F466397

General Info

Members Datasets Scaffolds Average Seq Length
584 385 1168 292

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0025032|Ga0495686_0025032_1957_2913
Length 318
Sequence MAFCGPVGLPCKDRHHRMSWLSKLMPSGIRTDNTPSKKRSVPEGLWEKCSNCGAVLYRPELEENLEVCPKCGHHMAIRARARLASLFDPGSSSEIAAHLGPVDVLKFRDQKKYADRIKSTQKATGEFDALVAMRGLLKGNPLVASSFDFAFMGGSMGSVVGERFARAAEVALEWGCPYVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVSASFAMLGDINIAEPQALIGFAGPRVIEQTVREKLPEGFQRSEFLVEHGAIDQICDRREMRDRIADLTAMMMRQPRPTADDAPVTSPTAA

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
97 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
119 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
205 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
243 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
246 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
320 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
321 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
328 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
329 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
330 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
331 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
332 2643221559 Lysobacter sp. Root559 Isolate Unclassified
333 2643221573 Lysobacter sp. Root604 Isolate Unclassified
334 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
335 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
336 2643221586 Lysobacter sp. Root667 Isolate Unclassified
337 2643221593 Lysobacter sp. Root690 Isolate Unclassified
338 2643221612 Lysobacter sp. Root76 Isolate Unclassified
339 2643221695 Lysobacter sp. Root494 Isolate Unclassified
340 2643221720 Lysobacter sp. Root916 Isolate Unclassified
341 2643221727 Lysobacter sp. Root96 Isolate Unclassified
342 2643221728 Lysobacter sp. Root983 Isolate Unclassified
343 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
344 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
345 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
346 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
347 2818991457 Xanthomonas translucens 569 Isolate Unclassified
348 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
349 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
350 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
351 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
352 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
353 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
354 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
355 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
356 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
357 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
358 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
359 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
360 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
361 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
362 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
363 2919513703 Luteimonas sp. 3794 Isolate Unclassified
364 2919675420 Luteimonas terrae 4099 Isolate Unclassified
365 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
366 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
367 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
368 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
369 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
370 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
371 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
372 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
373 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
374 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
375 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
376 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
377 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
378 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
379 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
380 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
381 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
382 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
383 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
384 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
385 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.24
Metatranscriptomes 0
Isolates 9.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 13.18
Nodule 0.17
Rhizoplane 3.08
Rhizosphere 69.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0025032 3300047472 Bacteria 3914
2 SwRhRL2b_contig_314363 2162886007 Bacteria 1254
3 SwRhRL2b_contig_3426700 2162886007 Bacteria 2356
4 JGI24748J21848_1001571 3300002074 Bacteria 2537
5 JGI24034J26672_10010741 3300002239 Bacteria 1366
6 JGI24751J29686_10013157 3300002459 Bacteria 1707
7 JGI25152J39213_1000548 3300002773 Bacteria 20669
8 JGI25150J39212_1000114 3300002774 Bacteria 45745
9 JGI25151J46595_10000100 3300003187 Bacteria 116522
10 JGI25151J46595_10000128 3300003187 Bacteria 102514
11 JGI25153J46596_10000071 3300003215 Bacteria 116950
12 rootL2_10284264 3300003322 Bacteria 2489
13 JGI26145J50221_1001698 3300003371 Bacteria 1728
14 JGI25404J52841_10001389 3300003659 Bacteria 4240
15 JGI25404J52841_10001494 3300003659 Bacteria 4131
16 Ga0055526_1000021 3300003771 Bacteria 180007
17 Ga0055526_1033149 3300003771 Bacteria 1440
18 Ga0055537_1000141 3300003773 Bacteria 54030
19 Ga0055537_1000215 3300003773 Bacteria 42710
20 Ga0055524_1000128 3300003775 Bacteria 88986
21 Ga0055524_1014005 3300003775 Bacteria 2994
22 Ga0055524_1036672 3300003775 Bacteria 1313
23 Ga0055536_1032767 3300003781 Bacteria 1338
24 Ga0055534_1000054 3300003784 Bacteria 88986
25 Ga0055534_1000086 3300003784 Bacteria 72299
26 Ga0055534_1002749 3300003784 Bacteria 5898
27 Ga0055534_1008954 3300003784 Bacteria 2218
