F466377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 278 | 584 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0581262|Ga0373943_0581262_232_603 |
| Length | 123 |
| Sequence | LPAPGAGKVKIEGEGKLLRIFVGESDRWHGKPLYQAIVERVRKEGLAGATVIRGIEGFGADSRLHTARILRLSEDLPVLIEIVDSAEQIERILPVLDEMVGEGMVTVERVEVIAYRGSAEPPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 142 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 8.9 |
| Rhizosphere | 90.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1056351 | 3300001977 | Bacteria | 558 |
| 2 | JGI24739J22299_10081163 | 3300001989 | Bacteria | 996 |
| 3 | JGI24738J21930_10046437 | 3300002075 | Unclassified | 884 |
| 4 | JGI24744J21845_10022103 | 3300002077 | Unclassified | 1250 |
| 5 | JGI24742J22300_10018062 | 3300002244 | Bacteria | 1195 |
| 6 | JGI24751J29686_10067669 | 3300002459 | Unclassified | 735 |
| 7 | rootL2_10222519 | 3300003322 | Unclassified | 1121 |
| 8 | rootH1_10082901 | 3300003323 | Bacteria | 1687 |
| 9 | Ga0070658_10025348 | 3300005327 | Bacteria | 4755 |
| 10 | Ga0070658_10034961 | 3300005327 | Bacteria | 4045 |
| 11 | Ga0070658_10072353 | 3300005327 | Bacteria | 2825 |
| 12 | Ga0070658_11078098 | 3300005327 | Bacteria | 699 |
| 13 | Ga0070676_10340896 | 3300005328 | Bacteria | 1028 |
| 14 | Ga0070683_100020638 | 3300005329 | Bacteria | 5864 |
| 15 | Ga0070683_100056584 | 3300005329 | Bacteria | 3642 |
| 16 | Ga0070683_100279505 | 3300005329 | Bacteria | 1588 |
| 17 | Ga0070683_100282635 | 3300005329 | Bacteria | 1578 |
| 18 | Ga0070683_101411319 | 3300005329 | Bacteria | 669 |
| 19 | Ga0070666_10374062 | 3300005335 | Bacteria | 1022 |
| 20 | Ga0070680_100046229 | 3300005336 | Bacteria | 3540 |
| 21 | Ga0070680_100227411 | 3300005336 | Bacteria | 1575 |
| 22 | Ga0070682_100001777 | 3300005337 | Bacteria | 12023 |
| 23 | Ga0070682_100111523 | 3300005337 | Bacteria | 1824 |
| 24 | Ga0070682_100710191 | 3300005337 | Bacteria | 807 |
| 25 | Ga0068868_101437085 | 3300005338 | Bacteria | 644 |
| 26 | Ga0070660_100001667 | 3300005339 | Bacteria | 15251 |
| 27 | Ga0070660_100048434 | 3300005339 | Bacteria | 3264 |
| 28 | Ga0070691_10030216 | 3300005341 | Bacteria | 2537 |
| 29 | Ga0070691_10132846 | 3300005341 | Bacteria | 1263 |
| 30 | Ga0070661_100005154 | 3300005344 | Bacteria | 8997 |
| 31 | Ga0070661_100145927 | 3300005344 | Bacteria | 1786 |
| 32 | Ga0070669_100529186 | 3300005353 | Bacteria | 981 |
| 33 | Ga0070675_100010398 | 3300005354 | Bacteria | 7268 |
| 34 | Ga0070674_100090866 | 3300005356 | Bacteria | 2203 |
| 35 | Ga0070673_100097751 | 3300005364 | Bacteria | 2411 |
| 36 | Ga0070659_100053595 | 3300005366 | Bacteria | 3175 |
| 37 | Ga0070667_100884313 | 3300005367 | Unclassified | 831 |
| 38 | Ga0070709_10069714 | 3300005434 | Bacteria | 2265 |
| 39 | Ga0070714_100001084 | 3300005435 | Bacteria | 19467 |
| 40 | Ga0070714_100122887 | 3300005435 | Bacteria | 2311 |
| 41 | Ga0070714_100187219 | 3300005435 | Bacteria | 1887 |
| 42 | Ga0070714_100578068 | 3300005435 | Bacteria | 1077 |
| 43 | Ga0070714_100809736 | 3300005435 | Bacteria | 907 |
| 44 | Ga0070713_100068651 | 3300005436 | Bacteria | 2987 |
| 45 | Ga0070713_100174140 | 3300005436 | Bacteria | 1929 |
| 46 | Ga0070713_100191971 | 3300005436 | Bacteria | 1841 |
| 47 | Ga0070710_10002369 | 3300005437 | Bacteria | 8922 |
| 48 | Ga0070710_10010592 | 3300005437 | Bacteria | 4532 |
| 49 | Ga0070710_10561056 | 3300005437 | Bacteria | 790 |
| 50 | Ga0070701_10132412 | 3300005438 | Bacteria | 1418 |
| 51 | Ga0070711_100629175 | 3300005439 | Unclassified | 898 |
| 52 | Ga0070705_100229287 | 3300005440 | Unclassified | 1291 |
| 53 | Ga0070700_100460341 | 3300005441 | Bacteria | 970 |
| 54 | Ga0070708_100003821 | 3300005445 | Bacteria | 11819 |
| 55 | Ga0070708_100006095 | 3300005445 | Bacteria | 9595 |
| 56 | Ga0070708_100376852 | 3300005445 | Bacteria | 1338 |
| 57 | Ga0070708_100565617 | 3300005445 | Bacteria | 1072 |
| 58 | Ga0070678_100005901 | 3300005456 | Bacteria | 7121 |
| 59 | Ga0070678_101198291 | 3300005456 | Bacteria | 704 |
| 60 | Ga0070662_100027799 | 3300005457 | Bacteria | 3931 |
| 61 | Ga0070681_10105612 | 3300005458 | Bacteria | 2758 |
| 62 | Ga0070706_100003177 | 3300005467 | Bacteria | 16222 |
| 63 | Ga0070706_100048569 | 3300005467 | Bacteria | 3916 |
| 64 | Ga0070706_100092971 | 3300005467 | Bacteria | 2798 |
| 65 | Ga0070706_101522081 | 3300005467 | Unclassified | 611 |
| 66 | Ga0070706_101532232 | 3300005467 | Unclassified | 609 |
| 67 | Ga0070707_100005238 | 3300005468 | Bacteria | 12134 |
| 68 | Ga0070707_100634630 | 3300005468 | Bacteria | 1031 |
| 69 | Ga0070707_101127035 | 3300005468 | Bacteria | 750 |
| 70 | Ga0070698_100559570 | 3300005471 | Bacteria | 1083 |
| 71 | Ga0070699_100042211 | 3300005518 | Bacteria | 3946 |
| 72 | Ga0070679_100260126 | 3300005530 | Bacteria | 1691 |
| 73 | Ga0070679_100301259 | 3300005530 | Bacteria | 1553 |
| 74 | Ga0070679_100340311 | 3300005530 | Bacteria | 1448 |
| 75 | Ga0070684_100018603 | 3300005535 | Bacteria | 5728 |
| 76 | Ga0070684_100021102 | 3300005535 | Bacteria | 5412 |
| 77 | Ga0070684_100192086 | 3300005535 | Unclassified | 1858 |
| 78 | Ga0070684_100934005 | 3300005535 | Bacteria | 813 |
| 79 | Ga0070697_101242417 | 3300005536 | Bacteria | 664 |
| 80 | Ga0068853_100004196 | 3300005539 | Bacteria | 11115 |
| 81 | Ga0068853_102014412 | 3300005539 | Bacteria | 560 |
| 82 | Ga0070695_100932745 | 3300005545 | Bacteria | 703 |
| 83 | Ga0070693_100022228 | 3300005547 | Bacteria | 3369 |
| 84 | Ga0070693_100118814 | 3300005547 | Bacteria | 1637 |
| 85 | Ga0068855_100046564 | 3300005563 | Bacteria | 5126 |
| 86 | Ga0068855_100626506 | 3300005563 | Bacteria | 1158 |
| 87 | Ga0068857_100785189 | 3300005577 | Bacteria | 909 |
| 88 | Ga0068856_100046444 | 3300005614 | Bacteria | 4277 |
| 89 | Ga0068856_100063637 | 3300005614 | Bacteria | 3644 |
| 90 | Ga0068856_100195891 | 3300005614 | Bacteria | 2034 |
| 91 | Ga0070702_100012411 | 3300005615 | Bacteria | 4269 |
| 92 | Ga0070702_100835118 | 3300005615 | Unclassified | 716 |
| 93 | Ga0068852_100218638 | 3300005616 | Bacteria | 1811 |
| 94 | Ga0068864_100708591 | 3300005618 | Bacteria | 984 |
| 95 | Ga0068861_100801923 | 3300005719 | Bacteria | 884 |
| 96 | Ga0068863_100064638 | 3300005841 | Bacteria | 3460 |
| 97 | Ga0070717_10008478 | 3300006028 | Bacteria | 7677 |
| 98 | Ga0070717_10022452 | 3300006028 | Bacteria | 4986 |
| 99 | Ga0070717_10033324 | 3300006028 | Bacteria | 4156 |
| 100 | Ga0070717_11443819 | 3300006028 | Bacteria | 624 |
| 101 | Ga0075364_10060448 | 3300006051 | Bacteria | 2485 |
| 102 | Ga0070716_100166880 | 3300006173 | Bacteria | 1432 |
| 103 | Ga0070712_100071321 | 3300006175 | Bacteria | 2485 |
| 104 | Ga0070712_101219126 | 3300006175 | Bacteria | 655 |
| 105 | Ga0068865_100725637 | 3300006881 | Bacteria | 851 |
| 106 | Ga0075436_100252464 | 3300006914 | Unclassified | 1256 |
| 107 | Ga0075435_100033009 | 3300007076 | Bacteria | 4090 |
| 108 | Ga0075435_101727951 | 3300007076 | Unclassified | 549 |
| 109 | Ga0105240_10047426 | 3300009093 | Bacteria | 5436 |
| 110 | Ga0105240_10286390 | 3300009093 | Bacteria | 1891 |
| 111 | Ga0105240_11415239 | 3300009093 | Bacteria | 731 |
| 112 | Ga0105245_10133547 | 3300009098 | Bacteria | 2330 |
| 113 | Ga0105245_10259688 | 3300009098 | Bacteria | 1690 |
| 114 | Ga0105245_10504591 | 3300009098 | Bacteria | 1226 |
| 115 | Ga0105245_12597904 | 3300009098 | Bacteria | 560 |
| 116 | Ga0105243_11114334 | 3300009148 | Bacteria | 798 |
| 117 | Ga0105242_10002465 | 3300009176 | Bacteria | 14522 |
| 118 | Ga0105248_10139561 | 3300009177 | Bacteria | 2734 |
| 119 | Ga0105237_11343631 | 3300009545 | Bacteria | 721 |
| 120 | Ga0105238_10078199 | 3300009551 | Bacteria | 3299 |
| 121 | Ga0105238_12429870 | 3300009551 | Bacteria | 560 |
| 122 | Ga0105249_11435644 | 3300009553 | Bacteria | 762 |
| 123 | Ga0105239_10049506 | 3300010375 | Bacteria | 4608 |
| 124 | Ga0105239_10362992 | 3300010375 | Bacteria | 1636 |
| 125 | Ga0105246_10220955 | 3300011119 | Bacteria | 1485 |
| 126 | Ga0157371_10003757 | 3300013102 | Bacteria | 13588 |
| 127 | Ga0157370_10064913 | 3300013104 | Bacteria | 3454 |
| 128 | Ga0157370_10175761 | 3300013104 | Bacteria | 1990 |
| 129 | Ga0157370_11602700 | 3300013104 | Bacteria | 585 |
| 130 | Ga0157369_10004049 | 3300013105 | Bacteria | 17368 |
| 131 | Ga0157369_10005636 | 3300013105 | Bacteria | 14546 |
| 132 | Ga0157369_10057858 | 3300013105 | Bacteria | 4181 |
| 133 | Ga0157369_10424013 | 3300013105 | Bacteria | 1379 |
| 134 | Ga0157374_10092619 | 3300013296 | Bacteria | 2884 |
| 135 | Ga0157374_10251669 | 3300013296 | Bacteria | 1739 |
| 136 | Ga0157374_11161348 | 3300013296 | Bacteria | 793 |
| 137 | Ga0157378_10265593 | 3300013297 | Bacteria | 1648 |
| 138 | Ga0157372_10174350 | 3300013307 | Bacteria | 2489 |
| 139 | Ga0157372_10683535 | 3300013307 | Bacteria | 1195 |
| 140 | Ga0163163_10222868 | 3300014325 | Bacteria | 1935 |
| 141 | Ga0163163_10514677 | 3300014325 | Bacteria | 1259 |
| 142 | Ga0157380_11351325 | 3300014326 | Bacteria | 761 |
| 143 | Ga0182008_10240795 | 3300014497 | Bacteria | 931 |
| 144 | Ga0182008_10451297 | 3300014497 | Unclassified | 699 |
| 145 | Ga0157377_10644330 | 3300014745 | Bacteria | 762 |
| 146 | Ga0157376_10100171 | 3300014969 | Bacteria | 2529 |
| 147 | Ga0182007_10215731 | 3300015262 | Bacteria | 676 |
| 148 | Ga0163161_11544454 | 3300017792 | Bacteria | 584 |
| 149 | Ga0206356_11138035 | 3300020070 | Bacteria | 555 |
| 150 | Ga0206353_11109881 | 3300020082 | Bacteria | 1900 |
| 151 | Ga0207692_10006084 | 3300025898 | Bacteria | 4881 |
| 152 | Ga0207692_10094975 | 3300025898 | Bacteria | 1625 |
| 153 | Ga0207692_10135079 | 3300025898 | Bacteria | 1397 |
| 154 | Ga0207680_10513643 | 3300025903 | Bacteria | 854 |
| 155 | Ga0207699_10297779 | 3300025906 | Bacteria | 1126 |
| 156 | Ga0207699_10388100 | 3300025906 | Bacteria | 992 |
| 157 | Ga0207699_10422622 | 3300025906 | Bacteria | 952 |
