga0207664_103937573 112
150 3300025932 Ga0207690_10066178 Ga0207690_100661784 112
151 3300025938 Ga0207704_10399442 Ga0207704_103994422 112
152 3300025939 Ga0207665_10081749 Ga0207665_100817494 112
153 3300025944 Ga0207661_10021882 Ga0207661_100218826 112
154 3300025945 Ga0207679_10734249 Ga0207679_107342492 112
155 3300025949 Ga0207667_10571068 Ga0207667_105710683 112
156 3300026078 Ga0207702_10092963 Ga0207702_100929634 112
157 3300026116 Ga0207674_10319859 Ga0207674_103198592 112
158 3300028563 Ga0265319_1256639 Ga0265319_12566392 112
159 3300028654 Ga0265322_10043357 Ga0265322_100433571 112
160 3300029957 Ga0265324_10283562 Ga0265324_102835621 112
161 3300031728 Ga0316578_10430808 Ga0316578_104308082 112
162 3300035119 Ga0373956_0585789 Ga0373956_0585789_39_377 112
163 3300035120 Ga0373957_0125300 Ga0373957_0125300_580_918 112
164 3300035170 Ga0373943_0697530 Ga0373943_0697530_102_440 112
165 3300035172 Ga0373955_0584515 Ga0373955_0584515_175_513 112
166 3300035724 Ga0373933_0625578 Ga0373933_0625578_17_355 112
167 3300036401 Ga0373937_0020040 Ga0373937_0020040_2924_3262 112
168 3300037068 Ga0373925_0252810 Ga0373925_0252810_921_1265 112
169 3300037418 Ga0395900_1802112 Ga0395900_1802112_127_465 112
170 3300037466 Ga0395898_0565211 Ga0395898_0565211_169_507 112
171 3300037466 Ga0395898_1529388 Ga0395898_1529388_138_476 112
172 3300041451 Ga0451791_0561320 Ga0451791_0561320_134_481 112
173 3300041486 Ga0451807_0123002 Ga0451807_0123002_56_403 112
174 3300041496 Ga0451839_1262289 Ga0451839_1262289_66_404 112
175 3300041512 Ga0451853_1143151 Ga0451853_1143151_105_452 112
176 3300044658 Ga0466972_0056516 Ga0466972_0056516_363_701 112
177 3300044683 Ga0466965_0015015 Ga0466965_0015015_270_608 112
178 3300044683 Ga0466965_0135246 Ga0466965_0135246_151_489 112
179 3300044684 Ga0466966_0662914 Ga0466966_0662914_192_530 112
180 3300044693 Ga0466961_0265145 Ga0466961_0265145_223_561 112
181 3300044693 Ga0466961_0314462 Ga0466961_0314462_514_852 112
182 3300044694 Ga0466963_0000430 Ga0466963_0000430_10933_11271 112
183 3300044694 Ga0466963_0008450 Ga0466963_0008450_863_1201 112
184 3300044694 Ga0466963_0008744 Ga0466963_0008744_1212_1550 112
185 3300044694 Ga0466963_0010043 Ga0466963_0010043_2729_3067 112
186 3300044694 Ga0466963_0012753 Ga0466963_0012753_2572_2910 112
187 3300044694 Ga0466963_0040503 Ga0466963_0040503_398_736 112
188 3300044694 Ga0466963_0051773 Ga0466963_0051773_2228_2566 112
189 3300044694 Ga0466963_0111939 Ga0466963_0111939_1477_1815 112
190 3300044706 Ga0466964_0006969 Ga0466964_0006969_1199_1537 112
191 3300044706 Ga0466964_0023847 Ga0466964_0023847_288_626 112
192 3300044706 Ga0466964_0107014 Ga0466964_0107014_504_842 112
193 3300044706 Ga0466964_0119350 Ga0466964_0119350_127_465 112
194 3300044706 Ga0466964_0121091 Ga0466964_0121091_408_755 112
195 3300044706 Ga0466964_0156318 Ga0466964_0156318_280_618 112
196 3300044706 Ga0466964_0207970 Ga0466964_0207970_120_458 112
197 3300044706 Ga0466964_0735132 Ga0466964_0735132_22_360 112
198 3300044712 Ga0453684_1161235 Ga0453684_1161235_311_649 112
199 3300044719 Ga0466971_0000571 Ga0466971_0000571_7198_7536 112
200 3300044719 Ga0466971_0015039 Ga0466971_0015039_2114_2452 112
201 3300044719 Ga0466971_0089392 Ga0466971_0089392_996_1334 112
202 3300044719 Ga0466971_0134837 Ga0466971_0134837_106_444 112
203 3300044735 Ga0466968_0001271 Ga0466968_0001271_5874_6212 112
204 3300044735 Ga0466968_0014588 Ga0466968_0014588_2504_2842 112
205 3300044735 Ga0466968_0059896 Ga0466968_0059896_773_1111 112
206 3300044735 Ga0466968_0124558 Ga0466968_0124558_794_1132 112