28 Ga0055528_1000009 3300003790 Bacteria 224150
29 Ga0055528_1000761 3300003790 Bacteria 22501
30 Ga0055530_10001109 3300003791 Bacteria 21055
31 Ga0055530_10001882 3300003791 Bacteria 14399
32 Ga0055530_10002002 3300003791 Bacteria 13806
33 Ga0055531_10003842 3300003794 Bacteria 9406
34 Ga0055531_10016573 3300003794 Bacteria 3169
35 Ga0055531_10024914 3300003794 Bacteria 2191
36 Ga0058692_1000011 3300003856 Bacteria 321321
37 Ga0058692_1000024 3300003856 Bacteria 219702
38 Ga0065714_10009016 3300005288 Bacteria 4227
39 Ga0065704_10083971 3300005289 Bacteria 3393
40 Ga0065715_10230468 3300005293 Bacteria 1236
41 Ga0070658_10003169 3300005327 Bacteria 13581
42 Ga0070676_10000823 3300005328 Bacteria 15347
43 Ga0070683_100601705 3300005329 Bacteria 1052
44 Ga0070690_100001047 3300005330 Bacteria 14161
45 Ga0070670_100235742 3300005331 Bacteria 1593
46 Ga0070670_100351385 3300005331 Bacteria 1295
47 Ga0068869_100001783 3300005334 Bacteria 12898
48 Ga0070666_10006883 3300005335 Bacteria 7004
49 Ga0068868_100008917 3300005338 Bacteria 7192
50 Ga0070660_100003148 3300005339 Bacteria 11336
51 Ga0070689_100002391 3300005340 Bacteria 12238
52 Ga0070687_100000482 3300005343 Bacteria 13313
53 Ga0070661_100002001 3300005344 Bacteria 14102
54 Ga0070668_100101898 3300005347 Bacteria 2276
55 Ga0070669_100001422 3300005353 Bacteria 17301
56 Ga0070669_100133535 3300005353 Bacteria 1907
57 Ga0070675_100125530 3300005354 Bacteria 2183
58 Ga0070671_100003509 3300005355 Bacteria 12254
59 Ga0070671_100028192 3300005355 Bacteria 4623
60 Ga0070671_100171422 3300005355 Bacteria 1835
61 Ga0070671_100379399 3300005355 Bacteria 1208
62 Ga0070674_100001692 3300005356 Bacteria 11936
63 Ga0070673_100001060 3300005364 Bacteria 15669
64 Ga0070688_100001262 3300005365 Bacteria 12614
65 Ga0070659_100002780 3300005366 Bacteria 12456
66 Ga0070667_100024566 3300005367 Bacteria 5006
67 Ga0070701_10001351 3300005438 Bacteria 9039
68 Ga0070711_100176182 3300005439 Bacteria 1634
69 Ga0070705_100002638 3300005440 Bacteria 8976
70 Ga0070663_100133435 3300005455 Bacteria 1888
71 Ga0070678_100001920 3300005456 Bacteria 11205
72 Ga0070678_100128413 3300005456 Bacteria 2010
73 Ga0070662_100001874 3300005457 Bacteria 12883
74 Ga0070685_10001698 3300005466 Bacteria 11571
75 Ga0070707_100420902 3300005468 Bacteria 1296
76 Ga0070679_100023473 3300005530 Bacteria 6038
77 Ga0068853_100000493 3300005539 Bacteria 26977
78 Ga0070672_100002883 3300005543 Bacteria 11058
79 Ga0070672_100004233 3300005543 Bacteria 9382
80 Ga0070672_100006280 3300005543 Bacteria 7965
81 Ga0070686_100003027 3300005544 Bacteria 9214
82 Ga0070696_100014261 3300005546 Bacteria 5332
83 Ga0070693_100000733 3300005547 Bacteria 14439
84 Ga0070665_100163191 3300005548 Bacteria 2230
85 Ga0070704_100033595 3300005549 Bacteria 3470
86 Ga0068855_100006770 3300005563 Bacteria 13901
87 Ga0070664_100004932 3300005564 Bacteria 10689
88 Ga0070664_100005223 3300005564 Bacteria 10415
89 Ga0068857_100009400 3300005577 Bacteria 8485
90 Ga0068857_100027014 3300005577 Bacteria 5064
91 Ga0068854_100001701 3300005578 Bacteria 13390
92 Ga0068856_100004173 3300005614 Bacteria 14429
93 Ga0068852_100002227 3300005616 Bacteria 13300
94 Ga0068859_100007196 3300005617 Bacteria 11296
95 Ga0068864_100002312 3300005618 Bacteria 15766
96 Ga0068861_100001305 3300005719 Bacteria 15610
97 Ga0068851_10000877 3300005834 Bacteria 12968
98 Ga0068870_10000916 3300005840 Bacteria 11544
99 Ga0068863_100013509 3300005841 Bacteria 7877
100 Ga0068860_100005121 3300005843 Bacteria 13330
101 Ga0081540_1000988 3300005983 Bacteria 25634
102 Ga0075364_10000020 3300006051 Bacteria 54215
103 Ga0075364_10305274 3300006051 Bacteria 1083
104 Ga0097621_100004336 3300006237 Bacteria 9858
105 Ga0097621_100038064 3300006237 Bacteria 3859
106 Ga0068871_100030519 3300006358 Bacteria 4245
107 Ga0068871_100045248 3300006358 Bacteria 3542
108 Ga0075428_100145594 3300006844 Bacteria 2575
109 Ga0068865_100001849 3300006881 Bacteria 12426
110 Ga0097620_100007195 3300006931 Bacteria 11296
111 Ga0075435_100047690 3300007076 Bacteria 3440
112 Ga0105251_10003611 3300009011 Bacteria 11123
113 Ga0105244_10073322 3300009036 Bacteria 1704
114 Ga0105244_10101697 3300009036 Bacteria 1405
115 Ga0105240_10003240 3300009093 Bacteria 25471
116 Ga0111539_10055715 3300009094 Bacteria 4700
117 Ga0111539_10337812 3300009094 Bacteria 1753
118 Ga0111539_10554299 3300009094 Bacteria 1339
119 Ga0105245_10004441 3300009098 Bacteria 12406
120 Ga0105247_10001559 3300009101 Bacteria 16324
121 Ga0105247_10003375 3300009101 Bacteria 10443
122 Ga0105243_10004714 3300009148 Bacteria 10737
123 Ga0105241_10092460 3300009174 Bacteria 2389
124 Ga0105242_10000383 3300009176 Bacteria 35192
125 Ga0105242_10061274 3300009176 Bacteria 3094
126 Ga0105248_10001684 3300009177 Bacteria 24603
127 Ga0105248_10480713 3300009177 Bacteria 1400
128 Ga0105237_10001653 3300009545 Bacteria 28941
129 Ga0105238_10006399 3300009551 Bacteria 11718
130 Ga0105249_10000236 3300009553 Bacteria 62582
131 Ga0105032_104247 3300009979 Bacteria 1228
132 Ga0105028_104662 3300009993 Bacteria 1428
133 Ga0105239_10005084 3300010375 Bacteria 15527
134 Ga0105239_10663386 3300010375 Bacteria 1191
135 Ga0157316_1000157 3300012510 Bacteria 3258
136 Ga0157327_1001218 3300012512 Bacteria 1569
137 Ga0157373_10005972 3300013100 Bacteria 9106
138 Ga0157371_10000154 3300013102 Bacteria 100237
139 Ga0157371_10000875 3300013102 Bacteria 34150
140 Ga0157371_10002975 3300013102 Bacteria 15728
141 Ga0157371_10243859 3300013102 Bacteria 1293
142 Ga0157370_10006946 3300013104 Bacteria 12369
143 Ga0157369_10000652 3300013105 Bacteria 44858
144 Ga0157369_10022183 3300013105 Bacteria 7092
145 Ga0157374_10001223 3300013296 Bacteria 21944
146 Ga0157374_10341588 3300013296 Bacteria 1486
147 Ga0157378_10000522 3300013297 Bacteria 36590
148 Ga0163162_10001916 3300013306 Bacteria 19589
149 Ga0157372_10010891 3300013307 Bacteria 9679