| 158 | Ga0207705_10051423 | 3300025909 | Bacteria | 2965 |
| 159 | Ga0207705_10194384 | 3300025909 | Bacteria | 1535 |
| 160 | Ga0207705_10255317 | 3300025909 | Bacteria | 1337 |
| 161 | Ga0207705_10334827 | 3300025909 | Bacteria | 1164 |
| 162 | Ga0207684_10003165 | 3300025910 | Bacteria | 16190 |
| 163 | Ga0207684_10871270 | 3300025910 | Bacteria | 758 |
| 164 | Ga0207684_11402588 | 3300025910 | Unclassified | 572 |
| 165 | Ga0207707_10271357 | 3300025912 | Bacteria | 1470 |
| 166 | Ga0207695_11556293 | 3300025913 | Unclassified | 542 |
| 167 | Ga0207693_10008397 | 3300025915 | Bacteria | 8449 |
| 168 | Ga0207663_10013008 | 3300025916 | Bacteria | 4512 |
| 169 | Ga0207660_10183966 | 3300025917 | Bacteria | 1624 |
| 170 | Ga0207660_11441222 | 3300025917 | Bacteria | 557 |
| 171 | Ga0207657_10014505 | 3300025919 | Bacteria | 7685 |
| 172 | Ga0207649_10212791 | 3300025920 | Bacteria | 1372 |
| 173 | Ga0207652_10536487 | 3300025921 | Bacteria | 1052 |
| 174 | Ga0207652_10596123 | 3300025921 | Bacteria | 991 |
| 175 | Ga0207652_11714794 | 3300025921 | Bacteria | 533 |
| 176 | Ga0207646_10077956 | 3300025922 | Unclassified | 2961 |
| 177 | Ga0207694_10102522 | 3300025924 | Bacteria | 2269 |
| 178 | Ga0207694_10898214 | 3300025924 | Bacteria | 749 |
| 179 | Ga0207687_10029148 | 3300025927 | Bacteria | 3711 |
| 180 | Ga0207700_10005417 | 3300025928 | Bacteria | 7631 |
| 181 | Ga0207700_10040824 | 3300025928 | Bacteria | 3389 |
| 182 | Ga0207664_10034034 | 3300025929 | Bacteria | 3921 |
| 183 | Ga0207664_10192035 | 3300025929 | Bacteria | 1758 |
| 184 | Ga0207664_10266567 | 3300025929 | Bacteria | 1499 |
| 185 | Ga0207664_10393757 | 3300025929 | Bacteria | 1231 |
| 186 | Ga0207690_10013235 | 3300025932 | Bacteria | 4953 |
| 187 | Ga0207690_10066178 | 3300025932 | Bacteria | 2474 |
| 188 | Ga0207706_10005943 | 3300025933 | Bacteria | 11353 |
| 189 | Ga0207686_10010949 | 3300025934 | Bacteria | 4947 |
| 190 | Ga0207709_10148055 | 3300025935 | Bacteria | 1623 |
| 191 | Ga0207669_10338826 | 3300025937 | Bacteria | 1157 |
| 192 | Ga0207704_10399442 | 3300025938 | Bacteria | 1084 |
| 193 | Ga0207665_10081749 | 3300025939 | Bacteria | 2225 |
| 194 | Ga0207711_10430420 | 3300025941 | Bacteria | 1228 |
| 195 | Ga0207689_10119513 | 3300025942 | Bacteria | 2168 |
| 196 | Ga0207661_10021882 | 3300025944 | Bacteria | 4800 |
| 197 | Ga0207661_10085383 | 3300025944 | Bacteria | 2616 |
| 198 | Ga0207661_10099039 | 3300025944 | Bacteria | 2444 |
| 199 | Ga0207661_10357645 | 3300025944 | Bacteria | 1318 |
| 200 | Ga0207661_10490939 | 3300025944 | Bacteria | 1122 |
| 201 | Ga0207679_10734249 | 3300025945 | Bacteria | 897 |
| 202 | Ga0207667_10128179 | 3300025949 | Bacteria | 2614 |
| 203 | Ga0207667_10571068 | 3300025949 | Bacteria | 1142 |
| 204 | Ga0207712_10945270 | 3300025961 | Bacteria | 763 |
| 205 | Ga0207640_10490020 | 3300025981 | Bacteria | 1021 |
| 206 | Ga0207677_11401554 | 3300026023 | Bacteria | 644 |
| 207 | Ga0207639_10146371 | 3300026041 | Bacteria | 1974 |
| 208 | Ga0207708_10292205 | 3300026075 | Bacteria | 1323 |
| 209 | Ga0207702_10092963 | 3300026078 | Bacteria | 2644 |
| 210 | Ga0207648_10147560 | 3300026089 | Bacteria | 2075 |
| 211 | Ga0207674_10319859 | 3300026116 | Bacteria | 1501 |
| 212 | Ga0207683_10013282 | 3300026121 | Bacteria | 7021 |
| 213 | Ga0207698_10109302 | 3300026142 | Bacteria | 2313 |
| 214 | Ga0265337_1003753 | 3300028556 | Bacteria | 6480 |
| 215 | Ga0265337_1013098 | 3300028556 | Bacteria | 2798 |
| 216 | Ga0265326_10000698 | 3300028558 | Bacteria | 12443 |
| 217 | Ga0265326_10007464 | 3300028558 | Bacteria | 3353 |
| 218 | Ga0265326_10027996 | 3300028558 | Bacteria | 1606 |
| 219 | Ga0265319_1000067 | 3300028563 | Bacteria | 82947 |
| 220 | Ga0265319_1000408 | 3300028563 | Bacteria | 30993 |
| 221 | Ga0265319_1002042 | 3300028563 | Bacteria | 11359 |
| 222 | Ga0265319_1012536 | 3300028563 | Bacteria | 3424 |
| 223 | Ga0265319_1053723 | 3300028563 | Bacteria | 1323 |
| 224 | Ga0265319_1256639 | 3300028563 | Bacteria | 532 |
| 225 | Ga0265334_10007750 | 3300028573 | Bacteria | 4598 |
| 226 | Ga0265334_10032888 | 3300028573 | Bacteria | 2066 |
| 227 | Ga0265318_10006922 | 3300028577 | Bacteria | 5170 |
| 228 | Ga0265318_10012770 | 3300028577 | Unclassified | 3563 |
| 229 | Ga0265318_10148189 | 3300028577 | Unclassified | 861 |
| 230 | Ga0265323_10000491 | 3300028653 | Bacteria | 22283 |
| 231 | Ga0265322_10000759 | 3300028654 | Bacteria | 11705 |
| 232 | Ga0265322_10043357 | 3300028654 | Bacteria | 1281 |
| 233 | Ga0265336_10000067 | 3300028666 | Bacteria | 93268 |
| 234 | Ga0265336_10118795 | 3300028666 | Bacteria | 787 |
| 235 | Ga0265338_10000126 | 3300028800 | Bacteria | 140495 |
| 236 | Ga0265338_10009097 | 3300028800 | Bacteria | 11937 |
| 237 | Ga0265338_10009434 | 3300028800 | Bacteria | 11631 |
| 238 | Ga0265338_10011608 | 3300028800 | Bacteria | 10152 |
| 239 | Ga0265338_10014199 | 3300028800 | Bacteria | 8894 |
| 240 | Ga0265338_10024476 | 3300028800 | Bacteria | 6167 |
| 241 | Ga0265338_10518331 | 3300028800 | Unclassified | 838 |
| 242 | Ga0265338_10627927 | 3300028800 | Bacteria | 746 |
| 243 | Ga0265324_10002147 | 3300029957 | Bacteria | 10356 |
| 244 | Ga0265324_10008640 | 3300029957 | Bacteria | 4031 |
| 245 | Ga0265324_10053614 | 3300029957 | Bacteria | 1384 |
| 246 | Ga0265324_10283562 | 3300029957 | Bacteria | 563 |
| 247 | Ga0265330_10000150 | 3300031235 | Bacteria | 56333 |
| 248 | Ga0265332_10000306 | 3300031238 | Bacteria | 37911 |
| 249 | Ga0265328_10008178 | 3300031239 | Bacteria | 4327 |
| 250 | Ga0265320_10000275 | 3300031240 | Bacteria | 42230 |
| 251 | Ga0265320_10005196 | 3300031240 | Bacteria | 8399 |
| 252 | Ga0265320_10193903 | 3300031240 | Unclassified | 908 |
| 253 | Ga0265325_10005197 | 3300031241 | Bacteria | 8087 |
| 254 | Ga0265325_10123670 | 3300031241 | Bacteria | 1244 |
| 255 | Ga0265329_10000181 | 3300031242 | Bacteria | 32113 |
| 256 | Ga0265329_10043569 | 3300031242 | Bacteria | 1435 |
| 257 | Ga0265340_10008924 | 3300031247 | Bacteria | 5401 |
| 258 | Ga0265340_10029483 | 3300031247 | Bacteria | 2755 |
| 259 | Ga0265339_10000097 | 3300031249 | Bacteria | 73931 |
| 260 | Ga0265339_10056040 | 3300031249 | Bacteria | 2136 |
| 261 | Ga0265331_10000322 | 3300031250 | Bacteria | 51785 |
| 262 | Ga0265331_10193979 | 3300031250 | Unclassified | 916 |
| 263 | Ga0265316_10001497 | 3300031344 | Bacteria | 25056 |
| 264 | Ga0265316_10002531 | 3300031344 | Bacteria | 18899 |
| 265 | Ga0265316_10221143 | 3300031344 | Bacteria | 1397 |
| 266 | Ga0265313_10001271 | 3300031595 | Bacteria | 23915 |
| 267 | Ga0265313_10049400 | 3300031595 | Bacteria | 2024 |
| 268 | Ga0265314_10000337 | 3300031711 | Bacteria | 65738 |
| 269 | Ga0265342_10000999 | 3300031712 | Bacteria | 27871 |
| 270 | Ga0265342_10001401 | 3300031712 | Bacteria | 22534 |
| 271 | Ga0316578_10020473 | 3300031728 | Bacteria | 3656 |
| 272 | Ga0316578_10430808 | 3300031728 | Unclassified | 780 |
| 273 | Ga0307415_100242864 | 3300032126 | Bacteria | 1458 |
| 274 | Ga0316580_10290121 | 3300032139 | Unclassified | 508 |
| 275 | Ga0373956_0585789 | 3300035119 | Unclassified | 532 |
| 276 | Ga0373957_0125300 | 3300035120 | Unclassified | 1042 |
| 277 | Ga0373943_0581262 | 3300035170 | Unclassified | 659 |
| 278 | Ga0373943_0697530 | 3300035170 | Bacteria | 601 |
| 279 | Ga0373955_0584515 | 3300035172 | Bacteria | 684 |
| 280 | Ga0316574_0031411 | 3300035398 | Bacteria | 3222 |
| 281 | Ga0316574_0227821 | 3300035398 | Bacteria | 1193 |
| 282 | Ga0373935_0789371 | 3300035692 | Bacteria | 701 |
| 283 | Ga0373933_0608401 | 3300035724 | Bacteria | 718 |
| 284 | Ga0373933_0625578 | 3300035724 | Bacteria | 707 |
| 285 | Ga0373933_0851959 | 3300035724 | Unclassified | 600 |
| 286 | Ga0373947_1216977 | 3300035725 | Bacteria | 513 |
| 287 | Ga0373937_0020040 | 3300036401 | Bacteria | 5991 |
| 288 | Ga0373937_0917015 | 3300036401 | Bacteria | 825 |
| 289 | Ga0316582_0224388 | 3300036647 | Bacteria | 1285 |
| 290 | Ga0316584_0089118 | 3300036712 | Bacteria | 2310 |
| 291 | Ga0373925_0252810 | 3300037068 | Bacteria | 1414 |
| 292 | Ga0373925_1555015 | 3300037068 | Bacteria | 541 |
| 293 | Ga0373925_1702713 | 3300037068 | Unclassified | 515 |
| 294 | Ga0395899_0352103 | 3300037312 | Bacteria | 985 |
| 295 | Ga0395899_0428366 | 3300037312 | Bacteria | 870 |
| 296 | Ga0395900_0017157 | 3300037418 | Bacteria | 7389 |
| 297 | Ga0395900_0108231 | 3300037418 | Bacteria | 2856 |
| 298 | Ga0395900_1802112 | 3300037418 | Unclassified | 523 |
| 299 | Ga0395898_0252650 | 3300037466 | Bacteria | 1681 |
| 300 | Ga0395898_0565211 | 3300037466 | Bacteria | 1080 |
| 301 | Ga0395898_1529388 | 3300037466 | Bacteria | 593 |
| 302 | Ga0395905_0645554 | 3300037471 | Bacteria | 960 |
| 303 | Ga0395901_0010671 | 3300038443 | Bacteria | 9312 |
| 304 | Ga0395901_0059057 | 3300038443 | Bacteria | 3990 |
| 305 | Ga0395901_1493945 | 3300038443 | Bacteria | 632 |
| 306 | Ga0451791_0561320 | 3300041451 | Bacteria | 720 |
| 307 | Ga0451807_0123002 | 3300041486 | Bacteria | 730 |
| 308 | Ga0451807_1286079 | 3300041486 | Bacteria | 1838 |
| 309 | Ga0451839_1262289 | 3300041496 | Bacteria | 500 |
| 310 | Ga0451853_1143151 | 3300041512 | Bacteria | 615 |
| 311 | Ga0466972_0056516 | 3300044658 | Bacteria | 1887 |
| 312 | Ga0466965_0015015 | 3300044683 | Bacteria | 3674 |
| 313 | Ga0466965_0135246 | 3300044683 | Bacteria | 1280 |
| 314 | Ga0466966_0662914 | 3300044684 | Bacteria | 629 |
| 315 | Ga0466961_0265145 | 3300044693 | Bacteria | 1053 |
| 316 | Ga0466961_0314462 | 3300044693 | Bacteria | 955 |
| 317 | Ga0466963_0000430 | 3300044694 | Bacteria | 19359 |
| 318 | Ga0466963_0008450 | 3300044694 | Bacteria | 6170 |
| 319 | Ga0466963_0008744 | 3300044694 | Bacteria | 6080 |
| 320 | Ga0466963_0010043 | 3300044694 | Bacteria | 5723 |
| 321 | Ga0466963_0012753 | 3300044694 | Bacteria | 5148 |
| 322 | Ga0466963_0040503 | 3300044694 | Bacteria | 3053 |
| 323 | Ga0466963_0051773 | 3300044694 | Bacteria | 2722 |