207 3300044735 Ga0466968_0661833 Ga0466968_0661833_68_406 112
208 3300044765 Ga0466970_0041403 Ga0466970_0041403_77_415 112
209 3300044765 Ga0466970_0046352 Ga0466970_0046352_1217_1555 112
210 3300044842 Ga0466957_0001386 Ga0466957_0001386_743_1081 112
211 3300044842 Ga0466957_0024346 Ga0466957_0024346_1162_1500 112
212 3300044842 Ga0466957_0066360 Ga0466957_0066360_592_930 112
213 3300044842 Ga0466957_0241166 Ga0466957_0241166_728_1066 112
214 3300044842 Ga0466957_0799746 Ga0466957_0799746_14_352 112
215 3300044901 Ga0466960_0005128 Ga0466960_0005128_1603_1941 112
216 3300044901 Ga0466960_0093661 Ga0466960_0093661_959_1297 112
217 3300045049 Ga0466959_0004364 Ga0466959_0004364_7512_7850 112
218 3300045049 Ga0466959_0085927 Ga0466959_0085927_274_612 112
219 3300045049 Ga0466959_0447148 Ga0466959_0447148_179_517 112
220 3300045836 Ga0466958_0007198 Ga0466958_0007198_4346_4684 112
221 3300045836 Ga0466958_0022021 Ga0466958_0022021_1148_1486 112
222 3300045836 Ga0466958_0065326 Ga0466958_0065326_604_942 112
223 3300045836 Ga0466958_0089702 Ga0466958_0089702_1148_1486 112
224 3300045836 Ga0466958_0093100 Ga0466958_0093100_317_655 112
225 3300045976 Ga0466967_0006144 Ga0466967_0006144_4466_4804 112
226 3300045976 Ga0466967_0016339 Ga0466967_0016339_3346_3684 112
227 3300045976 Ga0466967_0019641 Ga0466967_0019641_310_648 112
228 3300045976 Ga0466967_0022601 Ga0466967_0022601_2348_2686 112
229 3300045976 Ga0466967_0041398 Ga0466967_0041398_2596_2934 112
230 3300045976 Ga0466967_0096844 Ga0466967_0096844_570_908 112
231 3300045976 Ga0466967_0180391 Ga0466967_0180391_441_779 112
232 3300045976 Ga0466967_0311815 Ga0466967_0311815_1142_1480 112
233 3300045976 Ga0466967_0503714 Ga0466967_0503714_132_470 112
234 3300046454 Ga0495592_0000125 Ga0495592_0000125_60816_61154 112
235 3300046454 Ga0495592_0070954 Ga0495592_0070954_1436_1774 112
236 3300046454 Ga0495592_0171381 Ga0495592_0171381_941_1279 112
237 3300046455 Ga0495603_0005954 Ga0495603_0005954_5122_5463 112
238 3300046455 Ga0495603_0153756 Ga0495603_0153756_794_1132 112
239 3300046461 Ga0495641_0016970 Ga0495641_0016970_671_1012 112
240 3300046461 Ga0495641_0042670 Ga0495641_0042670_442_780 112
241 3300046461 Ga0495641_0368857 Ga0495641_0368857_177_515 112
242 3300046462 Ga0495651_0000104 Ga0495651_0000104_10994_11332 112
243 3300046462 Ga0495651_0002454 Ga0495651_0002454_8015_8353 112
244 3300046463 Ga0495653_0004604 Ga0495653_0004604_5760_6098 112
245 3300046463 Ga0495653_0005005 Ga0495653_0005005_3472_3810 112
246 3300046463 Ga0495653_0575691 Ga0495653_0575691_281_619 112
247 3300046463 Ga0495653_0692850 Ga0495653_0692850_178_516 112
248 3300046473 Ga0495582_0086405 Ga0495582_0086405_662_1003 112
249 3300046473 Ga0495582_0215053 Ga0495582_0215053_26_364 112
250 3300046473 Ga0495582_0325359 Ga0495582_0325359_84_428 112
251 3300046474 Ga0495605_0018697 Ga0495605_0018697_175_513 112
252 3300046476 Ga0495662_0111343 Ga0495662_0111343_972_1310 112
253 3300046477 Ga0495664_0205705 Ga0495664_0205705_472_810 112
254 3300046477 Ga0495664_0534164 Ga0495664_0534164_92_430 112
255 3300046492 Ga0495585_0400382 Ga0495585_0400382_131_469 112
256 3300046499 Ga0495594_0346948 Ga0495594_0346948_27_365 112
257 3300046500 Ga0495596_0053900 Ga0495596_0053900_312_650 112
258 3300046501 Ga0495607_0019154 Ga0495607_0019154_235_573 112
259 3300046511 Ga0495608_0000595 Ga0495608_0000595_10558_10896 112
260 3300046511 Ga0495608_0017819 Ga0495608_0017819_3421_3759 112
261 3300046511 Ga0495608_0055966 Ga0495608_0055966_770_1108 112
262 3300046514 Ga0495618_0006629 Ga0495618_0006629_3609_3947 112