150 Ga0157372_10019180 3300013307 Bacteria 7364
151 Ga0157375_10000635 3300013308 Bacteria 31214
152 Ga0157375_10049459 3300013308 Bacteria 4119
153 Ga0163163_10003411 3300014325 Bacteria 13499
154 Ga0157380_10035235 3300014326 Bacteria 3865
155 Ga0157380_10347957 3300014326 Bacteria 1386
156 Ga0182008_10000142 3300014497 Bacteria 55320
157 Ga0182008_10042134 3300014497 Bacteria 2275
158 Ga0157377_10000157 3300014745 Bacteria 41711
159 Ga0157379_10000177 3300014968 Bacteria 48021
160 Ga0157376_10391798 3300014969 Bacteria 1341
161 Ga0182007_10000287 3300015262 Bacteria 33403
162 Ga0182005_1000388 3300015265 Bacteria 24055
163 Ga0182005_1038803 3300015265 Bacteria 1296
164 Ga0183360_10001 3300015689 Bacteria 3943671
165 Ga0183361_12046 3300016635 Bacteria 1076
166 Ga0163161_10001350 3300017792 Bacteria 18251
167 Ga0207425_1000030 3300025245 Bacteria 268200
168 Ga0209129_1000063 3300025258 Bacteria 240205
169 Ga0209565_1000022 3300025263 Bacteria 390888
170 Ga0209565_1000048 3300025263 Bacteria 224961
171 Ga0209673_1000001 3300025273 Bacteria 3176258
172 Ga0209673_1000104 3300025273 Bacteria 186569
173 Ga0209673_1006793 3300025273 Bacteria 5435
174 Ga0209130_1012894 3300025284 Bacteria 2164
175 Ga0209130_1013338 3300025284 Bacteria 2108
176 Ga0209675_1000045 3300025291 Bacteria 225750
177 Ga0209675_1000048 3300025291 Bacteria 221457
178 Ga0209675_1012113 3300025291 Bacteria 2802
179 Ga0209676_1000024 3300025292 Bacteria 578839
180 Ga0209676_1000091 3300025292 Bacteria 251328
181 Ga0209676_1000117 3300025292 Bacteria 203251
182 Ga0209676_1001624 3300025292 Bacteria 19895
183 Ga0209676_1002128 3300025292 Bacteria 15135
184 Ga0209676_1002569 3300025292 Bacteria 12546
185 Ga0209676_1003631 3300025292 Bacteria 9275
186 Ga0209025_1000005 3300025294 Bacteria 1272149
187 Ga0209025_1000013 3300025294 Bacteria 871757
188 Ga0209025_1004696 3300025294 Bacteria 11657
189 Ga0209025_1005156 3300025294 Bacteria 10822
190 Ga0209564_1000001 3300025295 Bacteria 3176258
191 Ga0209564_1000213 3300025295 Bacteria 132985
192 Ga0209758_1000014 3300025297 Bacteria 871757
193 Ga0209758_1022517 3300025297 Bacteria 2884
194 Ga0209050_1000603 3300025298 Bacteria 57120
195 Ga0209050_1001495 3300025298 Bacteria 24789
196 Ga0209050_1001888 3300025298 Bacteria 20105
197 Ga0209050_1026023 3300025298 Bacteria 1970
198 Ga0209256_1000002 3300025299 Bacteria 1906740
199 Ga0209256_1002292 3300025299 Bacteria 16094
200 Ga0209256_1004498 3300025299 Bacteria 8709
201 Ga0209256_1007996 3300025299 Bacteria 5028
202 Ga0209256_1040932 3300025299 Bacteria 1180
203 Ga0207426_1054761 3300025302 Bacteria 1172
204 Ga0209051_1001112 3300025303 Bacteria 24636
205 Ga0209051_1008525 3300025303 Bacteria 5416
206 Ga0209257_1000062 3300025304 Bacteria 362413
207 Ga0209257_1000122 3300025304 Bacteria 219678
208 Ga0209257_1000217 3300025304 Bacteria 136049
209 Ga0209257_1000243 3300025304 Bacteria 126291
210 Ga0209257_1001409 3300025304 Bacteria 28685
211 Ga0209257_1001747 3300025304 Bacteria 24118
212 Ga0209257_1002061 3300025304 Bacteria 21277
213 Ga0207697_10001596 3300025315 Bacteria 12238
214 Ga0207656_10000282 3300025321 Bacteria 17537
215 Ga0207655_1049487 3300025728 Bacteria 1715
216 Ga0207713_1000327 3300025735 Bacteria 53351
217 Ga0207642_10010727 3300025899 Bacteria 3243
218 Ga0207710_10002180 3300025900 Bacteria 9204
219 Ga0207710_10005312 3300025900 Bacteria 5559
220 Ga0207688_10001775 3300025901 Bacteria 11449
221 Ga0207680_10000618 3300025903 Bacteria 16764
222 Ga0207647_10000971 3300025904 Bacteria 22177
223 Ga0207645_10000048 3300025907 Bacteria 84942
224 Ga0207643_10000122 3300025908 Bacteria 53121
225 Ga0207705_10002690 3300025909 Bacteria 13611
226 Ga0207705_10091151 3300025909 Bacteria 2232
227 Ga0207695_10070094 3300025913 Bacteria 3585
228 Ga0207671_10002485 3300025914 Bacteria 19695
229 Ga0207663_10046160 3300025916 Bacteria 2683
230 Ga0207660_10454099 3300025917 Bacteria 1037
231 Ga0207662_10000265 3300025918 Bacteria 24159
232 Ga0207657_10000091 3300025919 Bacteria 86419
233 Ga0207649_10001088 3300025920 Bacteria 16515
234 Ga0207646_10088847 3300025922 Bacteria 2766
235 Ga0207681_10000696 3300025923 Bacteria 22068
236 Ga0207681_10129243 3300025923 Bacteria 1865
237 Ga0207681_10253784 3300025923 Bacteria 1374
238 Ga0207650_10000831 3300025925 Bacteria 23640
239 Ga0207650_10004381 3300025925 Bacteria 9643
240 Ga0207650_10158098 3300025925 Bacteria 1794
241 Ga0207650_10218226 3300025925 Bacteria 1534
242 Ga0207650_10246237 3300025925 Bacteria 1446
243 Ga0207659_10000335 3300025926 Bacteria 28308
244 Ga0207687_10108946 3300025927 Bacteria 2052
245 Ga0207664_10207997 3300025929 Bacteria 1692
246 Ga0207644_10000651 3300025931 Bacteria 21967
247 Ga0207644_10001250 3300025931 Bacteria 16343
248 Ga0207644_10372624 3300025931 Bacteria 1163
249 Ga0207690_10001654 3300025932 Bacteria 13774
250 Ga0207706_10000753 3300025933 Bacteria 33684
251 Ga0207706_10321204 3300025933 Bacteria 1347
252 Ga0207686_10005878 3300025934 Bacteria 6584
253 Ga0207709_10000562 3300025935 Bacteria 31535
254 Ga0207709_10013019 3300025935 Bacteria 4586
255 Ga0207709_10040468 3300025935 Bacteria 2790
256 Ga0207670_10000412 3300025936 Bacteria 24343
257 Ga0207669_10000372 3300025937 Bacteria 20153
258 Ga0207704_10000994 3300025938 Bacteria 12575
259 Ga0207691_10000058 3300025940 Bacteria 87937
260 Ga0207691_10001348 3300025940 Bacteria 24480
261 Ga0207691_10001351 3300025940 Bacteria 24456
262 Ga0207691_10280120 3300025940 Bacteria 1435
263 Ga0207711_10000401 3300025941 Bacteria 45756
264 Ga0207689_10000636 3300025942 Bacteria 33492
265 Ga0207679_10005224 3300025945 Bacteria 8140
266 Ga0207679_10008833 3300025945 Bacteria 6423
267 Ga0207679_10135097 3300025945 Bacteria 1985
268 Ga0207667_10008470 3300025949 Bacteria 12213
269 Ga0207651_10000315 3300025960 Bacteria 20714
270 Ga0207712_10000518 3300025961 Bacteria 31766