| 324 | Ga0466963_0111939 | 3300044694 | Unclassified | 1874 |
| 325 | Ga0466963_0737618 | 3300044694 | Bacteria | 695 |
| 326 | Ga0466964_0006969 | 3300044706 | Bacteria | 4225 |
| 327 | Ga0466964_0023847 | 3300044706 | Unclassified | 2381 |
| 328 | Ga0466964_0107014 | 3300044706 | Bacteria | 1242 |
| 329 | Ga0466964_0119350 | 3300044706 | Bacteria | 1187 |
| 330 | Ga0466964_0121091 | 3300044706 | Bacteria | 1180 |
| 331 | Ga0466964_0122446 | 3300044706 | Bacteria | 1174 |
| 332 | Ga0466964_0156318 | 3300044706 | Bacteria | 1062 |
| 333 | Ga0466964_0207970 | 3300044706 | Bacteria | 943 |
| 334 | Ga0466964_0735132 | 3300044706 | Bacteria | 553 |
| 335 | Ga0466964_0842852 | 3300044706 | Bacteria | 521 |
| 336 | Ga0453684_1161235 | 3300044712 | Bacteria | 813 |
| 337 | Ga0466971_0000571 | 3300044719 | Bacteria | 14575 |
| 338 | Ga0466971_0015039 | 3300044719 | Bacteria | 3404 |
| 339 | Ga0466971_0089392 | 3300044719 | Bacteria | 1410 |
| 340 | Ga0466971_0134837 | 3300044719 | Bacteria | 1148 |
| 341 | Ga0466968_0001271 | 3300044735 | Bacteria | 8983 |
| 342 | Ga0466968_0014588 | 3300044735 | Bacteria | 3106 |
| 343 | Ga0466968_0059896 | 3300044735 | Archaea | 1640 |
| 344 | Ga0466968_0124558 | 3300044735 | Unclassified | 1168 |
| 345 | Ga0466968_0661833 | 3300044735 | Bacteria | 531 |
| 346 | Ga0466970_0041403 | 3300044765 | Bacteria | 2448 |
| 347 | Ga0466970_0046352 | 3300044765 | Bacteria | 2315 |
| 348 | Ga0466957_0001386 | 3300044842 | Bacteria | 12643 |
| 349 | Ga0466957_0024346 | 3300044842 | Bacteria | 3582 |
| 350 | Ga0466957_0066360 | 3300044842 | Bacteria | 2224 |
| 351 | Ga0466957_0241166 | 3300044842 | Bacteria | 1199 |
| 352 | Ga0466957_0799746 | 3300044842 | Unclassified | 670 |
| 353 | Ga0466960_0005128 | 3300044901 | Bacteria | 5184 |
| 354 | Ga0466960_0093661 | 3300044901 | Bacteria | 1536 |
| 355 | Ga0466959_0004364 | 3300045049 | Bacteria | 9464 |
| 356 | Ga0466959_0085927 | 3300045049 | Bacteria | 2263 |
| 357 | Ga0466959_0447148 | 3300045049 | Unclassified | 876 |
| 358 | Ga0451576_1302310 | 3300045051 | Bacteria | 757 |
| 359 | Ga0466958_0007198 | 3300045836 | Bacteria | 6099 |
| 360 | Ga0466958_0022021 | 3300045836 | Unclassified | 3728 |
| 361 | Ga0466958_0065326 | 3300045836 | Bacteria | 2220 |
| 362 | Ga0466958_0089702 | 3300045836 | Bacteria | 1901 |
| 363 | Ga0466958_0093100 | 3300045836 | Bacteria | 1866 |
| 364 | Ga0466958_0103337 | 3300045836 | Bacteria | 1774 |
| 365 | Ga0466958_0246419 | 3300045836 | Bacteria | 1142 |
| 366 | Ga0466967_0006144 | 3300045976 | Bacteria | 8454 |
| 367 | Ga0466967_0016339 | 3300045976 | Bacteria | 5850 |
| 368 | Ga0466967_0019641 | 3300045976 | Bacteria | 5439 |
| 369 | Ga0466967_0022601 | 3300045976 | Bacteria | 5135 |
| 370 | Ga0466967_0041398 | 3300045976 | Bacteria | 3971 |
| 371 | Ga0466967_0066749 | 3300045976 | Bacteria | 3206 |
| 372 | Ga0466967_0096844 | 3300045976 | Bacteria | 2692 |
| 373 | Ga0466967_0180391 | 3300045976 | Bacteria | 1991 |
| 374 | Ga0466967_0198086 | 3300045976 | Bacteria | 1901 |
| 375 | Ga0466967_0283617 | 3300045976 | Bacteria | 1590 |
| 376 | Ga0466967_0311815 | 3300045976 | Bacteria | 1515 |
| 377 | Ga0466967_0503714 | 3300045976 | Bacteria | 1188 |
| 378 | Ga0466967_0900358 | 3300045976 | Bacteria | 880 |
| 379 | Ga0466967_1703025 | 3300045976 | Bacteria | 628 |
| 380 | Ga0495592_0000125 | 3300046454 | Bacteria | 68045 |
| 381 | Ga0495592_0070954 | 3300046454 | Unclassified | 2536 |
| 382 | Ga0495592_0171381 | 3300046454 | Bacteria | 1486 |
| 383 | Ga0495603_0005954 | 3300046455 | Bacteria | 7290 |
| 384 | Ga0495603_0153756 | 3300046455 | Bacteria | 1336 |
| 385 | Ga0495641_0016970 | 3300046461 | Bacteria | 3813 |
| 386 | Ga0495641_0042670 | 3300046461 | Bacteria | 2100 |
| 387 | Ga0495641_0142598 | 3300046461 | Unclassified | 1070 |
| 388 | Ga0495641_0368857 | 3300046461 | Bacteria | 650 |
| 389 | Ga0495651_0000104 | 3300046462 | Bacteria | 61716 |
| 390 | Ga0495651_0002454 | 3300046462 | Bacteria | 14323 |
| 391 | Ga0495653_0004604 | 3300046463 | Bacteria | 11155 |
| 392 | Ga0495653_0005005 | 3300046463 | Bacteria | 10755 |
| 393 | Ga0495653_0575691 | 3300046463 | Bacteria | 694 |
| 394 | Ga0495653_0692850 | 3300046463 | Bacteria | 619 |
| 395 | Ga0495582_0086405 | 3300046473 | Bacteria | 1745 |
| 396 | Ga0495582_0215053 | 3300046473 | Bacteria | 1099 |
| 397 | Ga0495582_0325359 | 3300046473 | Unclassified | 885 |
| 398 | Ga0495582_0758769 | 3300046473 | Unclassified | 561 |
| 399 | Ga0495605_0018697 | 3300046474 | Bacteria | 3709 |
| 400 | Ga0495662_0111343 | 3300046476 | Unclassified | 1342 |
| 401 | Ga0495664_0205705 | 3300046477 | Bacteria | 1192 |
| 402 | Ga0495664_0282007 | 3300046477 | Bacteria | 1004 |
| 403 | Ga0495664_0534164 | 3300046477 | Bacteria | 699 |
| 404 | Ga0495585_0400382 | 3300046492 | Bacteria | 661 |
| 405 | Ga0495594_0346948 | 3300046499 | Bacteria | 845 |
| 406 | Ga0495596_0053900 | 3300046500 | Bacteria | 1573 |
| 407 | Ga0495607_0019154 | 3300046501 | Bacteria | 4352 |
| 408 | Ga0495608_0000595 | 3300046511 | Bacteria | 24865 |
| 409 | Ga0495608_0017819 | 3300046511 | Bacteria | 4909 |
| 410 | Ga0495608_0055966 | 3300046511 | Unclassified | 2606 |
| 411 | Ga0495618_0006629 | 3300046514 | Bacteria | 7016 |
| 412 | Ga0495618_0161361 | 3300046514 | Unclassified | 1429 |
| 413 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 414 | Ga0495628_0000132 | 3300046516 | Bacteria | 63426 |
| 415 | Ga0495628_0040955 | 3300046516 | Bacteria | 3698 |
| 416 | Ga0495628_0312062 | 3300046516 | Unclassified | 1162 |
| 417 | Ga0495630_0028971 | 3300046517 | Bacteria | 4115 |
| 418 | Ga0495630_0080084 | 3300046517 | Bacteria | 2464 |
| 419 | Ga0495630_0223759 | 3300046517 | Unclassified | 1437 |
| 420 | Ga0495630_0226861 | 3300046517 | Bacteria | 1426 |
| 421 | Ga0495631_0128527 | 3300046518 | Bacteria | 1089 |
| 422 | Ga0495637_0262360 | 3300046520 | Bacteria | 620 |
| 423 | Ga0495644_0003396 | 3300046523 | Bacteria | 6296 |
| 424 | Ga0495652_0000298 | 3300046529 | Bacteria | 59074 |
| 425 | Ga0495652_0051510 | 3300046529 | Unclassified | 3515 |
| 426 | Ga0495652_0126873 | 3300046529 | Bacteria | 2026 |
| 427 | Ga0495652_0150585 | 3300046529 | Bacteria | 1818 |
| 428 | Ga0495640_0044854 | 3300046533 | Bacteria | 3071 |
| 429 | Ga0495640_0400325 | 3300046533 | Bacteria | 843 |
| 430 | Ga0495586_0028540 | 3300046535 | Bacteria | 2985 |
| 431 | Ga0495586_0144077 | 3300046535 | Unclassified | 1338 |
| 432 | Ga0495587_0000212 | 3300046536 | Bacteria | 43340 |
| 433 | Ga0495587_0039869 | 3300046536 | Unclassified | 2809 |
| 434 | Ga0495645_0000035 | 3300046543 | Bacteria | 102305 |
| 435 | Ga0495645_0240680 | 3300046543 | Bacteria | 1207 |
| 436 | Ga0495645_0403540 | 3300046543 | Unclassified | 870 |
| 437 | Ga0495633_0085483 | 3300046558 | Bacteria | 1467 |
| 438 | Ga0495667_0084109 | 3300046559 | Bacteria | 2066 |
| 439 | Ga0495667_0151715 | 3300046559 | Unclassified | 1492 |
| 440 | Ga0495667_0279664 | 3300046559 | Unclassified | 1059 |
| 441 | Ga0495656_0003461 | 3300046615 | Bacteria | 5338 |
| 442 | Ga0495634_0093851 | 3300046642 | Bacteria | 1945 |
| 443 | Ga0495611_0219422 | 3300046648 | Bacteria | 885 |
| 444 | Ga0495635_0039927 | 3300046663 | Unclassified | 3245 |
| 445 | Ga0495635_0246121 | 3300046663 | Bacteria | 1206 |
| 446 | Ga0495659_0011040 | 3300046664 | Bacteria | 2909 |
| 447 | Ga0495657_0002891 | 3300046675 | Bacteria | 14255 |
| 448 | Ga0495657_0046888 | 3300046675 | Unclassified | 2924 |
| 449 | Ga0495657_0060447 | 3300046675 | Bacteria | 2510 |
| 450 | Ga0495657_0122223 | 3300046675 | Bacteria | 1639 |
| 451 | Ga0495657_0145568 | 3300046675 | Bacteria | 1474 |
| 452 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 453 | Ga0495599_0007227 | 3300046678 | Bacteria | 6728 |
| 454 | Ga0495599_0520074 | 3300046678 | Bacteria | 699 |
| 455 | Ga0495623_0001465 | 3300046679 | Bacteria | 15981 |
| 456 | Ga0495623_0216639 | 3300046679 | Bacteria | 1093 |
| 457 | Ga0495646_0006560 | 3300046680 | Bacteria | 7385 |
| 458 | Ga0495646_0342497 | 3300046680 | Bacteria | 784 |
| 459 | Ga0495647_0042402 | 3300046681 | Bacteria | 1737 |
| 460 | Ga0495647_0088988 | 3300046681 | Bacteria | 1263 |
| 461 | Ga0495658_0012076 | 3300046683 | Bacteria | 4363 |
| 462 | Ga0495658_0111163 | 3300046683 | Bacteria | 1648 |
| 463 | Ga0495669_0562664 | 3300046684 | Bacteria | 555 |
| 464 | Ga0495613_0017635 | 3300046689 | Bacteria | 5316 |
| 465 | Ga0495613_0084261 | 3300046689 | Bacteria | 2308 |
| 466 | Ga0495624_0024201 | 3300046690 | Bacteria | 3997 |
| 467 | Ga0495589_0229501 | 3300046794 | Bacteria | 871 |
| 468 | Ga0495600_0459409 | 3300046809 | Bacteria | 786 |
| 469 | Ga0495581_0015527 | 3300047315 | Bacteria | 4421 |
| 470 | Ga0495604_0000120 | 3300047317 | Bacteria | 66462 |
| 471 | Ga0495604_0254492 | 3300047317 | Bacteria | 1196 |
| 472 | Ga0495604_0985894 | 3300047317 | Bacteria | 522 |
| 473 | Ga0495674_0087891 | 3300047319 | Bacteria | 2659 |
| 474 | Ga0495674_0113279 | 3300047319 | Unclassified | 2297 |
| 475 | Ga0495674_0399764 | 3300047319 | Unclassified | 1109 |
| 476 | Ga0495676_0066924 | 3300047321 | Bacteria | 2781 |
| 477 | Ga0495676_0333475 | 3300047321 | Unclassified | 1017 |
| 478 | Ga0495676_0589648 | 3300047321 | Bacteria | 724 |
| 479 | Ga0495676_0856271 | 3300047321 | Bacteria | 583 |
| 480 | Ga0495676_0935647 | 3300047321 | Bacteria | 554 |
| 481 | Ga0495676_0936631 | 3300047321 | Bacteria | 554 |
| 482 | Ga0495680_0008617 | 3300047322 | Bacteria | 9258 |
| 483 | Ga0495680_0013033 | 3300047322 | Bacteria | 7272 |
| 484 | Ga0495680_0014726 | 3300047322 | Bacteria | 6761 |
| 485 | Ga0495683_0309248 | 3300047323 | Bacteria | 677 |
| 486 | Ga0495675_0000137 | 3300047444 | Bacteria | 50947 |
| 487 | Ga0495684_0018258 | 3300047471 | Bacteria | 5405 |
| 488 | Ga0495684_0917614 | 3300047471 | Bacteria | 563 |
| 489 | Ga0495593_0220071 | 3300047673 | Bacteria | 953 |
| 490 | Ga0495602_0001635 | 3300048088 | Bacteria | 22289 |