263 3300046514 Ga0495618_0161361 Ga0495618_0161361_73_411 112
264 3300046516 Ga0495628_0000040 Ga0495628_0000040_30351_30689 112
265 3300046516 Ga0495628_0040955 Ga0495628_0040955_168_506 112
266 3300046516 Ga0495628_0312062 Ga0495628_0312062_692_1030 112
267 3300046517 Ga0495630_0028971 Ga0495630_0028971_3347_3685 112
268 3300046517 Ga0495630_0226861 Ga0495630_0226861_375_713 112
269 3300046518 Ga0495631_0128527 Ga0495631_0128527_127_465 112
270 3300046520 Ga0495637_0262360 Ga0495637_0262360_44_382 112
271 3300046523 Ga0495644_0003396 Ga0495644_0003396_4803_5141 112
272 3300046529 Ga0495652_0000298 Ga0495652_0000298_40378_40716 112
273 3300046529 Ga0495652_0051510 Ga0495652_0051510_2196_2534 112
274 3300046529 Ga0495652_0126873 Ga0495652_0126873_901_1239 112
275 3300046529 Ga0495652_0150585 Ga0495652_0150585_136_474 112
276 3300046533 Ga0495640_0044854 Ga0495640_0044854_476_814 112
277 3300046533 Ga0495640_0400325 Ga0495640_0400325_364_702 112
278 3300046535 Ga0495586_0028540 Ga0495586_0028540_638_976 112
279 3300046536 Ga0495587_0000212 Ga0495587_0000212_38239_38577 112
280 3300046536 Ga0495587_0039869 Ga0495587_0039869_2137_2475 112
281 3300046543 Ga0495645_0000035 Ga0495645_0000035_7549_7887 112
282 3300046543 Ga0495645_0240680 Ga0495645_0240680_533_871 112
283 3300046543 Ga0495645_0403540 Ga0495645_0403540_112_450 112
284 3300046558 Ga0495633_0085483 Ga0495633_0085483_980_1318 112
285 3300046559 Ga0495667_0084109 Ga0495667_0084109_1393_1731 112
286 3300046559 Ga0495667_0151715 Ga0495667_0151715_472_810 112
287 3300046559 Ga0495667_0279664 Ga0495667_0279664_65_403 112
288 3300046615 Ga0495656_0003461 Ga0495656_0003461_94_432 112
289 3300046642 Ga0495634_0093851 Ga0495634_0093851_1324_1662 112
290 3300046648 Ga0495611_0219422 Ga0495611_0219422_401_739 112
291 3300046663 Ga0495635_0039927 Ga0495635_0039927_2094_2432 112
292 3300046663 Ga0495635_0246121 Ga0495635_0246121_808_1146 112
293 3300046664 Ga0495659_0011040 Ga0495659_0011040_1630_1968 112
294 3300046675 Ga0495657_0002891 Ga0495657_0002891_2898_3236 112
295 3300046675 Ga0495657_0046888 Ga0495657_0046888_1511_1849 112
296 3300046675 Ga0495657_0060447 Ga0495657_0060447_117_455 112
297 3300046675 Ga0495657_0122223 Ga0495657_0122223_288_626 112
298 3300046675 Ga0495657_0145568 Ga0495657_0145568_804_1142 112
299 3300046678 Ga0495599_0000009 Ga0495599_0000009_18729_19067 112
300 3300046678 Ga0495599_0007227 Ga0495599_0007227_244_582 112
301 3300046678 Ga0495599_0520074 Ga0495599_0520074_148_486 112
302 3300046679 Ga0495623_0001465 Ga0495623_0001465_4170_4508 112
303 3300046679 Ga0495623_0216639 Ga0495623_0216639_184_522 112
304 3300046680 Ga0495646_0006560 Ga0495646_0006560_4201_4539 112
305 3300046680 Ga0495646_0342497 Ga0495646_0342497_319_657 112
306 3300046681 Ga0495647_0042402 Ga0495647_0042402_806_1144 112
307 3300046681 Ga0495647_0088988 Ga0495647_0088988_729_1067 112
308 3300046683 Ga0495658_0012076 Ga0495658_0012076_553_891 112
309 3300046683 Ga0495658_0111163 Ga0495658_0111163_573_911 112
310 3300046684 Ga0495669_0562664 Ga0495669_0562664_26_364 112
311 3300046689 Ga0495613_0017635 Ga0495613_0017635_433_771 112
312 3300046689 Ga0495613_0084261 Ga0495613_0084261_603_941 112
313 3300046690 Ga0495624_0024201 Ga0495624_0024201_2682_3020 112
314 3300046794 Ga0495589_0229501 Ga0495589_0229501_116_454 112
315 3300046809 Ga0495600_0459409 Ga0495600_0459409_336_674 112
316 3300047315 Ga0495581_0015527 Ga0495581_0015527_1416_1754 112
317 3300047317 Ga0495604_0000120 Ga0495604_0000120_6512_6850 112