271 Ga0207668_10000761 3300025972 Bacteria 19674
272 Ga0207668_10020163 3300025972 Bacteria 4230
273 Ga0207640_10001807 3300025981 Bacteria 11479
274 Ga0207658_10001028 3300025986 Bacteria 22711
275 Ga0207677_10000116 3300026023 Bacteria 65208
276 Ga0207677_10030917 3300026023 Bacteria 3424
277 Ga0207703_10000226 3300026035 Bacteria 64851
278 Ga0207639_10003726 3300026041 Bacteria 10258
279 Ga0207678_10003479 3300026067 Bacteria 14174
280 Ga0207702_10007041 3300026078 Bacteria 9623
281 Ga0207641_10001536 3300026088 Bacteria 22584
282 Ga0207641_10018128 3300026088 Bacteria 5769
283 Ga0207648_10000769 3300026089 Bacteria 36104
284 Ga0207676_10000570 3300026095 Bacteria 30527
285 Ga0207674_10003927 3300026116 Bacteria 18099
286 Ga0207674_10007691 3300026116 Bacteria 12547
287 Ga0207675_100000045 3300026118 Bacteria 87487
288 Ga0207683_10002376 3300026121 Bacteria 16434
289 Ga0207683_10155613 3300026121 Bacteria 2064
290 Ga0207683_10232195 3300026121 Bacteria 1683
291 Ga0207698_10000612 3300026142 Bacteria 20810
292 Ga0209371_1000007 3300027312 Bacteria 1050654
293 Ga0209371_1000016 3300027312 Bacteria 646301
294 Ga0209984_1012835 3300027424 Bacteria 1095
295 Ga0209999_1001293 3300027543 Bacteria 4291
296 Ga0209982_1002155 3300027552 Bacteria 2740
297 Ga0209983_1007591 3300027665 Bacteria 2222
298 Ga0209971_1001898 3300027682 Bacteria 5116
299 Ga0207428_10161778 3300027907 Bacteria 1699
300 Ga0268266_10000240 3300028379 Bacteria 93100
301 Ga0268266_10152633 3300028379 Bacteria 2083
302 Ga0268265_10001030 3300028380 Bacteria 25149
303 Ga0268264_10000769 3300028381 Bacteria 35484
304 Ga0265319_1000259 3300028563 Bacteria 40074
305 Ga0265318_10000150 3300028577 Bacteria 63092
306 Ga0265318_10002234 3300028577 Bacteria 10439
307 Ga0265338_10047622 3300028800 Bacteria 3913
308 Ga0268256_1000008 3300030500 Bacteria 1050654
309 Ga0268256_1000015 3300030500 Bacteria 646300
310 Ga0316176_1170776 3300030732 Bacteria 2355
311 Ga0314311_1188486 3300030733 Bacteria 7455
312 Ga0316178_1121146 3300030735 Bacteria 2036
313 Ga0316181_1232513 3300030744 Bacteria 2551
314 Ga0316181_1257729 3300030744 Bacteria 2963
315 Ga0265330_10000166 3300031235 Bacteria 52307
316 Ga0265328_10098130 3300031239 Bacteria 1084
317 Ga0265320_10000381 3300031240 Bacteria 35971
318 Ga0265325_10001158 3300031241 Bacteria 18894
319 Ga0265329_10000352 3300031242 Bacteria 24264
320 Ga0265340_10000302 3300031247 Bacteria 25964
321 Ga0265340_10009220 3300031247 Bacteria 5302
322 Ga0265339_10002278 3300031249 Bacteria 13836
323 Ga0265331_10000709 3300031250 Bacteria 28371
324 Ga0265316_10002784 3300031344 Bacteria 17920
325 Ga0265316_10004280 3300031344 Bacteria 14247
326 Ga0307513_10039653 3300031456 Bacteria 5219
327 Ga0307509_10115061 3300031507 Bacteria 2683
328 Ga0307408_100017474 3300031548 Bacteria 4801
329 Ga0307408_100164128 3300031548 Bacteria 1767
330 Ga0307408_100337554 3300031548 Bacteria 1274
331 Ga0265313_10000378 3300031595 Bacteria 48043
332 Ga0265313_10001920 3300031595 Bacteria 18868
333 Ga0265314_10001502 3300031711 Bacteria 25850
334 Ga0265314_10012431 3300031711 Bacteria 6946
335 Ga0265342_10000725 3300031712 Bacteria 34013
336 Ga0316576_10064429 3300031727 Bacteria 2692
337 Ga0316578_10020283 3300031728 Bacteria 3670
338 Ga0307413_10006930 3300031824 Bacteria 5218
339 Ga0307413_10056758 3300031824 Bacteria 2390
340 Ga0307410_10236641 3300031852 Bacteria 1413
341 Ga0307406_10021651 3300031901 Bacteria 3806
342 Ga0307406_10063847 3300031901 Bacteria 2387
343 Ga0307406_10072049 3300031901 Bacteria 2267
344 Ga0307407_10057750 3300031903 Bacteria 2253
345 Ga0307412_10330483 3300031911 Bacteria 1216
346 Ga0307414_10004276 3300032004 Bacteria 7747
347 Ga0307414_10019038 3300032004 Bacteria 4245
348 Ga0307414_10025290 3300032004 Bacteria 3800
349 Ga0307414_10048036 3300032004 Bacteria 2941
350 Ga0307414_10084626 3300032004 Bacteria 2333
351 Ga0307414_10095010 3300032004 Bacteria 2226
352 Ga0307414_10124056 3300032004 Bacteria 1991
353 Ga0307414_10154948 3300032004 Bacteria 1812
354 Ga0307414_10205568 3300032004 Bacteria 1605
355 Ga0307414_10466962 3300032004 Bacteria 1110
356 Ga0307411_10037849 3300032005 Bacteria 3037
357 Ga0307411_10075655 3300032005 Bacteria 2299
358 Ga0307415_100162164 3300032126 Bacteria 1734
359 Ga0373947_0187718 3300035725 Bacteria 1348
360 Ga0373937_0119341 3300036401 Bacteria 2457
361 Ga0373937_0229305 3300036401 Bacteria 1749
362 Ga0395899_0090607 3300037312 Bacteria 2217
363 Ga0395900_0321630 3300037418 Bacteria 1527
364 Ga0395900_0589056 3300037418 Bacteria 1053
365 Ga0395898_0547308 3300037466 Bacteria 1099
366 Ga0395905_0000306 3300037471 Bacteria 71299
367 Ga0395905_0017994 3300037471 Bacteria 6709
368 Ga0395905_0338561 3300037471 Bacteria 1395
369 Ga0395905_0345517 3300037471 Bacteria 1379
370 Ga0436364_1010390 3300037853 Bacteria 973
371 Ga0395901_0002348 3300038443 Bacteria 19240
372 Ga0237819_00617 3300038705 Bacteria 11655
373 Ga0237816_00655 3300039145 Bacteria 2916
374 Ga0436365_1765442 3300039437 Bacteria 1843
375 Ga0436360_1082159 3300039438 Bacteria 1155
376 Ga0439436_0018848 3300041404 Bacteria 2063
377 Ga0439436_0023498 3300041404 Bacteria 1823
378 Ga0439439_0005994 3300041406 Bacteria 2798
379 Ga0439439_0019516 3300041406 Bacteria 1684
380 Ga0439447_011954 3300041407 Bacteria 2513
381 Ga0439465_0001771 3300041413 Bacteria 7065
382 Ga0439465_0003673 3300041413 Bacteria 5004
383 Ga0439465_0004523 3300041413 Bacteria 4496
384 Ga0439465_0037900 3300041413 Bacteria 1551
385 Ga0439465_0090206 3300041413 Bacteria 1048
386 Ga0451797_0382392 3300041453 Bacteria 2235
387 Ga0451795_0443075 3300041456 Bacteria 2692
388 Ga0451798_0406233 3300041458 Bacteria 997
389 Ga0451800_0326958 3300041459 Bacteria 1533
390 Ga0451806_516753 3300041462 Bacteria 2838
391 Ga0451807_0785375 3300041486 Bacteria 2328
392 Ga0451837_0162876 3300041494 Bacteria 1577
393 Ga0451837_0572425 3300041494 Bacteria 1548