| 491 | Ga0495602_0055163 | 3300048088 | Unclassified | 3501 |
| 492 | Ga0496101_0115934 | 3300048904 | Unclassified | 2021 |
| 493 | Ga0496101_0122749 | 3300048904 | Bacteria | 1965 |
| 494 | Ga0496101_0173891 | 3300048904 | Bacteria | 1656 |
| 495 | Ga0496101_0561989 | 3300048904 | Bacteria | 902 |
| 496 | Ga0496102_0382910 | 3300048905 | Bacteria | 1324 |
| 497 | Ga0496104_0008275 | 3300048907 | Bacteria | 9236 |
| 498 | Ga0496104_0012649 | 3300048907 | Bacteria | 7598 |
| 499 | Ga0496104_0127077 | 3300048907 | Bacteria | 2448 |
| 500 | Ga0496104_0157469 | 3300048907 | Bacteria | 2179 |
| 501 | Ga0496105_0004281 | 3300048908 | Bacteria | 10741 |
| 502 | Ga0496105_0004966 | 3300048908 | Bacteria | 10056 |
| 503 | Ga0496105_0021299 | 3300048908 | Bacteria | 5245 |
| 504 | Ga0496105_0086357 | 3300048908 | Bacteria | 2593 |
| 505 | Ga0496106_0184562 | 3300048909 | Unclassified | 1657 |
| 506 | Ga0496106_0396019 | 3300048909 | Bacteria | 1110 |
| 507 | Ga0496107_0056669 | 3300048910 | Bacteria | 2832 |
| 508 | Ga0496107_0089025 | 3300048910 | Bacteria | 2254 |
| 509 | Ga0496107_0190218 | 3300048910 | Bacteria | 1525 |
| 510 | Ga0496108_0005783 | 3300048911 | Bacteria | 10018 |
| 511 | Ga0496108_0008784 | 3300048911 | Bacteria | 8191 |
| 512 | Ga0496108_0356810 | 3300048911 | Bacteria | 1276 |
| 513 | Ga0496108_0411891 | 3300048911 | Bacteria | 1180 |
| 514 | Ga0496109_0012652 | 3300048912 | Bacteria | 7289 |
| 515 | Ga0496109_0055216 | 3300048912 | Bacteria | 3623 |
| 516 | Ga0496109_0068252 | 3300048912 | Bacteria | 3259 |
| 517 | Ga0496109_0280886 | 3300048912 | Bacteria | 1569 |
| 518 | Ga0496109_0424163 | 3300048912 | Bacteria | 1256 |
| 519 | Ga0496109_0550347 | 3300048912 | Bacteria | 1088 |
| 520 | Ga0496109_0833664 | 3300048912 | Unclassified | 860 |
| 521 | Ga0496109_0840038 | 3300048912 | Bacteria | 856 |
| 522 | Ga0496110_0208367 | 3300048913 | Bacteria | 1777 |
| 523 | Ga0496110_0666786 | 3300048913 | Bacteria | 940 |
| 524 | Ga0496111_0049379 | 3300048914 | Bacteria | 3034 |
| 525 | Ga0496111_0067617 | 3300048914 | Bacteria | 2596 |
| 526 | Ga0496111_0982622 | 3300048914 | Bacteria | 605 |
| 527 | Ga0496112_0176334 | 3300048915 | Bacteria | 2102 |
| 528 | Ga0496112_0296151 | 3300048915 | Bacteria | 1564 |
| 529 | Ga0496112_0598514 | 3300048915 | Bacteria | 1034 |
| 530 | Ga0496113_0019636 | 3300048916 | Bacteria | 4731 |
| 531 | Ga0496113_0120797 | 3300048916 | Bacteria | 2048 |
| 532 | Ga0496113_0153644 | 3300048916 | Bacteria | 1817 |
| 533 | Ga0496113_0386660 | 3300048916 | Bacteria | 1123 |
| 534 | Ga0496113_0783262 | 3300048916 | Bacteria | 758 |
| 535 | Ga0496114_0122336 | 3300048917 | Bacteria | 2239 |
| 536 | Ga0496114_0231967 | 3300048917 | Bacteria | 1622 |
| 537 | Ga0496115_0035995 | 3300048918 | Bacteria | 3918 |
| 538 | Ga0496115_0041338 | 3300048918 | Bacteria | 3669 |
| 539 | Ga0496115_0088486 | 3300048918 | Bacteria | 2528 |
| 540 | Ga0496115_0478835 | 3300048918 | Bacteria | 1003 |
| 541 | Ga0501040_0375131 | 3300049576 | Bacteria | 1020 |
| 542 | Ga0501040_1054099 | 3300049576 | Bacteria | 590 |
| 543 | Ga0501047_0073280 | 3300049581 | Bacteria | 3297 |
| 544 | Ga0501067_0002687 | 3300049583 | Bacteria | 9820 |
| 545 | Ga0501067_0020950 | 3300049583 | Bacteria | 3617 |
| 546 | Ga0501067_0031748 | 3300049583 | Bacteria | 2931 |
| 547 | Ga0501067_0060497 | 3300049583 | Unclassified | 2096 |
| 548 | Ga0501068_0018353 | 3300049584 | Bacteria | 4051 |
| 549 | Ga0501068_0328462 | 3300049584 | Bacteria | 981 |
| 550 | Ga0501069_0001737 | 3300049585 | Bacteria | 10870 |
| 551 | Ga0501069_0009778 | 3300049585 | Bacteria | 5069 |
| 552 | Ga0501069_0065803 | 3300049585 | Bacteria | 2027 |
| 553 | Ga0501070_0138846 | 3300049586 | Bacteria | 2007 |
| 554 | Ga0501070_1391165 | 3300049586 | Unclassified | 533 |
| 555 | Ga0501071_1019015 | 3300049587 | Bacteria | 639 |
| 556 | Ga0501072_0255024 | 3300049588 | Bacteria | 1397 |
| 557 | Ga0501073_1278461 | 3300049589 | Bacteria | 503 |
| 558 | Ga0501075_0288237 | 3300049591 | Bacteria | 1251 |
| 559 | Ga0501076_0182966 | 3300049592 | Bacteria | 1709 |
| 560 | Ga0501080_0589336 | 3300049742 | Bacteria | 988 |
| 561 | Ga0501080_1692176 | 3300049742 | Unclassified | 534 |
| 562 | nmdc:mga00v17_51010_c1 | 3300050491 | Bacteria | 2515 |
| 563 | nmdc:mga0rr50_505101_c1 | 3300050513 | Bacteria | 1028 |
| 564 | Ga0495601_0000983 | 3300053077 | Bacteria | 15574 |
| 565 | Ga0495601_0104266 | 3300053077 | Bacteria | 1833 |
| 566 | Ga0495601_0106827 | 3300053077 | Unclassified | 1810 |
| 567 | Ga0495601_0398422 | 3300053077 | Bacteria | 892 |
| 568 | Ga0495612_0084162 | 3300053078 | Bacteria | 1339 |
| 569 | Ga0495612_0358996 | 3300053078 | Bacteria | 658 |
| 570 | Ga0495595_0002532 | 3300053084 | Bacteria | 7168 |
| 571 | Ga0495595_0008406 | 3300053084 | Bacteria | 4233 |
| 572 | Ga0495619_0003772 | 3300053085 | Bacteria | 9744 |
| 573 | Ga0495619_0025735 | 3300053085 | Bacteria | 3781 |
| 574 | Ga0495619_0443274 | 3300053085 | Bacteria | 895 |
| 575 | Ga0495619_0651618 | 3300053085 | Bacteria | 718 |
| 576 | Ga0495619_0879457 | 3300053085 | Unclassified | 603 |
| 577 | Ga0495619_0915616 | 3300053085 | Bacteria | 589 |
| 578 | Ga0501084_1303273 | 3300054114 | Bacteria | 609 |
| 579 | Ga0501082_1692672 | 3300060353 | Unclassified | 552 |
| 580 | Ga0466962_0004435 | 3300061719 | Bacteria | 6725 |
| 581 | Ga0466962_0626642 | 3300061719 | Bacteria | 549 |
| 582 | Ga0530510_0015632 | 3300061734 | Bacteria | 5363 |
| 583 | Ga0530510_0183466 | 3300061734 | Bacteria | 1552 |
| 584 | Ga0530510_0405787 | 3300061734 | Bacteria | 1028 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100033009 | Ga0075435_1000330094 | 98 |
| 2 | 3300028577 | Ga0265318_10012770 | Ga0265318_100127703 | 99 |
| 3 | 3300028556 | Ga0265337_1003753 | Ga0265337_10037531 | 108 |
| 4 | 3300028558 | Ga0265326_10027996 | Ga0265326_100279961 | 108 |
| 5 | 3300028563 | Ga0265319_1002042 | Ga0265319_10020425 | 108 |
| 6 | 3300028573 | Ga0265334_10032888 | Ga0265334_100328882 | 108 |
| 7 | 3300028800 | Ga0265338_10011608 | Ga0265338_100116085 | 108 |
| 8 | 3300005327 | Ga0070658_10025348 | Ga0070658_100253485 | 111 |
| 9 | 3300005329 | Ga0070683_100056584 | Ga0070683_1000565844 | 111 |
| 10 | 3300005530 | Ga0070679_100301259 | Ga0070679_1003012592 | 111 |
| 11 | 3300005841 | Ga0068863_100064638 | Ga0068863_1000646384 | 111 |
| 12 | 3300009093 | Ga0105240_10047426 | Ga0105240_100474262 | 111 |
| 13 | 3300009098 | Ga0105245_10259688 | Ga0105245_102596883 | 111 |
| 14 | 3300013104 | Ga0157370_10064913 | Ga0157370_100649133 | 111 |
| 15 | 3300014497 | Ga0182008_10451297 | Ga0182008_104512971 | 111 |
| 16 | 3300025909 | Ga0207705_10051423 | Ga0207705_100514233 | 111 |
| 17 | 3300025921 | Ga0207652_11714794 | Ga0207652_117147942 | 111 |
| 18 | 3300025944 | Ga0207661_10085383 | Ga0207661_100853833 | 111 |
| 19 | 3300028556 | Ga0265337_1013098 | Ga0265337_10130983 | 111 |
| 20 | 3300028558 | Ga0265326_10000698 | Ga0265326_100006987 | 111 |
| 21 | 3300028558 | Ga0265326_10007464 | Ga0265326_100074645 | 111 |
| 22 | 3300028563 | Ga0265319_1000067 | Ga0265319_100006721 | 111 |
| 23 | 3300028563 | Ga0265319_1000408 | Ga0265319_100040823 | 111 |
| 24 | 3300028563 | Ga0265319_1012536 | Ga0265319_10125363 | 111 |
| 25 | 3300028563 | Ga0265319_1053723 | Ga0265319_10537232 | 111 |
| 26 | 3300028573 | Ga0265334_10007750 | Ga0265334_100077503 | 111 |
| 27 | 3300028577 | Ga0265318_10006922 | Ga0265318_100069223 | 111 |
| 28 | 3300028577 | Ga0265318_10148189 | Ga0265318_101481892 | 111 |
| 29 | 3300028653 | Ga0265323_10000491 | Ga0265323_1000049122 | 111 |
| 30 | 3300028654 | Ga0265322_10000759 | Ga0265322_100007594 | 111 |
| 31 | 3300028666 | Ga0265336_10000067 | Ga0265336_1000006720 | 111 |
| 32 | 3300028666 | Ga0265336_10118795 | Ga0265336_101187952 | 111 |
| 33 | 3300028800 | Ga0265338_10000126 | Ga0265338_1000012676 | 111 |
| 34 | 3300028800 | Ga0265338_10009097 | Ga0265338_100090973 | 111 |
| 35 | 3300028800 | Ga0265338_10009434 | Ga0265338_100094348 | 111 |
| 36 | 3300028800 | Ga0265338_10014199 | Ga0265338_100141993 | 111 |
| 37 | 3300029957 | Ga0265324_10002147 | Ga0265324_100021478 | 111 |
| 38 | 3300029957 | Ga0265324_10008640 | Ga0265324_100086401 | 111 |
| 39 | 3300029957 | Ga0265324_10053614 | Ga0265324_100536143 | 111 |
| 40 | 3300031235 | Ga0265330_10000150 | Ga0265330_1000015033 | 111 |
| 41 | 3300031238 | Ga0265332_10000306 | Ga0265332_1000030624 | 111 |
| 42 | 3300031239 | Ga0265328_10008178 | Ga0265328_100081785 | 111 |
| 43 | 3300031240 | Ga0265320_10000275 | Ga0265320_1000027523 | 111 |
| 44 | 3300031240 | Ga0265320_10005196 | Ga0265320_100051968 | 111 |
| 45 | 3300031241 | Ga0265325_10005197 | Ga0265325_1000519710 | 111 |
| 46 | 3300031241 | Ga0265325_10123670 | Ga0265325_101236702 | 111 |
| 47 | 3300031242 | Ga0265329_10000181 | Ga0265329_1000018121 | 111 |
| 48 | 3300031247 | Ga0265340_10008924 | Ga0265340_100089243 | 111 |
| 49 | 3300031247 | Ga0265340_10029483 | Ga0265340_100294833 | 111 |
| 50 | 3300031249 | Ga0265339_10000097 | Ga0265339_1000009723 | 111 |
| 51 | 3300031249 | Ga0265339_10056040 | Ga0265339_100560402 | 111 |
| 52 | 3300031250 | Ga0265331_10000322 | Ga0265331_1000032232 | 111 |
| 53 | 3300031250 | Ga0265331_10193979 | Ga0265331_101939792 | 111 |
| 54 | 3300031344 | Ga0265316_10001497 | Ga0265316_1000149722 | 111 |
| 55 | 3300031344 | Ga0265316_10002531 | Ga0265316_100025317 | 111 |
| 56 | 3300031595 | Ga0265313_10001271 | Ga0265313_100012718 | 111 |
| 57 | 3300031595 | Ga0265313_10049400 | Ga0265313_100494003 | 111 |
| 58 | 3300031711 | Ga0265314_10000337 | Ga0265314_1000033722 | 111 |
| 59 | 3300031712 | Ga0265342_10000999 | Ga0265342_1000099910 | 111 |
| 60 | 3300031712 | Ga0265342_10001401 | Ga0265342_1000140112 | 111 |
| 61 | 3300035398 | Ga0316574_0227821 | Ga0316574_0227821_340_690 | 111 |
| 62 | 3300037312 | Ga0395899_0428366 | Ga0395899_0428366_286_624 | 111 |