318 3300047317 Ga0495604_0254492 Ga0495604_0254492_423_761 112
319 3300047319 Ga0495674_0087891 Ga0495674_0087891_2105_2443 112
320 3300047319 Ga0495674_0113279 Ga0495674_0113279_1432_1770 112
321 3300047319 Ga0495674_0399764 Ga0495674_0399764_125_463 112
322 3300047321 Ga0495676_0066924 Ga0495676_0066924_1094_1432 112
323 3300047321 Ga0495676_0333475 Ga0495676_0333475_514_852 112
324 3300047321 Ga0495676_0856271 Ga0495676_0856271_24_362 112
325 3300047321 Ga0495676_0936631 Ga0495676_0936631_82_420 112
326 3300047322 Ga0495680_0008617 Ga0495680_0008617_7908_8246 112
327 3300047322 Ga0495680_0013033 Ga0495680_0013033_1055_1393 112
328 3300047322 Ga0495680_0014726 Ga0495680_0014726_4720_5058 112
329 3300047323 Ga0495683_0309248 Ga0495683_0309248_31_369 112
330 3300047444 Ga0495675_0000137 Ga0495675_0000137_3601_3939 112
331 3300047673 Ga0495593_0220071 Ga0495593_0220071_88_426 112
332 3300048088 Ga0495602_0001635 Ga0495602_0001635_18601_18939 112
333 3300048088 Ga0495602_0055163 Ga0495602_0055163_644_982 112
334 3300048904 Ga0496101_0115934 Ga0496101_0115934_107_445 112
335 3300048904 Ga0496101_0122749 Ga0496101_0122749_1186_1524 112
336 3300048904 Ga0496101_0173891 Ga0496101_0173891_1099_1446 112
337 3300048904 Ga0496101_0561989 Ga0496101_0561989_123_461 112
338 3300048905 Ga0496102_0382910 Ga0496102_0382910_227_565 112
339 3300048907 Ga0496104_0008275 Ga0496104_0008275_4276_4614 112
340 3300048907 Ga0496104_0012649 Ga0496104_0012649_6010_6348 112
341 3300048907 Ga0496104_0127077 Ga0496104_0127077_313_651 112
342 3300048908 Ga0496105_0004966 Ga0496105_0004966_1056_1394 112
343 3300048908 Ga0496105_0021299 Ga0496105_0021299_4005_4343 112
344 3300048908 Ga0496105_0086357 Ga0496105_0086357_1428_1766 112
345 3300048909 Ga0496106_0396019 Ga0496106_0396019_609_947 112
346 3300048910 Ga0496107_0056669 Ga0496107_0056669_884_1222 112
347 3300048910 Ga0496107_0089025 Ga0496107_0089025_85_423 112
348 3300048911 Ga0496108_0005783 Ga0496108_0005783_8551_8889 112
349 3300048911 Ga0496108_0008784 Ga0496108_0008784_2714_3052 112
350 3300048912 Ga0496109_0055216 Ga0496109_0055216_3064_3402 112
351 3300048912 Ga0496109_0068252 Ga0496109_0068252_2154_2492 112
352 3300048912 Ga0496109_0280886 Ga0496109_0280886_1089_1436 112
353 3300048912 Ga0496109_0424163 Ga0496109_0424163_747_1085 112
354 3300048912 Ga0496109_0550347 Ga0496109_0550347_340_678 112
355 3300048913 Ga0496110_0208367 Ga0496110_0208367_914_1261 112
356 3300048913 Ga0496110_0666786 Ga0496110_0666786_524_862 112
357 3300048914 Ga0496111_0049379 Ga0496111_0049379_25_363 112
358 3300048914 Ga0496111_0067617 Ga0496111_0067617_519_857 112
359 3300048914 Ga0496111_0982622 Ga0496111_0982622_29_367 112
360 3300048915 Ga0496112_0176334 Ga0496112_0176334_422_760 112
361 3300048915 Ga0496112_0296151 Ga0496112_0296151_986_1324 112
362 3300048916 Ga0496113_0120797 Ga0496113_0120797_117_455 112
363 3300048916 Ga0496113_0153644 Ga0496113_0153644_608_955 112
364 3300048916 Ga0496113_0386660 Ga0496113_0386660_613_951 112
365 3300048916 Ga0496113_0783262 Ga0496113_0783262_377_715 112
366 3300048917 Ga0496114_0122336 Ga0496114_0122336_780_1118 112
367 3300048917 Ga0496114_0231967 Ga0496114_0231967_636_974 112
368 3300048918 Ga0496115_0035995 Ga0496115_0035995_391_729 112
369 3300048918 Ga0496115_0041338 Ga0496115_0041338_2892_3230 112
370 3300048918 Ga0496115_0088486 Ga0496115_0088486_563_901 112
371 3300049581 Ga0501047_0073280 Ga0501047_0073280_841_1179 112
372 3300049583 Ga0501067_0020950 Ga0501067_0020950_2313_2651 112
373 3300049585 Ga0501069_0009778 Ga0501069_0009778_1862_2200 112