394 Ga0451837_0578947 3300041494 Bacteria 1728
395 Ga0451837_0713293 3300041494 Bacteria 1051
396 Ga0451837_0773876 3300041494 Bacteria 3398
397 Ga0451841_1303890 3300041498 Bacteria 3644
398 Ga0451843_1035942 3300041509 Bacteria 2951
399 Ga0439431_0018601 3300041997 Bacteria 1645
400 Ga0439432_005521 3300042006 Bacteria 4549
401 Ga0439432_016258 3300042006 Bacteria 2506
402 Ga0439449_0000156 3300042007 Bacteria 23254
403 Ga0439449_0012229 3300042007 Bacteria 3226
404 Ga0439449_0012427 3300042007 Bacteria 3200
405 Ga0439449_0016777 3300042007 Bacteria 2751
406 Ga0439449_0032165 3300042007 Bacteria 1955
407 Ga0439450_007998 3300042008 Bacteria 1959
408 Ga0439455_0001840 3300042012 Bacteria 3702
409 Ga0450901_003263 3300042533 Bacteria 1703
410 Ga0451577_0042380 3300042876 Bacteria 4083
411 Ga0466966_0059036 3300044684 Bacteria 2423
412 Ga0453684_0014277 3300044712 Bacteria 12736
413 Ga0453684_0072777 3300044712 Bacteria 4337
414 Ga0495638_0001842 3300046460 Bacteria 18352
415 Ga0495638_0051744 3300046460 Bacteria 2561
416 Ga0495606_0086909 3300046507 Bacteria 1931
417 Ga0495610_0004733 3300046512 Bacteria 9931
418 Ga0495631_0002006 3300046518 Bacteria 11866
419 Ga0495643_0001695 3300046522 Bacteria 19192
420 Ga0495663_0001507 3300046525 Bacteria 7317
421 Ga0495663_0007487 3300046525 Bacteria 3018
422 Ga0495663_0030882 3300046525 Bacteria 1589
423 Ga0495598_0000742 3300046537 Bacteria 6218
424 Ga0495621_0004671 3300046539 Bacteria 3873
425 Ga0495622_0060002 3300046557 Bacteria 1761
426 Ga0495633_0016986 3300046558 Bacteria 3733
427 Ga0495656_0009800 3300046615 Bacteria 3458
428 Ga0495656_0033683 3300046615 Bacteria 2092
429 Ga0495659_0142024 3300046664 Bacteria 959
430 Ga0495671_0010539 3300046692 Bacteria 5113
431 Ga0495636_0003452 3300047318 Bacteria 6132
432 Ga0495636_0008887 3300047318 Bacteria 3956
433 Ga0495636_0014005 3300047318 Bacteria 3187
434 Ga0495636_0044107 3300047318 Bacteria 1856
435 Ga0495672_0000073 3300047320 Bacteria 179398
436 Ga0495686_0026392 3300047472 Bacteria 3800
437 Ga0496101_0087253 3300048904 Bacteria 2316
438 Ga0496101_0177725 3300048904 Bacteria 1638
439 Ga0496102_0004532 3300048905 Bacteria 11741
440 Ga0496106_0001090 3300048909 Bacteria 20066
441 Ga0496106_0030699 3300048909 Bacteria 4006
442 Ga0496107_0044662 3300048910 Bacteria 3186
443 Ga0496108_0090168 3300048911 Bacteria 2606
444 Ga0496109_0038143 3300048912 Bacteria 4343
445 Ga0496109_0090422 3300048912 Bacteria 2831
446 Ga0496112_0008685 3300048915 Bacteria 9111
447 Ga0496114_0006407 3300048917 Bacteria 9269
448 Ga0496115_0237052 3300048918 Bacteria 1504
449 Ga0496117_0002324 3300048920 Bacteria 24332
450 Ga0496117_0002722 3300048920 Bacteria 21720
451 Ga0496117_0090355 3300048920 Bacteria 1973
452 Ga0496118_0000344 3300048921 Bacteria 78989
453 Ga0496118_0001379 3300048921 Bacteria 36605
454 Ga0496118_0013072 3300048921 Bacteria 7892
455 Ga0496118_0018080 3300048921 Bacteria 6379
456 Ga0496118_0070648 3300048921 Bacteria 2519
457 Ga0496119_0003326 3300048922 Bacteria 16773
458 Ga0496119_0014839 3300048922 Bacteria 6059
459 Ga0496119_0131850 3300048922 Bacteria 1361
460 Ga0496120_0002285 3300048923 Bacteria 19880
461 Ga0496120_0003024 3300048923 Bacteria 15923
462 Ga0496121_0006284 3300048924 Bacteria 14851
463 Ga0496121_0008043 3300048924 Bacteria 12572
464 Ga0496122_0003858 3300048925 Bacteria 19242
465 Ga0496122_0005074 3300048925 Bacteria 15901
466 Ga0496122_0008107 3300048925 Bacteria 11448
467 Ga0496122_0039435 3300048925 Bacteria 3766
468 Ga0496122_0041940 3300048925 Bacteria 3608
469 Ga0496122_0042161 3300048925 Bacteria 3594
470 Ga0496122_0114519 3300048925 Bacteria 1759
471 Ga0496123_0000669 3300048926 Bacteria 56717
472 Ga0496123_0004123 3300048926 Bacteria 15561
473 Ga0496123_0009080 3300048926 Bacteria 9004
474 Ga0496123_0013609 3300048926 Bacteria 6811
475 Ga0496123_0033730 3300048926 Bacteria 3678
476 Ga0496124_0000009 3300048927 Bacteria 734820
477 Ga0496124_0003480 3300048927 Bacteria 19168
478 Ga0496124_0004112 3300048927 Bacteria 17192
479 Ga0496124_0007146 3300048927 Bacteria 11949
480 Ga0496124_0014062 3300048927 Bacteria 7763
481 Ga0496124_0014864 3300048927 Bacteria 7499
482 Ga0496124_0022002 3300048927 Bacteria 5860
483 Ga0496125_0004477 3300048928 Bacteria 16098
484 Ga0496125_0049749 3300048928 Bacteria 3478
485 Ga0496125_0053334 3300048928 Bacteria 3315
486 Ga0496126_0051425 3300048929 Bacteria 3750
487 Ga0501290_000334 3300049513 Bacteria 7750
488 Ga0501031_0015466 3300049568 Bacteria 4954
489 Ga0501031_0040249 3300049568 Bacteria 3051
490 Ga0501032_0003474 3300049569 Bacteria 12065
491 Ga0501033_0002438 3300049570 Bacteria 15799
492 Ga0501034_0000122 3300049571 Bacteria 144085
493 Ga0501034_0001021 3300049571 Bacteria 40111
494 Ga0501034_0002909 3300049571 Bacteria 19882
495 Ga0501034_0007363 3300049571 Bacteria 11724
496 Ga0501034_0087102 3300049571 Bacteria 3123
497 Ga0501036_0120311 3300049572 Bacteria 2217
498 Ga0501037_0030670 3300049573 Bacteria 3972
499 Ga0501037_0061087 3300049573 Bacteria 2748
500 Ga0501038_0005011 3300049574 Bacteria 12292
501 Ga0501038_0046025 3300049574 Bacteria 3784
502 Ga0501039_0031363 3300049575 Bacteria 4097
503 Ga0501043_0006239 3300049579 Bacteria 9571
504 Ga0501043_0026118 3300049579 Bacteria 4582
505 Ga0501047_0068457 3300049581 Bacteria 3419
506 Ga0501047_0178552 3300049581 Bacteria 1990
507 Ga0501070_0009112 3300049586 Bacteria 8394
508 Ga0501070_0138686 3300049586 Bacteria 2008
509 Ga0501071_0094032 3300049587 Bacteria 2204
510 Ga0501073_0015658 3300049589 Bacteria 5499
511 Ga0501225_0016531 3300049705 Bacteria 2052
512 Ga0501080_0105402 3300049742 Bacteria 2614
513 Ga0501241_002421 3300049758 Bacteria 3605
514 Ga0501265_001185 3300049762 Bacteria 2944
515 Ga0501266_003663 3300049763 Bacteria 1903
516 Ga0501275_000033 3300049772 Bacteria 14296
517 Ga0501035_0104849 3300049822 Bacteria 2479