| 63 | 3300037418 | Ga0395900_0017157 | Ga0395900_0017157_91_429 | 111 |
| 64 | 3300037466 | Ga0395898_0252650 | Ga0395898_0252650_1174_1512 | 111 |
| 65 | 3300038443 | Ga0395901_0010671 | Ga0395901_0010671_7679_8017 | 111 |
| 66 | 3300048909 | Ga0496106_0184562 | Ga0496106_0184562_738_1073 | 111 |
| 67 | 3300048918 | Ga0496115_0478835 | Ga0496115_0478835_134_472 | 111 |
| 68 | 3300049583 | Ga0501067_0002687 | Ga0501067_0002687_5894_6241 | 111 |
| 69 | 3300049583 | Ga0501067_0031748 | Ga0501067_0031748_1107_1442 | 111 |
| 70 | 3300049583 | Ga0501067_0060497 | Ga0501067_0060497_1344_1679 | 111 |
| 71 | 3300049584 | Ga0501068_0018353 | Ga0501068_0018353_1362_1697 | 111 |
| 72 | 3300049585 | Ga0501069_0001737 | Ga0501069_0001737_5778_6125 | 111 |
| 73 | 3300049585 | Ga0501069_0065803 | Ga0501069_0065803_682_1017 | 111 |
| 74 | 3300049586 | Ga0501070_0138846 | Ga0501070_0138846_1566_1913 | 111 |
| 75 | 3300061734 | Ga0530510_0015632 | Ga0530510_0015632_2771_3118 | 111 |
| 76 | 3300061734 | Ga0530510_0405787 | Ga0530510_0405787_288_623 | 111 |
| 77 | 3300002077 | JGI24744J21845_10022103 | JGI24744J21845_100221032 | 112 |
| 78 | 3300003323 | rootH1_10082901 | rootH1_100829013 | 112 |
| 79 | 3300005327 | Ga0070658_10034961 | Ga0070658_100349616 | 112 |
| 80 | 3300005327 | Ga0070658_11078098 | Ga0070658_110780981 | 112 |
| 81 | 3300005329 | Ga0070683_100020638 | Ga0070683_1000206384 | 112 |
| 82 | 3300005336 | Ga0070680_100046229 | Ga0070680_1000462295 | 112 |
| 83 | 3300005337 | Ga0070682_100111523 | Ga0070682_1001115233 | 112 |
| 84 | 3300005339 | Ga0070660_100048434 | Ga0070660_1000484345 | 112 |
| 85 | 3300005341 | Ga0070691_10132846 | Ga0070691_101328463 | 112 |
| 86 | 3300005344 | Ga0070661_100145927 | Ga0070661_1001459272 | 112 |
| 87 | 3300005366 | Ga0070659_100053595 | Ga0070659_1000535952 | 112 |
| 88 | 3300005435 | Ga0070714_100001084 | Ga0070714_10000108418 | 112 |
| 89 | 3300005435 | Ga0070714_100122887 | Ga0070714_1001228874 | 112 |
| 90 | 3300005435 | Ga0070714_100809736 | Ga0070714_1008097362 | 112 |
| 91 | 3300005436 | Ga0070713_100174140 | Ga0070713_1001741403 | 112 |
| 92 | 3300005437 | Ga0070710_10002369 | Ga0070710_100023699 | 112 |
| 93 | 3300005437 | Ga0070710_10561056 | Ga0070710_105610562 | 112 |
| 94 | 3300005456 | Ga0070678_101198291 | Ga0070678_1011982912 | 112 |
| 95 | 3300005458 | Ga0070681_10105612 | Ga0070681_101056123 | 112 |
| 96 | 3300005467 | Ga0070706_101522081 | Ga0070706_1015220811 | 112 |
| 97 | 3300005530 | Ga0070679_100340311 | Ga0070679_1003403112 | 112 |
| 98 | 3300005535 | Ga0070684_100021102 | Ga0070684_1000211024 | 112 |
| 99 | 3300005535 | Ga0070684_100192086 | Ga0070684_1001920862 | 112 |
| 100 | 3300005539 | Ga0068853_102014412 | Ga0068853_1020144121 | 112 |
| 101 | 3300005545 | Ga0070695_100932745 | Ga0070695_1009327452 | 112 |
| 102 | 3300005547 | Ga0070693_100118814 | Ga0070693_1001188142 | 112 |
| 103 | 3300005563 | Ga0068855_100046564 | Ga0068855_1000465646 | 112 |
| 104 | 3300005577 | Ga0068857_100785189 | Ga0068857_1007851892 | 112 |
| 105 | 3300005614 | Ga0068856_100063637 | Ga0068856_1000636373 | 112 |
| 106 | 3300005614 | Ga0068856_100195891 | Ga0068856_1001958912 | 112 |
| 107 | 3300005615 | Ga0070702_100835118 | Ga0070702_1008351182 | 112 |
| 108 | 3300005616 | Ga0068852_100218638 | Ga0068852_1002186383 | 112 |
| 109 | 3300006028 | Ga0070717_10008478 | Ga0070717_100084785 | 112 |
| 110 | 3300006028 | Ga0070717_10022452 | Ga0070717_100224525 | 112 |
| 111 | 3300006028 | Ga0070717_10033324 | Ga0070717_100333243 | 112 |
| 112 | 3300006173 | Ga0070716_100166880 | Ga0070716_1001668803 | 112 |
| 113 | 3300006175 | Ga0070712_100071321 | Ga0070712_1000713213 | 112 |
| 114 | 3300006175 | Ga0070712_101219126 | Ga0070712_1012191261 | 112 |
| 115 | 3300006881 | Ga0068865_100725637 | Ga0068865_1007256372 | 112 |
| 116 | 3300006914 | Ga0075436_100252464 | Ga0075436_1002524642 | 112 |
| 117 | 3300009098 | Ga0105245_10504591 | Ga0105245_105045912 | 112 |
| 118 | 3300009551 | Ga0105238_10078199 | Ga0105238_100781995 | 112 |
| 119 | 3300009551 | Ga0105238_12429870 | Ga0105238_124298702 | 112 |
| 120 | 3300010375 | Ga0105239_10362992 | Ga0105239_103629923 | 112 |
| 121 | 3300013104 | Ga0157370_11602700 | Ga0157370_116027002 | 112 |
| 122 | 3300013105 | Ga0157369_10057858 | Ga0157369_100578583 | 112 |
| 123 | 3300013105 | Ga0157369_10424013 | Ga0157369_104240132 | 112 |
| 124 | 3300013296 | Ga0157374_10251669 | Ga0157374_102516694 | 112 |
| 125 | 3300013296 | Ga0157374_11161348 | Ga0157374_111613481 | 112 |
| 126 | 3300013307 | Ga0157372_10174350 | Ga0157372_101743502 | 112 |
| 127 | 3300013307 | Ga0157372_10683535 | Ga0157372_106835353 | 112 |
| 128 | 3300014497 | Ga0182008_10240795 | Ga0182008_102407952 | 112 |
| 129 | 3300014745 | Ga0157377_10644330 | Ga0157377_106443302 | 112 |
| 130 | 3300014969 | Ga0157376_10100171 | Ga0157376_101001713 | 112 |
| 131 | 3300015262 | Ga0182007_10215731 | Ga0182007_102157311 | 112 |
| 132 | 3300017792 | Ga0163161_11544454 | Ga0163161_115444542 | 112 |
| 133 | 3300020070 | Ga0206356_11138035 | Ga0206356_111380352 | 112 |
| 134 | 3300025898 | Ga0207692_10094975 | Ga0207692_100949753 | 112 |
| 135 | 3300025898 | Ga0207692_10135079 | Ga0207692_101350792 | 112 |
| 136 | 3300025906 | Ga0207699_10388100 | Ga0207699_103881002 | 112 |
| 137 | 3300025906 | Ga0207699_10422622 | Ga0207699_104226222 | 112 |
| 138 | 3300025909 | Ga0207705_10194384 | Ga0207705_101943844 | 112 |
| 139 | 3300025912 | Ga0207707_10271357 | Ga0207707_102713573 | 112 |
| 140 | 3300025915 | Ga0207693_10008397 | Ga0207693_100083974 | 112 |
| 141 | 3300025916 | Ga0207663_10013008 | Ga0207663_100130083 | 112 |
| 142 | 3300025917 | Ga0207660_10183966 | Ga0207660_101839662 | 112 |
| 143 | 3300025919 | Ga0207657_10014505 | Ga0207657_100145055 | 112 |
| 144 | 3300025920 | Ga0207649_10212791 | Ga0207649_102127912 | 112 |
| 145 | 3300025921 | Ga0207652_10536487 | Ga0207652_105364872 | 112 |
| 146 | 3300025924 | Ga0207694_10102522 | Ga0207694_101025223 | 112 |
| 147 | 3300025928 | Ga0207700_10005417 | Ga0207700_100054178 | 112 |
| 148 | 3300025929 | Ga0207664_10192035 | Ga0207664_101920352 | 112 |
| 149 | 3300025929 | Ga0207664_10393757 | Ga0207664_103937573 | 112 |
| 150 | 3300025932 | Ga0207690_10066178 | Ga0207690_100661784 | 112 |
| 151 | 3300025938 | Ga0207704_10399442 | Ga0207704_103994422 | 112 |
| 152 | 3300025939 | Ga0207665_10081749 | Ga0207665_100817494 | 112 |
| 153 | 3300025944 | Ga0207661_10021882 | Ga0207661_100218826 | 112 |
| 154 | 3300025945 | Ga0207679_10734249 | Ga0207679_107342492 | 112 |
| 155 | 3300025949 | Ga0207667_10571068 | Ga0207667_105710683 | 112 |
| 156 | 3300026078 | Ga0207702_10092963 | Ga0207702_100929634 | 112 |
| 157 | 3300026116 | Ga0207674_10319859 | Ga0207674_103198592 | 112 |
| 158 | 3300028563 | Ga0265319_1256639 | Ga0265319_12566392 | 112 |
| 159 | 3300028654 | Ga0265322_10043357 | Ga0265322_100433571 | 112 |
| 160 | 3300029957 | Ga0265324_10283562 | Ga0265324_102835621 | 112 |
| 161 | 3300031728 | Ga0316578_10430808 | Ga0316578_104308082 | 112 |
| 162 | 3300035119 | Ga0373956_0585789 | Ga0373956_0585789_39_377 | 112 |
| 163 | 3300035120 | Ga0373957_0125300 | Ga0373957_0125300_580_918 | 112 |
| 164 | 3300035170 | Ga0373943_0697530 | Ga0373943_0697530_102_440 | 112 |
| 165 | 3300035172 | Ga0373955_0584515 | Ga0373955_0584515_175_513 | 112 |
| 166 | 3300035724 | Ga0373933_0625578 | Ga0373933_0625578_17_355 | 112 |
| 167 | 3300036401 | Ga0373937_0020040 | Ga0373937_0020040_2924_3262 | 112 |
| 168 | 3300037068 | Ga0373925_0252810 | Ga0373925_0252810_921_1265 | 112 |
| 169 | 3300037418 | Ga0395900_1802112 | Ga0395900_1802112_127_465 | 112 |
| 170 | 3300037466 | Ga0395898_0565211 | Ga0395898_0565211_169_507 | 112 |
| 171 | 3300037466 | Ga0395898_1529388 | Ga0395898_1529388_138_476 | 112 |
| 172 | 3300041451 | Ga0451791_0561320 | Ga0451791_0561320_134_481 | 112 |
| 173 | 3300041486 | Ga0451807_0123002 | Ga0451807_0123002_56_403 | 112 |
| 174 | 3300041496 | Ga0451839_1262289 | Ga0451839_1262289_66_404 | 112 |
| 175 | 3300041512 | Ga0451853_1143151 | Ga0451853_1143151_105_452 | 112 |
| 176 | 3300044658 | Ga0466972_0056516 | Ga0466972_0056516_363_701 | 112 |
| 177 | 3300044683 | Ga0466965_0015015 | Ga0466965_0015015_270_608 | 112 |
| 178 | 3300044683 | Ga0466965_0135246 | Ga0466965_0135246_151_489 | 112 |
| 179 | 3300044684 | Ga0466966_0662914 | Ga0466966_0662914_192_530 | 112 |
| 180 | 3300044693 | Ga0466961_0265145 | Ga0466961_0265145_223_561 | 112 |
| 181 | 3300044693 | Ga0466961_0314462 | Ga0466961_0314462_514_852 | 112 |
| 182 | 3300044694 | Ga0466963_0000430 | Ga0466963_0000430_10933_11271 | 112 |
| 183 | 3300044694 | Ga0466963_0008450 | Ga0466963_0008450_863_1201 | 112 |
| 184 | 3300044694 | Ga0466963_0008744 | Ga0466963_0008744_1212_1550 | 112 |
| 185 | 3300044694 | Ga0466963_0010043 | Ga0466963_0010043_2729_3067 | 112 |
| 186 | 3300044694 | Ga0466963_0012753 | Ga0466963_0012753_2572_2910 | 112 |
| 187 | 3300044694 | Ga0466963_0040503 | Ga0466963_0040503_398_736 | 112 |
| 188 | 3300044694 | Ga0466963_0051773 | Ga0466963_0051773_2228_2566 | 112 |
| 189 | 3300044694 | Ga0466963_0111939 | Ga0466963_0111939_1477_1815 | 112 |
| 190 | 3300044706 | Ga0466964_0006969 | Ga0466964_0006969_1199_1537 | 112 |
| 191 | 3300044706 | Ga0466964_0023847 | Ga0466964_0023847_288_626 | 112 |
| 192 | 3300044706 | Ga0466964_0107014 | Ga0466964_0107014_504_842 | 112 |
| 193 | 3300044706 | Ga0466964_0119350 | Ga0466964_0119350_127_465 | 112 |
| 194 | 3300044706 | Ga0466964_0121091 | Ga0466964_0121091_408_755 | 112 |
| 195 | 3300044706 | Ga0466964_0156318 | Ga0466964_0156318_280_618 | 112 |
| 196 | 3300044706 | Ga0466964_0207970 | Ga0466964_0207970_120_458 | 112 |
| 197 | 3300044706 | Ga0466964_0735132 | Ga0466964_0735132_22_360 | 112 |
| 198 | 3300044712 | Ga0453684_1161235 | Ga0453684_1161235_311_649 | 112 |
| 199 | 3300044719 | Ga0466971_0000571 | Ga0466971_0000571_7198_7536 | 112 |
| 200 | 3300044719 | Ga0466971_0015039 | Ga0466971_0015039_2114_2452 | 112 |