374 3300049586 Ga0501070_1391165 Ga0501070_1391165_88_426 112
375 3300049589 Ga0501073_1278461 Ga0501073_1278461_125_463 112
376 3300049742 Ga0501080_0589336 Ga0501080_0589336_524_862 112
377 3300053077 Ga0495601_0000983 Ga0495601_0000983_4026_4364 112
378 3300053077 Ga0495601_0104266 Ga0495601_0104266_1095_1433 112
379 3300053077 Ga0495601_0106827 Ga0495601_0106827_214_552 112
380 3300053077 Ga0495601_0398422 Ga0495601_0398422_29_367 112
381 3300053078 Ga0495612_0084162 Ga0495612_0084162_749_1087 112
382 3300053078 Ga0495612_0358996 Ga0495612_0358996_130_468 112
383 3300053084 Ga0495595_0002532 Ga0495595_0002532_6172_6510 112
384 3300053084 Ga0495595_0008406 Ga0495595_0008406_3451_3789 112
385 3300053085 Ga0495619_0003772 Ga0495619_0003772_1106_1444 112
386 3300053085 Ga0495619_0025735 Ga0495619_0025735_995_1333 112
387 3300053085 Ga0495619_0443274 Ga0495619_0443274_319_657 112
388 3300053085 Ga0495619_0651618 Ga0495619_0651618_289_627 112
389 3300053085 Ga0495619_0879457 Ga0495619_0879457_244_582 112
390 3300060353 Ga0501082_1692672 Ga0501082_1692672_127_465 112
391 3300061719 Ga0466962_0004435 Ga0466962_0004435_453_791 112
392 3300061719 Ga0466962_0626642 Ga0466962_0626642_88_426 112
393 3300061734 Ga0530510_0183466 Ga0530510_0183466_87_425 112
394 3300005434 Ga0070709_10069714 Ga0070709_100697143 113
395 3300005435 Ga0070714_100187219 Ga0070714_1001872194 113
396 3300005435 Ga0070714_100578068 Ga0070714_1005780682 113
397 3300005436 Ga0070713_100068651 Ga0070713_1000686513 113
398 3300005436 Ga0070713_100191971 Ga0070713_1001919712 113
399 3300005439 Ga0070711_100629175 Ga0070711_1006291752 113
400 3300005445 Ga0070708_100376852 Ga0070708_1003768524 113
401 3300005467 Ga0070706_101532232 Ga0070706_1015322321 113
402 3300005471 Ga0070698_100559570 Ga0070698_1005595702 113
403 3300005518 Ga0070699_100042211 Ga0070699_1000422115 113
404 3300005536 Ga0070697_101242417 Ga0070697_1012424172 113
405 3300006028 Ga0070717_11443819 Ga0070717_114438191 113
406 3300006051 Ga0075364_10060448 Ga0075364_100604481 113
407 3300009093 Ga0105240_10286390 Ga0105240_102863905 113
408 3300013105 Ga0157369_10005636 Ga0157369_100056365 113
409 3300025906 Ga0207699_10297779 Ga0207699_102977793 113
410 3300025913 Ga0207695_11556293 Ga0207695_115562931 113
411 3300025928 Ga0207700_10040824 Ga0207700_100408244 113
412 3300025929 Ga0207664_10034034 Ga0207664_100340344 113
413 3300025929 Ga0207664_10266567 Ga0207664_102665673 113
414 3300025981 Ga0207640_10490020 Ga0207640_104900202 113
415 3300028800 Ga0265338_10024476 Ga0265338_100244762 113
416 3300031240 Ga0265320_10193903 Ga0265320_101939032 113
417 3300031242 Ga0265329_10043569 Ga0265329_100435692 113
418 3300031344 Ga0265316_10221143 Ga0265316_102211434 113
419 3300035724 Ga0373933_0608401 Ga0373933_0608401_357_698 113
420 3300035725 Ga0373947_1216977 Ga0373947_1216977_100_441 113
421 3300036401 Ga0373937_0917015 Ga0373937_0917015_286_627 113
422 3300037068 Ga0373925_1702713 Ga0373925_1702713_43_384 113
423 3300038443 Ga0395901_1493945 Ga0395901_1493945_31_372 113
424 3300044694 Ga0466963_0737618 Ga0466963_0737618_139_480 113
425 3300044706 Ga0466964_0842852 Ga0466964_0842852_115_456 113
426 3300045836 Ga0466958_0246419 Ga0466958_0246419_492_833 113
427 3300045976 Ga0466967_0283617 Ga0466967_0283617_443_784 113
428 3300045976 Ga0466967_1703025 Ga0466967_1703025_152_493 113
429 3300047317 Ga0495604_0985894 Ga0495604_0985894_73_414 113
430 3300048912 Ga0496109_0833664 Ga0496109_0833664_214_570 113
431 3300048912 Ga0496109_0840038 Ga0496109_0840038_158_499 113