518 Ga0501044_0046980 3300049823 Bacteria 4467
519 Ga0501044_0420528 3300049823 Bacteria 1246
520 nmdc:mga00v17_202_c2 3300050491 Bacteria 31082
521 nmdc:mga00v17_55844_c1 3300050491 Bacteria 2413
522 nmdc:mga08y16_277275_c1 3300050511 Bacteria 1730
523 nmdc:mga08y16_41561_c1 3300050511 Bacteria 4816
524 nmdc:mga08y16_449515_c1 3300050511 Bacteria 1314
525 nmdc:mga0rr50_155503_c1 3300050513 Bacteria 1852
526 Ga0500634_0000048 3300053161 Bacteria 55497
527 Ga0500565_002311 3300053734 Bacteria 1411
528 2547500017 2547132130 Bacteria 4660562
529 2572253562 2571042365 Bacteria 3289345
530 2578457593 2576861471 Bacteria 4648976
531 2643815267 2643221559 Bacteria 4424915
532 2643879306 2643221573 Bacteria 4784121
533 2643908752 2643221579 Bacteria 4443405
534 2643916180 2643221581 Bacteria 3893603
535 2643939945 2643221586 Bacteria 4446529
536 2643976192 2643221593 Bacteria 6296053
537 2644077003 2643221612 Bacteria 4361984
538 2644528898 2643221695 Bacteria 3441323
539 2644660605 2643221720 Bacteria 4694283
540 2644695317 2643221727 Bacteria 4415595
541 2644697966 2643221728 Bacteria 4797149
542 2747948104 2747842428 Bacteria 4689383
543 2748018289 2747842501 Bacteria 5293829
544 2765579889 2765235840 Bacteria 4663337
545 2816519068 2816332141 Bacteria 4436036
546 2819660075 2818991457 Bacteria 5323295
547 2842394852 2842391507 Bacteria 4486072
548 2842760618 2842757796 Bacteria 3981385
549 2842781110 2842780639 Bacteria 4337790
550 2852650010 2852649853 Bacteria 4036942
551 2852685109 2852684882 Bacteria 5463342
552 2857445550 2857442823 Bacteria 4562550
553 2874222572 2874220319 Bacteria 4594709
554 2894415894 2894414249 Bacteria 4405451
555 2895500817 2895498888 Bacteria 5283788
556 2895516313 2895511927 Bacteria 6802080
557 2895523768 2895522137 Bacteria 3284416
558 2895526651 2895525241 Bacteria 3388457
559 2919090513 2919089067 Bacteria 4560942
560 2919130649 2919130084 Bacteria 5301837
561 2919137554 2919134579 Bacteria 4480386
562 2919516122 2919513703 Bacteria 3844312
563 2919677954 2919675420 Bacteria 3969095
564 2923517962 2923516293 Bacteria 3716336
565 2928498348 2928496128 Bacteria 4631123
566 2929198348 2929195423 Bacteria 5325372
567 2931383971 2931380184 Bacteria 4455911
568 2937614469 2937610967 Bacteria 4618818
569 2939591115 2939589442 Bacteria 4214238
570 2939624609 2939622612 Bacteria 4698046
571 2939628317 2939626828 Bacteria 4695272
572 2941476646 2941475908 Bacteria 4145589
573 2941491140 2941489479 Bacteria 6313767
574 2961049337 2961047084 Bacteria 4594415
575 2961065971 2961064222 Bacteria 4749990
576 2974308213 2974307012 Bacteria 4172388
577 2977248971 2977247770 Bacteria 4160543
578 2984516578 2984514374 Bacteria 4172479
579 2987607370 2987605356 Bacteria 4187822
580 2995952071 2995948881 Bacteria 6358104
581 8003014577 8003014200 Bacteria 4059994
582 8021624514 8021622325 Bacteria 4844743
583 8021627618 8021626552 Bacteria 4665214
584 8021650741 8021648035 Bacteria 4772378
585 Ga0495686_0025032
586 SwRhRL2b_contig_314363
587 SwRhRL2b_contig_3426700
588 JGI24748J21848_1001571
589 JGI24034J26672_10010741
590 JGI24751J29686_10013157
591 JGI25152J39213_1000548
592 JGI25150J39212_1000114
593 JGI25151J46595_10000100
594 JGI25151J46595_10000128
595 JGI25153J46596_10000071
596 rootL2_10284264
597 JGI26145J50221_1001698
598 JGI25404J52841_10001389
599 JGI25404J52841_10001494
600 Ga0055526_1000021
601 Ga0055526_1033149
602 Ga0055537_1000141
603 Ga0055537_1000215
604 Ga0055524_1000128
605 Ga0055524_1014005
606 Ga0055524_1036672
607 Ga0055536_1032767
608 Ga0055534_1000054
609 Ga0055534_1000086
610 Ga0055534_1002749
611 Ga0055534_1008954
612 Ga0055528_1000009
613 Ga0055528_1000761
614 Ga0055530_10001109
615 Ga0055530_10001882
616 Ga0055530_10002002
617 Ga0055531_10003842
618 Ga0055531_10016573
619 Ga0055531_10024914
620 Ga0058692_1000011
621 Ga0058692_1000024
622 Ga0065714_10009016
623 Ga0065704_10083971
624 Ga0065715_10230468
625 Ga0070658_10003169
626 Ga0070676_10000823
627 Ga0070683_100601705
628 Ga0070690_100001047
629 Ga0070670_100235742
630 Ga0070670_100351385
631 Ga0068869_100001783
632 Ga0070666_10006883
633 Ga0068868_100008917
634 Ga0070660_100003148
635 Ga0070689_100002391
636 Ga0070687_100000482
637 Ga0070661_100002001
638 Ga0070668_100101898
639 Ga0070669_100001422
640 Ga0070669_100133535
641 Ga0070675_100125530
642 Ga0070671_100003509
643 Ga0070671_100028192
644 Ga0070671_100171422
645 Ga0070671_100379399
646 Ga0070674_100001692
647 Ga0070673_100001060
648 Ga0070688_100001262
649 Ga0070659_100002780
650 Ga0070667_100024566
651 Ga0070701_10001351
652 Ga0070711_100176182
653 Ga0070705_100002638
654 Ga0070663_100133435
655 Ga0070678_100001920
656 Ga0070678_100128413
657 Ga0070662_100001874
658 Ga0070685_10001698
659 Ga0070707_100420902
660 Ga0070679_100023473
661 Ga0068853_100000493
662 Ga0070672_100002883
663 Ga0070672_100004233
664 Ga0070672_100006280
665 Ga0070686_100003027
666 Ga0070696_100014261
667 Ga0070693_100000733
668 Ga0070665_100163191
669 Ga0070704_100033595
670 Ga0068855_100006770
671 Ga0070664_100004932
672 Ga0070664_100005223
673 Ga0068857_100009400
674 Ga0068857_100027014
675 Ga0068854_100001701
676 Ga0068856_100004173
677 Ga0068852_100002227
678 Ga0068859_100007196
679 Ga0068864_100002312
680 Ga0068861_100001305
681 Ga0068851_10000877
682 Ga0068870_10000916
683 Ga0068863_100013509
684 Ga0068860_100005121
685 Ga0081540_1000988
686 Ga0075364_10000020
687 Ga0075364_10305274
688 Ga0097621_100004336
689 Ga0097621_100038064
690 Ga0068871_100030519
691 Ga0068871_100045248
692 Ga0075428_100145594
693 Ga0068865_100001849
694 Ga0097620_100007195
695 Ga0075435_100047690
696 Ga0105251_10003611
697 Ga0105244_10073322
698 Ga0105244_10101697
699 Ga0105240_10003240
700 Ga0111539_10055715
701 Ga0111539_10337812
702 Ga0111539_10554299
703 Ga0105245_10004441
704 Ga0105247_10001559
705 Ga0105247_10003375
706 Ga0105243_10004714