| 201 | 3300044719 | Ga0466971_0089392 | Ga0466971_0089392_996_1334 | 112 |
| 202 | 3300044719 | Ga0466971_0134837 | Ga0466971_0134837_106_444 | 112 |
| 203 | 3300044735 | Ga0466968_0001271 | Ga0466968_0001271_5874_6212 | 112 |
| 204 | 3300044735 | Ga0466968_0014588 | Ga0466968_0014588_2504_2842 | 112 |
| 205 | 3300044735 | Ga0466968_0059896 | Ga0466968_0059896_773_1111 | 112 |
| 206 | 3300044735 | Ga0466968_0124558 | Ga0466968_0124558_794_1132 | 112 |
| 207 | 3300044735 | Ga0466968_0661833 | Ga0466968_0661833_68_406 | 112 |
| 208 | 3300044765 | Ga0466970_0041403 | Ga0466970_0041403_77_415 | 112 |
| 209 | 3300044765 | Ga0466970_0046352 | Ga0466970_0046352_1217_1555 | 112 |
| 210 | 3300044842 | Ga0466957_0001386 | Ga0466957_0001386_743_1081 | 112 |
| 211 | 3300044842 | Ga0466957_0024346 | Ga0466957_0024346_1162_1500 | 112 |
| 212 | 3300044842 | Ga0466957_0066360 | Ga0466957_0066360_592_930 | 112 |
| 213 | 3300044842 | Ga0466957_0241166 | Ga0466957_0241166_728_1066 | 112 |
| 214 | 3300044842 | Ga0466957_0799746 | Ga0466957_0799746_14_352 | 112 |
| 215 | 3300044901 | Ga0466960_0005128 | Ga0466960_0005128_1603_1941 | 112 |
| 216 | 3300044901 | Ga0466960_0093661 | Ga0466960_0093661_959_1297 | 112 |
| 217 | 3300045049 | Ga0466959_0004364 | Ga0466959_0004364_7512_7850 | 112 |
| 218 | 3300045049 | Ga0466959_0085927 | Ga0466959_0085927_274_612 | 112 |
| 219 | 3300045049 | Ga0466959_0447148 | Ga0466959_0447148_179_517 | 112 |
| 220 | 3300045836 | Ga0466958_0007198 | Ga0466958_0007198_4346_4684 | 112 |
| 221 | 3300045836 | Ga0466958_0022021 | Ga0466958_0022021_1148_1486 | 112 |
| 222 | 3300045836 | Ga0466958_0065326 | Ga0466958_0065326_604_942 | 112 |
| 223 | 3300045836 | Ga0466958_0089702 | Ga0466958_0089702_1148_1486 | 112 |
| 224 | 3300045836 | Ga0466958_0093100 | Ga0466958_0093100_317_655 | 112 |
| 225 | 3300045976 | Ga0466967_0006144 | Ga0466967_0006144_4466_4804 | 112 |
| 226 | 3300045976 | Ga0466967_0016339 | Ga0466967_0016339_3346_3684 | 112 |
| 227 | 3300045976 | Ga0466967_0019641 | Ga0466967_0019641_310_648 | 112 |
| 228 | 3300045976 | Ga0466967_0022601 | Ga0466967_0022601_2348_2686 | 112 |
| 229 | 3300045976 | Ga0466967_0041398 | Ga0466967_0041398_2596_2934 | 112 |
| 230 | 3300045976 | Ga0466967_0096844 | Ga0466967_0096844_570_908 | 112 |
| 231 | 3300045976 | Ga0466967_0180391 | Ga0466967_0180391_441_779 | 112 |
| 232 | 3300045976 | Ga0466967_0311815 | Ga0466967_0311815_1142_1480 | 112 |
| 233 | 3300045976 | Ga0466967_0503714 | Ga0466967_0503714_132_470 | 112 |
| 234 | 3300046454 | Ga0495592_0000125 | Ga0495592_0000125_60816_61154 | 112 |
| 235 | 3300046454 | Ga0495592_0070954 | Ga0495592_0070954_1436_1774 | 112 |
| 236 | 3300046454 | Ga0495592_0171381 | Ga0495592_0171381_941_1279 | 112 |
| 237 | 3300046455 | Ga0495603_0005954 | Ga0495603_0005954_5122_5463 | 112 |
| 238 | 3300046455 | Ga0495603_0153756 | Ga0495603_0153756_794_1132 | 112 |
| 239 | 3300046461 | Ga0495641_0016970 | Ga0495641_0016970_671_1012 | 112 |
| 240 | 3300046461 | Ga0495641_0042670 | Ga0495641_0042670_442_780 | 112 |
| 241 | 3300046461 | Ga0495641_0368857 | Ga0495641_0368857_177_515 | 112 |
| 242 | 3300046462 | Ga0495651_0000104 | Ga0495651_0000104_10994_11332 | 112 |
| 243 | 3300046462 | Ga0495651_0002454 | Ga0495651_0002454_8015_8353 | 112 |
| 244 | 3300046463 | Ga0495653_0004604 | Ga0495653_0004604_5760_6098 | 112 |
| 245 | 3300046463 | Ga0495653_0005005 | Ga0495653_0005005_3472_3810 | 112 |
| 246 | 3300046463 | Ga0495653_0575691 | Ga0495653_0575691_281_619 | 112 |
| 247 | 3300046463 | Ga0495653_0692850 | Ga0495653_0692850_178_516 | 112 |
| 248 | 3300046473 | Ga0495582_0086405 | Ga0495582_0086405_662_1003 | 112 |
| 249 | 3300046473 | Ga0495582_0215053 | Ga0495582_0215053_26_364 | 112 |
| 250 | 3300046473 | Ga0495582_0325359 | Ga0495582_0325359_84_428 | 112 |
| 251 | 3300046474 | Ga0495605_0018697 | Ga0495605_0018697_175_513 | 112 |
| 252 | 3300046476 | Ga0495662_0111343 | Ga0495662_0111343_972_1310 | 112 |
| 253 | 3300046477 | Ga0495664_0205705 | Ga0495664_0205705_472_810 | 112 |
| 254 | 3300046477 | Ga0495664_0534164 | Ga0495664_0534164_92_430 | 112 |
| 255 | 3300046492 | Ga0495585_0400382 | Ga0495585_0400382_131_469 | 112 |
| 256 | 3300046499 | Ga0495594_0346948 | Ga0495594_0346948_27_365 | 112 |
| 257 | 3300046500 | Ga0495596_0053900 | Ga0495596_0053900_312_650 | 112 |
| 258 | 3300046501 | Ga0495607_0019154 | Ga0495607_0019154_235_573 | 112 |
| 259 | 3300046511 | Ga0495608_0000595 | Ga0495608_0000595_10558_10896 | 112 |
| 260 | 3300046511 | Ga0495608_0017819 | Ga0495608_0017819_3421_3759 | 112 |
| 261 | 3300046511 | Ga0495608_0055966 | Ga0495608_0055966_770_1108 | 112 |
| 262 | 3300046514 | Ga0495618_0006629 | Ga0495618_0006629_3609_3947 | 112 |
| 263 | 3300046514 | Ga0495618_0161361 | Ga0495618_0161361_73_411 | 112 |
| 264 | 3300046516 | Ga0495628_0000040 | Ga0495628_0000040_30351_30689 | 112 |
| 265 | 3300046516 | Ga0495628_0040955 | Ga0495628_0040955_168_506 | 112 |
| 266 | 3300046516 | Ga0495628_0312062 | Ga0495628_0312062_692_1030 | 112 |
| 267 | 3300046517 | Ga0495630_0028971 | Ga0495630_0028971_3347_3685 | 112 |
| 268 | 3300046517 | Ga0495630_0226861 | Ga0495630_0226861_375_713 | 112 |
| 269 | 3300046518 | Ga0495631_0128527 | Ga0495631_0128527_127_465 | 112 |
| 270 | 3300046520 | Ga0495637_0262360 | Ga0495637_0262360_44_382 | 112 |
| 271 | 3300046523 | Ga0495644_0003396 | Ga0495644_0003396_4803_5141 | 112 |
| 272 | 3300046529 | Ga0495652_0000298 | Ga0495652_0000298_40378_40716 | 112 |
| 273 | 3300046529 | Ga0495652_0051510 | Ga0495652_0051510_2196_2534 | 112 |
| 274 | 3300046529 | Ga0495652_0126873 | Ga0495652_0126873_901_1239 | 112 |
| 275 | 3300046529 | Ga0495652_0150585 | Ga0495652_0150585_136_474 | 112 |
| 276 | 3300046533 | Ga0495640_0044854 | Ga0495640_0044854_476_814 | 112 |
| 277 | 3300046533 | Ga0495640_0400325 | Ga0495640_0400325_364_702 | 112 |
| 278 | 3300046535 | Ga0495586_0028540 | Ga0495586_0028540_638_976 | 112 |
| 279 | 3300046536 | Ga0495587_0000212 | Ga0495587_0000212_38239_38577 | 112 |
| 280 | 3300046536 | Ga0495587_0039869 | Ga0495587_0039869_2137_2475 | 112 |
| 281 | 3300046543 | Ga0495645_0000035 | Ga0495645_0000035_7549_7887 | 112 |
| 282 | 3300046543 | Ga0495645_0240680 | Ga0495645_0240680_533_871 | 112 |
| 283 | 3300046543 | Ga0495645_0403540 | Ga0495645_0403540_112_450 | 112 |
| 284 | 3300046558 | Ga0495633_0085483 | Ga0495633_0085483_980_1318 | 112 |
| 285 | 3300046559 | Ga0495667_0084109 | Ga0495667_0084109_1393_1731 | 112 |
| 286 | 3300046559 | Ga0495667_0151715 | Ga0495667_0151715_472_810 | 112 |
| 287 | 3300046559 | Ga0495667_0279664 | Ga0495667_0279664_65_403 | 112 |
| 288 | 3300046615 | Ga0495656_0003461 | Ga0495656_0003461_94_432 | 112 |
| 289 | 3300046642 | Ga0495634_0093851 | Ga0495634_0093851_1324_1662 | 112 |
| 290 | 3300046648 | Ga0495611_0219422 | Ga0495611_0219422_401_739 | 112 |
| 291 | 3300046663 | Ga0495635_0039927 | Ga0495635_0039927_2094_2432 | 112 |
| 292 | 3300046663 | Ga0495635_0246121 | Ga0495635_0246121_808_1146 | 112 |
| 293 | 3300046664 | Ga0495659_0011040 | Ga0495659_0011040_1630_1968 | 112 |
| 294 | 3300046675 | Ga0495657_0002891 | Ga0495657_0002891_2898_3236 | 112 |
| 295 | 3300046675 | Ga0495657_0046888 | Ga0495657_0046888_1511_1849 | 112 |
| 296 | 3300046675 | Ga0495657_0060447 | Ga0495657_0060447_117_455 | 112 |
| 297 | 3300046675 | Ga0495657_0122223 | Ga0495657_0122223_288_626 | 112 |
| 298 | 3300046675 | Ga0495657_0145568 | Ga0495657_0145568_804_1142 | 112 |
| 299 | 3300046678 | Ga0495599_0000009 | Ga0495599_0000009_18729_19067 | 112 |
| 300 | 3300046678 | Ga0495599_0007227 | Ga0495599_0007227_244_582 | 112 |
| 301 | 3300046678 | Ga0495599_0520074 | Ga0495599_0520074_148_486 | 112 |
| 302 | 3300046679 | Ga0495623_0001465 | Ga0495623_0001465_4170_4508 | 112 |
| 303 | 3300046679 | Ga0495623_0216639 | Ga0495623_0216639_184_522 | 112 |
| 304 | 3300046680 | Ga0495646_0006560 | Ga0495646_0006560_4201_4539 | 112 |
| 305 | 3300046680 | Ga0495646_0342497 | Ga0495646_0342497_319_657 | 112 |
| 306 | 3300046681 | Ga0495647_0042402 | Ga0495647_0042402_806_1144 | 112 |
| 307 | 3300046681 | Ga0495647_0088988 | Ga0495647_0088988_729_1067 | 112 |
| 308 | 3300046683 | Ga0495658_0012076 | Ga0495658_0012076_553_891 | 112 |
| 309 | 3300046683 | Ga0495658_0111163 | Ga0495658_0111163_573_911 | 112 |
| 310 | 3300046684 | Ga0495669_0562664 | Ga0495669_0562664_26_364 | 112 |
| 311 | 3300046689 | Ga0495613_0017635 | Ga0495613_0017635_433_771 | 112 |
| 312 | 3300046689 | Ga0495613_0084261 | Ga0495613_0084261_603_941 | 112 |
| 313 | 3300046690 | Ga0495624_0024201 | Ga0495624_0024201_2682_3020 | 112 |
| 314 | 3300046794 | Ga0495589_0229501 | Ga0495589_0229501_116_454 | 112 |
| 315 | 3300046809 | Ga0495600_0459409 | Ga0495600_0459409_336_674 | 112 |
| 316 | 3300047315 | Ga0495581_0015527 | Ga0495581_0015527_1416_1754 | 112 |
| 317 | 3300047317 | Ga0495604_0000120 | Ga0495604_0000120_6512_6850 | 112 |
| 318 | 3300047317 | Ga0495604_0254492 | Ga0495604_0254492_423_761 | 112 |
| 319 | 3300047319 | Ga0495674_0087891 | Ga0495674_0087891_2105_2443 | 112 |
| 320 | 3300047319 | Ga0495674_0113279 | Ga0495674_0113279_1432_1770 | 112 |
| 321 | 3300047319 | Ga0495674_0399764 | Ga0495674_0399764_125_463 | 112 |
| 322 | 3300047321 | Ga0495676_0066924 | Ga0495676_0066924_1094_1432 | 112 |
| 323 | 3300047321 | Ga0495676_0333475 | Ga0495676_0333475_514_852 | 112 |
| 324 | 3300047321 | Ga0495676_0856271 | Ga0495676_0856271_24_362 | 112 |
| 325 | 3300047321 | Ga0495676_0936631 | Ga0495676_0936631_82_420 | 112 |
| 326 | 3300047322 | Ga0495680_0008617 | Ga0495680_0008617_7908_8246 | 112 |
| 327 | 3300047322 | Ga0495680_0013033 | Ga0495680_0013033_1055_1393 | 112 |
| 328 | 3300047322 | Ga0495680_0014726 | Ga0495680_0014726_4720_5058 | 112 |
| 329 | 3300047323 | Ga0495683_0309248 | Ga0495683_0309248_31_369 | 112 |
| 330 | 3300047444 | Ga0495675_0000137 | Ga0495675_0000137_3601_3939 | 112 |