432 3300049576 Ga0501040_0375131 Ga0501040_0375131_214_555 113
433 3300049592 Ga0501076_0182966 Ga0501076_0182966_79_420 113
434 3300050491 nmdc:mga00v17_51010_c1 nmdc:mga00v17_51010_c1_35_385 113
435 3300001977 JGI24746J21847_1056351 JGI24746J21847_10563512 114
436 3300001989 JGI24739J22299_10081163 JGI24739J22299_100811632 114
437 3300002075 JGI24738J21930_10046437 JGI24738J21930_100464372 114
438 3300002244 JGI24742J22300_10018062 JGI24742J22300_100180622 114
439 3300002459 JGI24751J29686_10067669 JGI24751J29686_100676692 114
440 3300003322 rootL2_10222519 rootL2_102225191 114
441 3300005327 Ga0070658_10072353 Ga0070658_100723532 114
442 3300005328 Ga0070676_10340896 Ga0070676_103408962 114
443 3300005329 Ga0070683_100279505 Ga0070683_1002795053 114
444 3300005329 Ga0070683_100282635 Ga0070683_1002826352 114
445 3300005329 Ga0070683_101411319 Ga0070683_1014113192 114
446 3300005335 Ga0070666_10374062 Ga0070666_103740622 114
447 3300005336 Ga0070680_100227411 Ga0070680_1002274111 114
448 3300005337 Ga0070682_100001777 Ga0070682_10000177711 114
449 3300005337 Ga0070682_100710191 Ga0070682_1007101911 114
450 3300005338 Ga0068868_101437085 Ga0068868_1014370852 114
451 3300005339 Ga0070660_100001667 Ga0070660_10000166710 114
452 3300005341 Ga0070691_10030216 Ga0070691_100302163 114
453 3300005344 Ga0070661_100005154 Ga0070661_1000051546 114
454 3300005353 Ga0070669_100529186 Ga0070669_1005291862 114
455 3300005354 Ga0070675_100010398 Ga0070675_1000103982 114
456 3300005356 Ga0070674_100090866 Ga0070674_1000908662 114
457 3300005364 Ga0070673_100097751 Ga0070673_1000977512 114
458 3300005367 Ga0070667_100884313 Ga0070667_1008843131 114
459 3300005437 Ga0070710_10010592 Ga0070710_100105927 114
460 3300005438 Ga0070701_10132412 Ga0070701_101324122 114
461 3300005440 Ga0070705_100229287 Ga0070705_1002292872 114
462 3300005441 Ga0070700_100460341 Ga0070700_1004603411 114
463 3300005445 Ga0070708_100003821 Ga0070708_10000382111 114
464 3300005445 Ga0070708_100006095 Ga0070708_1000060952 114
465 3300005445 Ga0070708_100565617 Ga0070708_1005656172 114
466 3300005456 Ga0070678_100005901 Ga0070678_1000059017 114
467 3300005457 Ga0070662_100027799 Ga0070662_1000277995 114
468 3300005467 Ga0070706_100003177 Ga0070706_10000317713 114
469 3300005467 Ga0070706_100048569 Ga0070706_1000485695 114
470 3300005467 Ga0070706_100092971 Ga0070706_1000929713 114
471 3300005468 Ga0070707_100005238 Ga0070707_10000523812 114
472 3300005468 Ga0070707_100634630 Ga0070707_1006346303 114
473 3300005468 Ga0070707_101127035 Ga0070707_1011270352 114
474 3300005530 Ga0070679_100260126 Ga0070679_1002601263 114
475 3300005535 Ga0070684_100018603 Ga0070684_1000186032 114
476 3300005535 Ga0070684_100934005 Ga0070684_1009340052 114
477 3300005539 Ga0068853_100004196 Ga0068853_10000419611 114
478 3300005547 Ga0070693_100022228 Ga0070693_1000222282 114
479 3300005563 Ga0068855_100626506 Ga0068855_1006265063 114
480 3300005614 Ga0068856_100046444 Ga0068856_1000464443 114
481 3300005615 Ga0070702_100012411 Ga0070702_1000124113 114
482 3300005618 Ga0068864_100708591 Ga0068864_1007085912 114
483 3300005719 Ga0068861_100801923 Ga0068861_1008019232 114
484 3300007076 Ga0075435_101727951 Ga0075435_1017279512 114
485 3300009093 Ga0105240_11415239 Ga0105240_114152392 114
486 3300009098 Ga0105245_10133547 Ga0105245_101335473 114
487 3300009098 Ga0105245_12597904 Ga0105245_125979042 114
488 3300009148 Ga0105243_11114334 Ga0105243_111143342 114
489 3300009176 Ga0105242_10002465 Ga0105242_100024654 114
490 3300009177 Ga0105248_10139561 Ga0105248_101395613 114