707 Ga0105241_10092460
708 Ga0105242_10000383
709 Ga0105242_10061274
710 Ga0105248_10001684
711 Ga0105248_10480713
712 Ga0105237_10001653
713 Ga0105238_10006399
714 Ga0105249_10000236
715 Ga0105032_104247
716 Ga0105028_104662
717 Ga0105239_10005084
718 Ga0105239_10663386
719 Ga0157316_1000157
720 Ga0157327_1001218
721 Ga0157373_10005972
722 Ga0157371_10000154
723 Ga0157371_10000875
724 Ga0157371_10002975
725 Ga0157371_10243859
726 Ga0157370_10006946
727 Ga0157369_10000652
728 Ga0157369_10022183
729 Ga0157374_10001223
730 Ga0157374_10341588
731 Ga0157378_10000522
732 Ga0163162_10001916
733 Ga0157372_10010891
734 Ga0157372_10019180
735 Ga0157375_10000635
736 Ga0157375_10049459
737 Ga0163163_10003411
738 Ga0157380_10035235
739 Ga0157380_10347957
740 Ga0182008_10000142
741 Ga0182008_10042134
742 Ga0157377_10000157
743 Ga0157379_10000177
744 Ga0157376_10391798
745 Ga0182007_10000287
746 Ga0182005_1000388
747 Ga0182005_1038803
748 Ga0183360_10001
749 Ga0183361_12046
750 Ga0163161_10001350
751 Ga0207425_1000030
752 Ga0209129_1000063
753 Ga0209565_1000022
754 Ga0209565_1000048
755 Ga0209673_1000001
756 Ga0209673_1000104
757 Ga0209673_1006793
758 Ga0209130_1012894
759 Ga0209130_1013338
760 Ga0209675_1000045
761 Ga0209675_1000048
762 Ga0209675_1012113
763 Ga0209676_1000024
764 Ga0209676_1000091
765 Ga0209676_1000117
766 Ga0209676_1001624
767 Ga0209676_1002128
768 Ga0209676_1002569
769 Ga0209676_1003631
770 Ga0209025_1000005
771 Ga0209025_1000013
772 Ga0209025_1004696
773 Ga0209025_1005156
774 Ga0209564_1000001
775 Ga0209564_1000213
776 Ga0209758_1000014
777 Ga0209758_1022517
778 Ga0209050_1000603
779 Ga0209050_1001495
780 Ga0209050_1001888
781 Ga0209050_1026023
782 Ga0209256_1000002
783 Ga0209256_1002292
784 Ga0209256_1004498
785 Ga0209256_1007996
786 Ga0209256_1040932
787 Ga0207426_1054761
788 Ga0209051_1001112
789 Ga0209051_1008525
790 Ga0209257_1000062
791 Ga0209257_1000122
792 Ga0209257_1000217
793 Ga0209257_1000243
794 Ga0209257_1001409
795 Ga0209257_1001747
796 Ga0209257_1002061
797 Ga0207697_10001596
798 Ga0207656_10000282
799 Ga0207655_1049487
800 Ga0207713_1000327
801 Ga0207642_10010727
802 Ga0207710_10002180
803 Ga0207710_10005312
804 Ga0207688_10001775
805 Ga0207680_10000618
806 Ga0207647_10000971
807 Ga0207645_10000048
808 Ga0207643_10000122
809 Ga0207705_10002690
810 Ga0207705_10091151
811 Ga0207695_10070094
812 Ga0207671_10002485
813 Ga0207663_10046160
814 Ga0207660_10454099
815 Ga0207662_10000265
816 Ga0207657_10000091
817 Ga0207649_10001088
818 Ga0207646_10088847
819 Ga0207681_10000696
820 Ga0207681_10129243
821 Ga0207681_10253784
822 Ga0207650_10000831
823 Ga0207650_10004381
824 Ga0207650_10158098
825 Ga0207650_10218226
826 Ga0207650_10246237
827 Ga0207659_10000335
828 Ga0207687_10108946
829 Ga0207664_10207997
830 Ga0207644_10000651
831 Ga0207644_10001250
832 Ga0207644_10372624
833 Ga0207690_10001654
834 Ga0207706_10000753
835 Ga0207706_10321204
836 Ga0207686_10005878
837 Ga0207709_10000562
838 Ga0207709_10013019
839 Ga0207709_10040468
840 Ga0207670_10000412
841 Ga0207669_10000372
842 Ga0207704_10000994
843 Ga0207691_10000058
844 Ga0207691_10001348
845 Ga0207691_10001351
846 Ga0207691_10280120
847 Ga0207711_10000401
848 Ga0207689_10000636
849 Ga0207679_10005224
850 Ga0207679_10008833
851 Ga0207679_10135097
852 Ga0207667_10008470
853 Ga0207651_10000315
854 Ga0207712_10000518
855 Ga0207668_10000761
856 Ga0207668_10020163
857 Ga0207640_10001807
858 Ga0207658_10001028
859 Ga0207677_10000116
860 Ga0207677_10030917
861 Ga0207703_10000226
862 Ga0207639_10003726
863 Ga0207678_10003479
864 Ga0207702_10007041
865 Ga0207641_10001536
866 Ga0207641_10018128
867 Ga0207648_10000769
868 Ga0207676_10000570
869 Ga0207674_10003927
870 Ga0207674_10007691
871 Ga0207675_100000045
872 Ga0207683_10002376
873 Ga0207683_10155613
874 Ga0207683_10232195
875 Ga0207698_10000612
876 Ga0209371_1000007
877 Ga0209371_1000016
878 Ga0209984_1012835
879 Ga0209999_1001293
880 Ga0209982_1002155
881 Ga0209983_1007591
882 Ga0209971_1001898
883 Ga0207428_10161778
884 Ga0268266_10000240
885 Ga0268266_10152633
886 Ga0268265_10001030
887 Ga0268264_10000769
888 Ga0265319_1000259
889 Ga0265318_10000150
890 Ga0265318_10002234
891 Ga0265338_10047622
892 Ga0268256_1000008
893 Ga0268256_1000015
894 Ga0316176_1170776
895 Ga0314311_1188486
896 Ga0316178_1121146
897 Ga0316181_1232513
898 Ga0316181_1257729
899 Ga0265330_10000166
900 Ga0265328_10098130
901 Ga0265320_10000381
902 Ga0265325_10001158
903 Ga0265329_10000352
904 Ga0265340_10000302
905 Ga0265340_10009220
906 Ga0265339_10002278
907 Ga0265331_10000709
908 Ga0265316_10002784
909 Ga0265316_10004280
910 Ga0307513_10039653
911 Ga0307509_10115061
912 Ga0307408_100017474
913 Ga0307408_100164128
914 Ga0307408_100337554
915 Ga0265313_10000378
916 Ga0265313_10001920
917 Ga0265314_10001502
918 Ga0265314_10012431
919 Ga0265342_10000725
920 Ga0316576_10064429
921 Ga0316578_10020283
922 Ga0307413_10006930
923 Ga0307413_10056758
924 Ga0307410_10236641
925 Ga0307406_10021651
926 Ga0307406_10063847
927 Ga0307406_10072049
928 Ga0307407_10057750
929 Ga0307412_10330483
930 Ga0307414_10004276
931 Ga0307414_10019038
932 Ga0307414_10025290
933 Ga0307414_10048036
934 Ga0307414_10084626
935 Ga0307414_10095010
936 Ga0307414_10124056
937 Ga0307414_10154948
938 Ga0307414_10205568
939 Ga0307414_10466962
940 Ga0307411_10037849
941 Ga0307411_10075655
942 Ga0307415_100162164
943 Ga0373947_0187718
944 Ga0373937_0119341
945 Ga0373937_0229305
946 Ga0395899_0090607
947 Ga0395900_0321630
948 Ga0395900_0589056
949 Ga0395898_0547308
950 Ga0395905_0000306
951 Ga0395905_0017994
952 Ga0395905_0338561
953 Ga0395905_0345517
954 Ga0436364_1010390
955 Ga0395901_0002348
956 Ga0237819_00617
957 Ga0237816_00655
958 Ga0436365_1765442
959 Ga0436360_1082159
960 Ga0439436_0018848
961 Ga0439436_0023498
962 Ga0439439_0005994
963 Ga0439439_0019516
964 Ga0439447_011954
965 Ga0439465_0001771
966 Ga0439465_0003673