| 331 | 3300047673 | Ga0495593_0220071 | Ga0495593_0220071_88_426 | 112 |
| 332 | 3300048088 | Ga0495602_0001635 | Ga0495602_0001635_18601_18939 | 112 |
| 333 | 3300048088 | Ga0495602_0055163 | Ga0495602_0055163_644_982 | 112 |
| 334 | 3300048904 | Ga0496101_0115934 | Ga0496101_0115934_107_445 | 112 |
| 335 | 3300048904 | Ga0496101_0122749 | Ga0496101_0122749_1186_1524 | 112 |
| 336 | 3300048904 | Ga0496101_0173891 | Ga0496101_0173891_1099_1446 | 112 |
| 337 | 3300048904 | Ga0496101_0561989 | Ga0496101_0561989_123_461 | 112 |
| 338 | 3300048905 | Ga0496102_0382910 | Ga0496102_0382910_227_565 | 112 |
| 339 | 3300048907 | Ga0496104_0008275 | Ga0496104_0008275_4276_4614 | 112 |
| 340 | 3300048907 | Ga0496104_0012649 | Ga0496104_0012649_6010_6348 | 112 |
| 341 | 3300048907 | Ga0496104_0127077 | Ga0496104_0127077_313_651 | 112 |
| 342 | 3300048908 | Ga0496105_0004966 | Ga0496105_0004966_1056_1394 | 112 |
| 343 | 3300048908 | Ga0496105_0021299 | Ga0496105_0021299_4005_4343 | 112 |
| 344 | 3300048908 | Ga0496105_0086357 | Ga0496105_0086357_1428_1766 | 112 |
| 345 | 3300048909 | Ga0496106_0396019 | Ga0496106_0396019_609_947 | 112 |
| 346 | 3300048910 | Ga0496107_0056669 | Ga0496107_0056669_884_1222 | 112 |
| 347 | 3300048910 | Ga0496107_0089025 | Ga0496107_0089025_85_423 | 112 |
| 348 | 3300048911 | Ga0496108_0005783 | Ga0496108_0005783_8551_8889 | 112 |
| 349 | 3300048911 | Ga0496108_0008784 | Ga0496108_0008784_2714_3052 | 112 |
| 350 | 3300048912 | Ga0496109_0055216 | Ga0496109_0055216_3064_3402 | 112 |
| 351 | 3300048912 | Ga0496109_0068252 | Ga0496109_0068252_2154_2492 | 112 |
| 352 | 3300048912 | Ga0496109_0280886 | Ga0496109_0280886_1089_1436 | 112 |
| 353 | 3300048912 | Ga0496109_0424163 | Ga0496109_0424163_747_1085 | 112 |
| 354 | 3300048912 | Ga0496109_0550347 | Ga0496109_0550347_340_678 | 112 |
| 355 | 3300048913 | Ga0496110_0208367 | Ga0496110_0208367_914_1261 | 112 |
| 356 | 3300048913 | Ga0496110_0666786 | Ga0496110_0666786_524_862 | 112 |
| 357 | 3300048914 | Ga0496111_0049379 | Ga0496111_0049379_25_363 | 112 |
| 358 | 3300048914 | Ga0496111_0067617 | Ga0496111_0067617_519_857 | 112 |
| 359 | 3300048914 | Ga0496111_0982622 | Ga0496111_0982622_29_367 | 112 |
| 360 | 3300048915 | Ga0496112_0176334 | Ga0496112_0176334_422_760 | 112 |
| 361 | 3300048915 | Ga0496112_0296151 | Ga0496112_0296151_986_1324 | 112 |
| 362 | 3300048916 | Ga0496113_0120797 | Ga0496113_0120797_117_455 | 112 |
| 363 | 3300048916 | Ga0496113_0153644 | Ga0496113_0153644_608_955 | 112 |
| 364 | 3300048916 | Ga0496113_0386660 | Ga0496113_0386660_613_951 | 112 |
| 365 | 3300048916 | Ga0496113_0783262 | Ga0496113_0783262_377_715 | 112 |
| 366 | 3300048917 | Ga0496114_0122336 | Ga0496114_0122336_780_1118 | 112 |
| 367 | 3300048917 | Ga0496114_0231967 | Ga0496114_0231967_636_974 | 112 |
| 368 | 3300048918 | Ga0496115_0035995 | Ga0496115_0035995_391_729 | 112 |
| 369 | 3300048918 | Ga0496115_0041338 | Ga0496115_0041338_2892_3230 | 112 |
| 370 | 3300048918 | Ga0496115_0088486 | Ga0496115_0088486_563_901 | 112 |
| 371 | 3300049581 | Ga0501047_0073280 | Ga0501047_0073280_841_1179 | 112 |
| 372 | 3300049583 | Ga0501067_0020950 | Ga0501067_0020950_2313_2651 | 112 |
| 373 | 3300049585 | Ga0501069_0009778 | Ga0501069_0009778_1862_2200 | 112 |
| 374 | 3300049586 | Ga0501070_1391165 | Ga0501070_1391165_88_426 | 112 |
| 375 | 3300049589 | Ga0501073_1278461 | Ga0501073_1278461_125_463 | 112 |
| 376 | 3300049742 | Ga0501080_0589336 | Ga0501080_0589336_524_862 | 112 |
| 377 | 3300053077 | Ga0495601_0000983 | Ga0495601_0000983_4026_4364 | 112 |
| 378 | 3300053077 | Ga0495601_0104266 | Ga0495601_0104266_1095_1433 | 112 |
| 379 | 3300053077 | Ga0495601_0106827 | Ga0495601_0106827_214_552 | 112 |
| 380 | 3300053077 | Ga0495601_0398422 | Ga0495601_0398422_29_367 | 112 |
| 381 | 3300053078 | Ga0495612_0084162 | Ga0495612_0084162_749_1087 | 112 |
| 382 | 3300053078 | Ga0495612_0358996 | Ga0495612_0358996_130_468 | 112 |
| 383 | 3300053084 | Ga0495595_0002532 | Ga0495595_0002532_6172_6510 | 112 |
| 384 | 3300053084 | Ga0495595_0008406 | Ga0495595_0008406_3451_3789 | 112 |
| 385 | 3300053085 | Ga0495619_0003772 | Ga0495619_0003772_1106_1444 | 112 |
| 386 | 3300053085 | Ga0495619_0025735 | Ga0495619_0025735_995_1333 | 112 |
| 387 | 3300053085 | Ga0495619_0443274 | Ga0495619_0443274_319_657 | 112 |
| 388 | 3300053085 | Ga0495619_0651618 | Ga0495619_0651618_289_627 | 112 |
| 389 | 3300053085 | Ga0495619_0879457 | Ga0495619_0879457_244_582 | 112 |
| 390 | 3300060353 | Ga0501082_1692672 | Ga0501082_1692672_127_465 | 112 |
| 391 | 3300061719 | Ga0466962_0004435 | Ga0466962_0004435_453_791 | 112 |
| 392 | 3300061719 | Ga0466962_0626642 | Ga0466962_0626642_88_426 | 112 |
| 393 | 3300061734 | Ga0530510_0183466 | Ga0530510_0183466_87_425 | 112 |
| 394 | 3300005434 | Ga0070709_10069714 | Ga0070709_100697143 | 113 |
| 395 | 3300005435 | Ga0070714_100187219 | Ga0070714_1001872194 | 113 |
| 396 | 3300005435 | Ga0070714_100578068 | Ga0070714_1005780682 | 113 |
| 397 | 3300005436 | Ga0070713_100068651 | Ga0070713_1000686513 | 113 |
| 398 | 3300005436 | Ga0070713_100191971 | Ga0070713_1001919712 | 113 |
| 399 | 3300005439 | Ga0070711_100629175 | Ga0070711_1006291752 | 113 |
| 400 | 3300005445 | Ga0070708_100376852 | Ga0070708_1003768524 | 113 |
| 401 | 3300005467 | Ga0070706_101532232 | Ga0070706_1015322321 | 113 |
| 402 | 3300005471 | Ga0070698_100559570 | Ga0070698_1005595702 | 113 |
| 403 | 3300005518 | Ga0070699_100042211 | Ga0070699_1000422115 | 113 |
| 404 | 3300005536 | Ga0070697_101242417 | Ga0070697_1012424172 | 113 |
| 405 | 3300006028 | Ga0070717_11443819 | Ga0070717_114438191 | 113 |
| 406 | 3300006051 | Ga0075364_10060448 | Ga0075364_100604481 | 113 |
| 407 | 3300009093 | Ga0105240_10286390 | Ga0105240_102863905 | 113 |
| 408 | 3300013105 | Ga0157369_10005636 | Ga0157369_100056365 | 113 |
| 409 | 3300025906 | Ga0207699_10297779 | Ga0207699_102977793 | 113 |
| 410 | 3300025913 | Ga0207695_11556293 | Ga0207695_115562931 | 113 |
| 411 | 3300025928 | Ga0207700_10040824 | Ga0207700_100408244 | 113 |
| 412 | 3300025929 | Ga0207664_10034034 | Ga0207664_100340344 | 113 |
| 413 | 3300025929 | Ga0207664_10266567 | Ga0207664_102665673 | 113 |
| 414 | 3300025981 | Ga0207640_10490020 | Ga0207640_104900202 | 113 |
| 415 | 3300028800 | Ga0265338_10024476 | Ga0265338_100244762 | 113 |
| 416 | 3300031240 | Ga0265320_10193903 | Ga0265320_101939032 | 113 |
| 417 | 3300031242 | Ga0265329_10043569 | Ga0265329_100435692 | 113 |
| 418 | 3300031344 | Ga0265316_10221143 | Ga0265316_102211434 | 113 |
| 419 | 3300035724 | Ga0373933_0608401 | Ga0373933_0608401_357_698 | 113 |
| 420 | 3300035725 | Ga0373947_1216977 | Ga0373947_1216977_100_441 | 113 |
| 421 | 3300036401 | Ga0373937_0917015 | Ga0373937_0917015_286_627 | 113 |
| 422 | 3300037068 | Ga0373925_1702713 | Ga0373925_1702713_43_384 | 113 |
| 423 | 3300038443 | Ga0395901_1493945 | Ga0395901_1493945_31_372 | 113 |
| 424 | 3300044694 | Ga0466963_0737618 | Ga0466963_0737618_139_480 | 113 |
| 425 | 3300044706 | Ga0466964_0842852 | Ga0466964_0842852_115_456 | 113 |
| 426 | 3300045836 | Ga0466958_0246419 | Ga0466958_0246419_492_833 | 113 |
| 427 | 3300045976 | Ga0466967_0283617 | Ga0466967_0283617_443_784 | 113 |
| 428 | 3300045976 | Ga0466967_1703025 | Ga0466967_1703025_152_493 | 113 |
| 429 | 3300047317 | Ga0495604_0985894 | Ga0495604_0985894_73_414 | 113 |
| 430 | 3300048912 | Ga0496109_0833664 | Ga0496109_0833664_214_570 | 113 |
| 431 | 3300048912 | Ga0496109_0840038 | Ga0496109_0840038_158_499 | 113 |
| 432 | 3300049576 | Ga0501040_0375131 | Ga0501040_0375131_214_555 | 113 |
| 433 | 3300049592 | Ga0501076_0182966 | Ga0501076_0182966_79_420 | 113 |
| 434 | 3300050491 | nmdc:mga00v17_51010_c1 | nmdc:mga00v17_51010_c1_35_385 | 113 |
| 435 | 3300001977 | JGI24746J21847_1056351 | JGI24746J21847_10563512 | 114 |
| 436 | 3300001989 | JGI24739J22299_10081163 | JGI24739J22299_100811632 | 114 |
| 437 | 3300002075 | JGI24738J21930_10046437 | JGI24738J21930_100464372 | 114 |
| 438 | 3300002244 | JGI24742J22300_10018062 | JGI24742J22300_100180622 | 114 |
| 439 | 3300002459 | JGI24751J29686_10067669 | JGI24751J29686_100676692 | 114 |
| 440 | 3300003322 | rootL2_10222519 | rootL2_102225191 | 114 |
| 441 | 3300005327 | Ga0070658_10072353 | Ga0070658_100723532 | 114 |
| 442 | 3300005328 | Ga0070676_10340896 | Ga0070676_103408962 | 114 |
| 443 | 3300005329 | Ga0070683_100279505 | Ga0070683_1002795053 | 114 |
| 444 | 3300005329 | Ga0070683_100282635 | Ga0070683_1002826352 | 114 |
| 445 | 3300005329 | Ga0070683_101411319 | Ga0070683_1014113192 | 114 |
| 446 | 3300005335 | Ga0070666_10374062 | Ga0070666_103740622 | 114 |
| 447 | 3300005336 | Ga0070680_100227411 | Ga0070680_1002274111 | 114 |
| 448 | 3300005337 | Ga0070682_100001777 | Ga0070682_10000177711 | 114 |
| 449 | 3300005337 | Ga0070682_100710191 | Ga0070682_1007101911 | 114 |
| 450 | 3300005338 | Ga0068868_101437085 | Ga0068868_1014370852 | 114 |
| 451 | 3300005339 | Ga0070660_100001667 | Ga0070660_10000166710 | 114 |
| 452 | 3300005341 | Ga0070691_10030216 | Ga0070691_100302163 | 114 |
| 453 | 3300005344 | Ga0070661_100005154 | Ga0070661_1000051546 | 114 |
| 454 | 3300005353 | Ga0070669_100529186 | Ga0070669_1005291862 | 114 |
| 455 | 3300005354 | Ga0070675_100010398 | Ga0070675_1000103982 | 114 |
| 456 | 3300005356 | Ga0070674_100090866 | Ga0070674_1000908662 | 114 |
| 457 | 3300005364 | Ga0070673_100097751 | Ga0070673_1000977512 | 114 |
| 458 | 3300005367 | Ga0070667_100884313 | Ga0070667_1008843131 | 114 |
| 459 | 3300005437 | Ga0070710_10010592 | Ga0070710_100105927 | 114 |
| 460 | 3300005438 | Ga0070701_10132412 | Ga0070701_101324122 | 114 |
| 461 | 3300005440 | Ga0070705_100229287 | Ga0070705_1002292872 | 114 |
| 462 | 3300005441 | Ga0070700_100460341 | Ga0070700_1004603411 | 114 |
| 463 | 3300005445 | Ga0070708_100003821 | Ga0070708_10000382111 | 114 |
| 464 | 3300005445 | Ga0070708_100006095 | Ga0070708_1000060952 | 114 |