491 3300009545 Ga0105237_11343631 Ga0105237_113436312 114
492 3300009553 Ga0105249_11435644 Ga0105249_114356442 114
493 3300010375 Ga0105239_10049506 Ga0105239_100495063 114
494 3300011119 Ga0105246_10220955 Ga0105246_102209553 114
495 3300013102 Ga0157371_10003757 Ga0157371_1000375711 114
496 3300013104 Ga0157370_10175761 Ga0157370_101757613 114
497 3300013105 Ga0157369_10004049 Ga0157369_1000404913 114
498 3300013296 Ga0157374_10092619 Ga0157374_100926193 114
499 3300013297 Ga0157378_10265593 Ga0157378_102655932 114
500 3300014325 Ga0163163_10222868 Ga0163163_102228682 114
501 3300014325 Ga0163163_10514677 Ga0163163_105146772 114
502 3300014326 Ga0157380_11351325 Ga0157380_113513252 114
503 3300020082 Ga0206353_11109881 Ga0206353_111098813 114
504 3300025898 Ga0207692_10006084 Ga0207692_100060847 114
505 3300025903 Ga0207680_10513643 Ga0207680_105136432 114
506 3300025909 Ga0207705_10255317 Ga0207705_102553172 114
507 3300025909 Ga0207705_10334827 Ga0207705_103348272 114
508 3300025910 Ga0207684_10003165 Ga0207684_1000316513 114
509 3300025910 Ga0207684_10871270 Ga0207684_108712702 114
510 3300025910 Ga0207684_11402588 Ga0207684_114025881 114
511 3300025917 Ga0207660_11441222 Ga0207660_114412222 114
512 3300025921 Ga0207652_10596123 Ga0207652_105961232 114
513 3300025922 Ga0207646_10077956 Ga0207646_100779563 114
514 3300025924 Ga0207694_10898214 Ga0207694_108982142 114
515 3300025927 Ga0207687_10029148 Ga0207687_100291486 114
516 3300025932 Ga0207690_10013235 Ga0207690_100132355 114
517 3300025933 Ga0207706_10005943 Ga0207706_1000594312 114
518 3300025934 Ga0207686_10010949 Ga0207686_100109493 114
519 3300025935 Ga0207709_10148055 Ga0207709_101480553 114
520 3300025937 Ga0207669_10338826 Ga0207669_103388262 114
521 3300025941 Ga0207711_10430420 Ga0207711_104304203 114
522 3300025942 Ga0207689_10119513 Ga0207689_101195133 114
523 3300025944 Ga0207661_10099039 Ga0207661_100990394 114
524 3300025944 Ga0207661_10357645 Ga0207661_103576452 114
525 3300025944 Ga0207661_10490939 Ga0207661_104909392 114
526 3300025949 Ga0207667_10128179 Ga0207667_101281793 114
527 3300025961 Ga0207712_10945270 Ga0207712_109452702 114
528 3300026023 Ga0207677_11401554 Ga0207677_114015541 114
529 3300026041 Ga0207639_10146371 Ga0207639_101463713 114
530 3300026075 Ga0207708_10292205 Ga0207708_102922052 114
531 3300026089 Ga0207648_10147560 Ga0207648_101475601 114
532 3300026121 Ga0207683_10013282 Ga0207683_100132827 114
533 3300026142 Ga0207698_10109302 Ga0207698_101093023 114
534 3300028800 Ga0265338_10518331 Ga0265338_105183311 114
535 3300028800 Ga0265338_10627927 Ga0265338_106279271 114
536 3300031728 Ga0316578_10020473 Ga0316578_100204732 114
537 3300032126 Ga0307415_100242864 Ga0307415_1002428642 114
538 3300032139 Ga0316580_10290121 Ga0316580_102901211 114
539 3300035170 Ga0373943_0581262 Ga0373943_0581262_232_603 114
540 3300035398 Ga0316574_0031411 Ga0316574_0031411_1144_1494 114
541 3300035692 Ga0373935_0789371 Ga0373935_0789371_238_609 114
542 3300035724 Ga0373933_0851959 Ga0373933_0851959_148_510 114
543 3300036647 Ga0316582_0224388 Ga0316582_0224388_187_537 114
544 3300036712 Ga0316584_0089118 Ga0316584_0089118_658_1008 114
545 3300037068 Ga0373925_1555015 Ga0373925_1555015_104_475 114
546 3300037312 Ga0395899_0352103 Ga0395899_0352103_379_735 114
547 3300037418 Ga0395900_0108231 Ga0395900_0108231_887_1243 114
548 3300037471 Ga0395905_0645554 Ga0395905_0645554_29_382 114
549 3300038443 Ga0395901_0059057 Ga0395901_0059057_2760_3116 114
550 3300041486 Ga0451807_1286079 Ga0451807_1286079_1056_1400 114
551 3300044706 Ga0466964_0122446 Ga0466964_0122446_770_1117 114
552 3300045051 Ga0451576_1302310 Ga0451576_1302310_233_586 114
553 3300045836 Ga0466958_0103337 Ga0466958_0103337_1051_1395 114
554 3300045976 Ga0466967_0066749 Ga0466967_0066749_828_1187 114
555 3300045976 Ga0466967_0198086 Ga0466967_0198086_468_815 114
556 3300045976 Ga0466967_0900358 Ga0466967_0900358_273_620 114
557 3300046461 Ga0495641_0142598 Ga0495641_0142598_631_978 114
558 3300046473 Ga0495582_0758769 Ga0495582_0758769_109_456 114
559 3300046477 Ga0495664_0282007 Ga0495664_0282007_545_907 114
560 3300046516 Ga0495628_0000132 Ga0495628_0000132_4274_4636 114
561 3300046517 Ga0495630_0080084 Ga0495630_0080084_1283_1645 114
562 3300046517 Ga0495630_0223759 Ga0495630_0223759_485_832 114
563 3300046535 Ga0495586_0144077 Ga0495586_0144077_690_1037 114
564 3300047321 Ga0495676_0589648 Ga0495676_0589648_220_591 114
565 3300047321 Ga0495676_0935647 Ga0495676_0935647_60_416 114
566 3300047471 Ga0495684_0018258 Ga0495684_0018258_2567_2929 114
567 3300047471 Ga0495684_0917614 Ga0495684_0917614_171_527 114
568 3300048907 Ga0496104_0157469 Ga0496104_0157469_147_500 114
569 3300048908 Ga0496105_0004281 Ga0496105_0004281_5151_5504 114
570 3300048910 Ga0496107_0190218 Ga0496107_0190218_1108_1452 114
571 3300048911 Ga0496108_0356810 Ga0496108_0356810_587_931 114
572 3300048911 Ga0496108_0411891 Ga0496108_0411891_358_711 114
573 3300048912 Ga0496109_0012652 Ga0496109_0012652_3746_4099 114
574 3300048915 Ga0496112_0598514 Ga0496112_0598514_636_998 114
575 3300048916 Ga0496113_0019636 Ga0496113_0019636_1587_1940 114
576 3300049576 Ga0501040_1054099 Ga0501040_1054099_112_459 114
577 3300049584 Ga0501068_0328462 Ga0501068_0328462_284_628 114
578 3300049587 Ga0501071_1019015 Ga0501071_1019015_268_615 114
579 3300049588 Ga0501072_0255024 Ga0501072_0255024_196_543 114
580 3300049591 Ga0501075_0288237 Ga0501075_0288237_894_1241 114
581 3300049742 Ga0501080_1692176 Ga0501080_1692176_76_447 114
582 3300050513 nmdc:mga0rr50_505101_c1 nmdc:mga0rr50_505101_c1_212_556 114
583 3300053085 Ga0495619_0915616 Ga0495619_0915616_134_490 114
584 3300054114 Ga0501084_1303273 Ga0501084_1303273_23_370 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02641

DUF190

Uncharacterized ACR, COG1993

16

112

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9583 6 105
1o51-assembly1.cif.gz_A crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution 0.9271 6 105
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.897 3 105
2dcl-assembly1.cif.gz_B-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8952 3 105
2dcl-assembly1.cif.gz_C-2 structure of ph1503 protein from pyrococcus horikoshii ot3 0.8881 3 105
ID Description Score Start End Superfamily
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9503 7 105 3.30.70.120
1o51A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9185 7 105 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.897 3 105 3.30.70.120
2dclC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8882 3 105 3.30.70.120
af_Q58919_1_108_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8366 6 113 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A660V0E6-F1-model_v4 DUF190 domain-containing protein 0.9369 1 111
AF-A0A645A900-F1-model_v4 Uncharacterized protein 0.9365 4 110
AF-A0A2H0LUP4-F1-model_v4 Uncharacterized protein 0.9319 1 109
AF-A0A2H0M287-F1-model_v4 Uncharacterized protein 0.9308 1 109
AF-A0A4R5BGI5-F1-model_v4 DUF190 domain-containing protein 0.9301 1 114

Feature Viewer

pLDDT pTM Quality
81.55 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map