967 Ga0439465_0004523
968 Ga0439465_0037900
969 Ga0439465_0090206
970 Ga0451797_0382392
971 Ga0451795_0443075
972 Ga0451798_0406233
973 Ga0451800_0326958
974 Ga0451806_516753
975 Ga0451807_0785375
976 Ga0451837_0162876
977 Ga0451837_0572425
978 Ga0451837_0578947
979 Ga0451837_0713293
980 Ga0451837_0773876
981 Ga0451841_1303890
982 Ga0451843_1035942
983 Ga0439431_0018601
984 Ga0439432_005521
985 Ga0439432_016258
986 Ga0439449_0000156
987 Ga0439449_0012229
988 Ga0439449_0012427
989 Ga0439449_0016777
990 Ga0439449_0032165
991 Ga0439450_007998
992 Ga0439455_0001840
993 Ga0450901_003263
994 Ga0451577_0042380
995 Ga0466966_0059036
996 Ga0453684_0014277
997 Ga0453684_0072777
998 Ga0495638_0001842
999 Ga0495638_0051744
1000 Ga0495606_0086909
1001 Ga0495610_0004733
1002 Ga0495631_0002006
1003 Ga0495643_0001695
1004 Ga0495663_0001507
1005 Ga0495663_0007487
1006 Ga0495663_0030882
1007 Ga0495598_0000742
1008 Ga0495621_0004671
1009 Ga0495622_0060002
1010 Ga0495633_0016986
1011 Ga0495656_0009800
1012 Ga0495656_0033683
1013 Ga0495659_0142024
1014 Ga0495671_0010539
1015 Ga0495636_0003452
1016 Ga0495636_0008887
1017 Ga0495636_0014005
1018 Ga0495636_0044107
1019 Ga0495672_0000073
1020 Ga0495686_0026392
1021 Ga0496101_0087253
1022 Ga0496101_0177725
1023 Ga0496102_0004532
1024 Ga0496106_0001090
1025 Ga0496106_0030699
1026 Ga0496107_0044662
1027 Ga0496108_0090168
1028 Ga0496109_0038143
1029 Ga0496109_0090422
1030 Ga0496112_0008685
1031 Ga0496114_0006407
1032 Ga0496115_0237052
1033 Ga0496117_0002324
1034 Ga0496117_0002722
1035 Ga0496117_0090355
1036 Ga0496118_0000344
1037 Ga0496118_0001379
1038 Ga0496118_0013072
1039 Ga0496118_0018080
1040 Ga0496118_0070648
1041 Ga0496119_0003326
1042 Ga0496119_0014839
1043 Ga0496119_0131850
1044 Ga0496120_0002285
1045 Ga0496120_0003024
1046 Ga0496121_0006284
1047 Ga0496121_0008043
1048 Ga0496122_0003858
1049 Ga0496122_0005074
1050 Ga0496122_0008107
1051 Ga0496122_0039435
1052 Ga0496122_0041940
1053 Ga0496122_0042161
1054 Ga0496122_0114519
1055 Ga0496123_0000669
1056 Ga0496123_0004123
1057 Ga0496123_0009080
1058 Ga0496123_0013609
1059 Ga0496123_0033730
1060 Ga0496124_0000009
1061 Ga0496124_0003480
1062 Ga0496124_0004112
1063 Ga0496124_0007146
1064 Ga0496124_0014062
1065 Ga0496124_0014864
1066 Ga0496124_0022002
1067 Ga0496125_0004477
1068 Ga0496125_0049749
1069 Ga0496125_0053334
1070 Ga0496126_0051425
1071 Ga0501290_000334
1072 Ga0501031_0015466
1073 Ga0501031_0040249
1074 Ga0501032_0003474
1075 Ga0501033_0002438
1076 Ga0501034_0000122
1077 Ga0501034_0001021
1078 Ga0501034_0002909
1079 Ga0501034_0007363
1080 Ga0501034_0087102
1081 Ga0501036_0120311
1082 Ga0501037_0030670
1083 Ga0501037_0061087
1084 Ga0501038_0005011
1085 Ga0501038_0046025
1086 Ga0501039_0031363
1087 Ga0501043_0006239
1088 Ga0501043_0026118
1089 Ga0501047_0068457
1090 Ga0501047_0178552
1091 Ga0501070_0009112
1092 Ga0501070_0138686
1093 Ga0501071_0094032
1094 Ga0501073_0015658
1095 Ga0501225_0016531
1096 Ga0501080_0105402
1097 Ga0501241_002421
1098 Ga0501265_001185
1099 Ga0501266_003663
1100 Ga0501275_000033
1101 Ga0501035_0104849
1102 Ga0501044_0046980
1103 Ga0501044_0420528
1104 nmdc:mga00v17_202_c2
1105 nmdc:mga00v17_55844_c1
1106 nmdc:mga08y16_277275_c1
1107 nmdc:mga08y16_41561_c1
1108 nmdc:mga08y16_449515_c1
1109 nmdc:mga0rr50_155503_c1
1110 Ga0500634_0000048
1111 Ga0500565_002311
1112 2547500017
1113 2572253562
1114 2578457593
1115 2643815267
1116 2643879306
1117 2643908752
1118 2643916180
1119 2643939945
1120 2643976192
1121 2644077003
1122 2644528898
1123 2644660605
1124 2644695317
1125 2644697966
1126 2747948104
1127 2748018289
1128 2765579889
1129 2816519068
1130 2819660075
1131 2842394852
1132 2842760618
1133 2842781110
1134 2852650010
1135 2852685109
1136 2857445550
1137 2874222572
1138 2894415894
1139 2895500817
1140 2895516313
1141 2895523768
1142 2895526651
1143 2919090513
1144 2919130649
1145 2919137554
1146 2919516122
1147 2919677954
1148 2923517962
1149 2928498348
1150 2929198348
1151 2931383971
1152 2937614469
1153 2939591115
1154 2939624609
1155 2939628317
1156 2941476646
1157 2941491140
1158 2961049337
1159 2961065971
1160 2974308213
1161 2977248971
1162 2984516578
1163 2987607370
1164 2995952071
1165 8003014577
1166 8021624514
1167 8021627618
1168 8021650741

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17848

zf-ACC

Acetyl-CoA carboxylase zinc finger domain

46

71

0.98

PF01039

Carboxyl_trans

Carboxyl transferase domain

102

268

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9279 29 282
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9276 29 287
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9071 29 282
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9069 29 287
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8984 29 287
ID Description Score Start End Superfamily
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9276 29 287 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9169 28 282 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9069 29 287 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8984 29 287 3.90.226.10
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8968 28 282 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A522GU42-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9344 190 287 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A3Q0KZV0-F1-model_v4 Acetyl-CoA carboxylase beta subunit 0.9339 181 287 GO:0003989
GO:0006633
GO:0009329
GO:2001295
AF-A0A1B8QA07-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9338 29 284 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009329
GO:0016743
GO:2001295
AF-A0A126QHE5-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9333 39 288 GO:0003989
GO:0005524
GO:0006633
GO:0009329
GO:0016743
GO:2001295
AF-H9UL55-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9333 31 283 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:2001295

Map