| 465 | 3300005445 | Ga0070708_100565617 | Ga0070708_1005656172 | 114 |
| 466 | 3300005456 | Ga0070678_100005901 | Ga0070678_1000059017 | 114 |
| 467 | 3300005457 | Ga0070662_100027799 | Ga0070662_1000277995 | 114 |
| 468 | 3300005467 | Ga0070706_100003177 | Ga0070706_10000317713 | 114 |
| 469 | 3300005467 | Ga0070706_100048569 | Ga0070706_1000485695 | 114 |
| 470 | 3300005467 | Ga0070706_100092971 | Ga0070706_1000929713 | 114 |
| 471 | 3300005468 | Ga0070707_100005238 | Ga0070707_10000523812 | 114 |
| 472 | 3300005468 | Ga0070707_100634630 | Ga0070707_1006346303 | 114 |
| 473 | 3300005468 | Ga0070707_101127035 | Ga0070707_1011270352 | 114 |
| 474 | 3300005530 | Ga0070679_100260126 | Ga0070679_1002601263 | 114 |
| 475 | 3300005535 | Ga0070684_100018603 | Ga0070684_1000186032 | 114 |
| 476 | 3300005535 | Ga0070684_100934005 | Ga0070684_1009340052 | 114 |
| 477 | 3300005539 | Ga0068853_100004196 | Ga0068853_10000419611 | 114 |
| 478 | 3300005547 | Ga0070693_100022228 | Ga0070693_1000222282 | 114 |
| 479 | 3300005563 | Ga0068855_100626506 | Ga0068855_1006265063 | 114 |
| 480 | 3300005614 | Ga0068856_100046444 | Ga0068856_1000464443 | 114 |
| 481 | 3300005615 | Ga0070702_100012411 | Ga0070702_1000124113 | 114 |
| 482 | 3300005618 | Ga0068864_100708591 | Ga0068864_1007085912 | 114 |
| 483 | 3300005719 | Ga0068861_100801923 | Ga0068861_1008019232 | 114 |
| 484 | 3300007076 | Ga0075435_101727951 | Ga0075435_1017279512 | 114 |
| 485 | 3300009093 | Ga0105240_11415239 | Ga0105240_114152392 | 114 |
| 486 | 3300009098 | Ga0105245_10133547 | Ga0105245_101335473 | 114 |
| 487 | 3300009098 | Ga0105245_12597904 | Ga0105245_125979042 | 114 |
| 488 | 3300009148 | Ga0105243_11114334 | Ga0105243_111143342 | 114 |
| 489 | 3300009176 | Ga0105242_10002465 | Ga0105242_100024654 | 114 |
| 490 | 3300009177 | Ga0105248_10139561 | Ga0105248_101395613 | 114 |
| 491 | 3300009545 | Ga0105237_11343631 | Ga0105237_113436312 | 114 |
| 492 | 3300009553 | Ga0105249_11435644 | Ga0105249_114356442 | 114 |
| 493 | 3300010375 | Ga0105239_10049506 | Ga0105239_100495063 | 114 |
| 494 | 3300011119 | Ga0105246_10220955 | Ga0105246_102209553 | 114 |
| 495 | 3300013102 | Ga0157371_10003757 | Ga0157371_1000375711 | 114 |
| 496 | 3300013104 | Ga0157370_10175761 | Ga0157370_101757613 | 114 |
| 497 | 3300013105 | Ga0157369_10004049 | Ga0157369_1000404913 | 114 |
| 498 | 3300013296 | Ga0157374_10092619 | Ga0157374_100926193 | 114 |
| 499 | 3300013297 | Ga0157378_10265593 | Ga0157378_102655932 | 114 |
| 500 | 3300014325 | Ga0163163_10222868 | Ga0163163_102228682 | 114 |
| 501 | 3300014325 | Ga0163163_10514677 | Ga0163163_105146772 | 114 |
| 502 | 3300014326 | Ga0157380_11351325 | Ga0157380_113513252 | 114 |
| 503 | 3300020082 | Ga0206353_11109881 | Ga0206353_111098813 | 114 |
| 504 | 3300025898 | Ga0207692_10006084 | Ga0207692_100060847 | 114 |
| 505 | 3300025903 | Ga0207680_10513643 | Ga0207680_105136432 | 114 |
| 506 | 3300025909 | Ga0207705_10255317 | Ga0207705_102553172 | 114 |
| 507 | 3300025909 | Ga0207705_10334827 | Ga0207705_103348272 | 114 |
| 508 | 3300025910 | Ga0207684_10003165 | Ga0207684_1000316513 | 114 |
| 509 | 3300025910 | Ga0207684_10871270 | Ga0207684_108712702 | 114 |
| 510 | 3300025910 | Ga0207684_11402588 | Ga0207684_114025881 | 114 |
| 511 | 3300025917 | Ga0207660_11441222 | Ga0207660_114412222 | 114 |
| 512 | 3300025921 | Ga0207652_10596123 | Ga0207652_105961232 | 114 |
| 513 | 3300025922 | Ga0207646_10077956 | Ga0207646_100779563 | 114 |
| 514 | 3300025924 | Ga0207694_10898214 | Ga0207694_108982142 | 114 |
| 515 | 3300025927 | Ga0207687_10029148 | Ga0207687_100291486 | 114 |
| 516 | 3300025932 | Ga0207690_10013235 | Ga0207690_100132355 | 114 |
| 517 | 3300025933 | Ga0207706_10005943 | Ga0207706_1000594312 | 114 |
| 518 | 3300025934 | Ga0207686_10010949 | Ga0207686_100109493 | 114 |
| 519 | 3300025935 | Ga0207709_10148055 | Ga0207709_101480553 | 114 |
| 520 | 3300025937 | Ga0207669_10338826 | Ga0207669_103388262 | 114 |
| 521 | 3300025941 | Ga0207711_10430420 | Ga0207711_104304203 | 114 |
| 522 | 3300025942 | Ga0207689_10119513 | Ga0207689_101195133 | 114 |
| 523 | 3300025944 | Ga0207661_10099039 | Ga0207661_100990394 | 114 |
| 524 | 3300025944 | Ga0207661_10357645 | Ga0207661_103576452 | 114 |
| 525 | 3300025944 | Ga0207661_10490939 | Ga0207661_104909392 | 114 |
| 526 | 3300025949 | Ga0207667_10128179 | Ga0207667_101281793 | 114 |
| 527 | 3300025961 | Ga0207712_10945270 | Ga0207712_109452702 | 114 |
| 528 | 3300026023 | Ga0207677_11401554 | Ga0207677_114015541 | 114 |
| 529 | 3300026041 | Ga0207639_10146371 | Ga0207639_101463713 | 114 |
| 530 | 3300026075 | Ga0207708_10292205 | Ga0207708_102922052 | 114 |
| 531 | 3300026089 | Ga0207648_10147560 | Ga0207648_101475601 | 114 |
| 532 | 3300026121 | Ga0207683_10013282 | Ga0207683_100132827 | 114 |
| 533 | 3300026142 | Ga0207698_10109302 | Ga0207698_101093023 | 114 |
| 534 | 3300028800 | Ga0265338_10518331 | Ga0265338_105183311 | 114 |
| 535 | 3300028800 | Ga0265338_10627927 | Ga0265338_106279271 | 114 |
| 536 | 3300031728 | Ga0316578_10020473 | Ga0316578_100204732 | 114 |
| 537 | 3300032126 | Ga0307415_100242864 | Ga0307415_1002428642 | 114 |
| 538 | 3300032139 | Ga0316580_10290121 | Ga0316580_102901211 | 114 |
| 539 | 3300035170 | Ga0373943_0581262 | Ga0373943_0581262_232_603 | 114 |
| 540 | 3300035398 | Ga0316574_0031411 | Ga0316574_0031411_1144_1494 | 114 |
| 541 | 3300035692 | Ga0373935_0789371 | Ga0373935_0789371_238_609 | 114 |
| 542 | 3300035724 | Ga0373933_0851959 | Ga0373933_0851959_148_510 | 114 |
| 543 | 3300036647 | Ga0316582_0224388 | Ga0316582_0224388_187_537 | 114 |
| 544 | 3300036712 | Ga0316584_0089118 | Ga0316584_0089118_658_1008 | 114 |
| 545 | 3300037068 | Ga0373925_1555015 | Ga0373925_1555015_104_475 | 114 |
| 546 | 3300037312 | Ga0395899_0352103 | Ga0395899_0352103_379_735 | 114 |
| 547 | 3300037418 | Ga0395900_0108231 | Ga0395900_0108231_887_1243 | 114 |
| 548 | 3300037471 | Ga0395905_0645554 | Ga0395905_0645554_29_382 | 114 |
| 549 | 3300038443 | Ga0395901_0059057 | Ga0395901_0059057_2760_3116 | 114 |
| 550 | 3300041486 | Ga0451807_1286079 | Ga0451807_1286079_1056_1400 | 114 |
| 551 | 3300044706 | Ga0466964_0122446 | Ga0466964_0122446_770_1117 | 114 |
| 552 | 3300045051 | Ga0451576_1302310 | Ga0451576_1302310_233_586 | 114 |
| 553 | 3300045836 | Ga0466958_0103337 | Ga0466958_0103337_1051_1395 | 114 |
| 554 | 3300045976 | Ga0466967_0066749 | Ga0466967_0066749_828_1187 | 114 |
| 555 | 3300045976 | Ga0466967_0198086 | Ga0466967_0198086_468_815 | 114 |
| 556 | 3300045976 | Ga0466967_0900358 | Ga0466967_0900358_273_620 | 114 |
| 557 | 3300046461 | Ga0495641_0142598 | Ga0495641_0142598_631_978 | 114 |
| 558 | 3300046473 | Ga0495582_0758769 | Ga0495582_0758769_109_456 | 114 |
| 559 | 3300046477 | Ga0495664_0282007 | Ga0495664_0282007_545_907 | 114 |
| 560 | 3300046516 | Ga0495628_0000132 | Ga0495628_0000132_4274_4636 | 114 |
| 561 | 3300046517 | Ga0495630_0080084 | Ga0495630_0080084_1283_1645 | 114 |
| 562 | 3300046517 | Ga0495630_0223759 | Ga0495630_0223759_485_832 | 114 |
| 563 | 3300046535 | Ga0495586_0144077 | Ga0495586_0144077_690_1037 | 114 |
| 564 | 3300047321 | Ga0495676_0589648 | Ga0495676_0589648_220_591 | 114 |
| 565 | 3300047321 | Ga0495676_0935647 | Ga0495676_0935647_60_416 | 114 |
| 566 | 3300047471 | Ga0495684_0018258 | Ga0495684_0018258_2567_2929 | 114 |
| 567 | 3300047471 | Ga0495684_0917614 | Ga0495684_0917614_171_527 | 114 |
| 568 | 3300048907 | Ga0496104_0157469 | Ga0496104_0157469_147_500 | 114 |
| 569 | 3300048908 | Ga0496105_0004281 | Ga0496105_0004281_5151_5504 | 114 |
| 570 | 3300048910 | Ga0496107_0190218 | Ga0496107_0190218_1108_1452 | 114 |
| 571 | 3300048911 | Ga0496108_0356810 | Ga0496108_0356810_587_931 | 114 |
| 572 | 3300048911 | Ga0496108_0411891 | Ga0496108_0411891_358_711 | 114 |
| 573 | 3300048912 | Ga0496109_0012652 | Ga0496109_0012652_3746_4099 | 114 |
| 574 | 3300048915 | Ga0496112_0598514 | Ga0496112_0598514_636_998 | 114 |
| 575 | 3300048916 | Ga0496113_0019636 | Ga0496113_0019636_1587_1940 | 114 |
| 576 | 3300049576 | Ga0501040_1054099 | Ga0501040_1054099_112_459 | 114 |
| 577 | 3300049584 | Ga0501068_0328462 | Ga0501068_0328462_284_628 | 114 |
| 578 | 3300049587 | Ga0501071_1019015 | Ga0501071_1019015_268_615 | 114 |
| 579 | 3300049588 | Ga0501072_0255024 | Ga0501072_0255024_196_543 | 114 |
| 580 | 3300049591 | Ga0501075_0288237 | Ga0501075_0288237_894_1241 | 114 |
| 581 | 3300049742 | Ga0501080_1692176 | Ga0501080_1692176_76_447 | 114 |
| 582 | 3300050513 | nmdc:mga0rr50_505101_c1 | nmdc:mga0rr50_505101_c1_212_556 | 114 |
| 583 | 3300053085 | Ga0495619_0915616 | Ga0495619_0915616_134_490 | 114 |
| 584 | 3300054114 | Ga0501084_1303273 | Ga0501084_1303273_23_370 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.9583 | 6 | 105 |
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.9271 | 6 | 105 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.897 | 3 | 105 |
| 2dcl-assembly1.cif.gz_B-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8952 | 3 | 105 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8881 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9503 | 7 | 105 | 3.30.70.120 |
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9185 | 7 | 105 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.897 | 3 | 105 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8882 | 3 | 105 | 3.30.70.120 |
| af_Q58919_1_108_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8366 | 6 | 113 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660V0E6-F1-model_v4 | DUF190 domain-containing protein | 0.9369 | 1 | 111 |
|
| AF-A0A645A900-F1-model_v4 | Uncharacterized protein | 0.9365 | 4 | 110 |
|
| AF-A0A2H0LUP4-F1-model_v4 | Uncharacterized protein | 0.9319 | 1 | 109 |
|
| AF-A0A2H0M287-F1-model_v4 | Uncharacterized protein | 0.9308 | 1 | 109 |
|
| AF-A0A4R5BGI5-F1-model_v4 | DUF190 domain-containing protein | 0.9301 | 1 | 114 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar