F466397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 385 | 1168 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0025032|Ga0495686_0025032_1957_2913 |
| Length | 318 |
| Sequence | MAFCGPVGLPCKDRHHRMSWLSKLMPSGIRTDNTPSKKRSVPEGLWEKCSNCGAVLYRPELEENLEVCPKCGHHMAIRARARLASLFDPGSSSEIAAHLGPVDVLKFRDQKKYADRIKSTQKATGEFDALVAMRGLLKGNPLVASSFDFAFMGGSMGSVVGERFARAAEVALEWGCPYVCFSASGGARMQEGLFSLMQMAKTSAALGRLREAGLPYISVLTHPTTGGVSASFAMLGDINIAEPQALIGFAGPRVIEQTVREKLPEGFQRSEFLVEHGAIDQICDRREMRDRIADLTAMMMRQPRPTADDAPVTSPTAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 97 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 119 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 206 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 207 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 208 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 243 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 246 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 247 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 248 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 257 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 263 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 264 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 320 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 321 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 328 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 329 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 330 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 331 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 332 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 333 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 334 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 335 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 336 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 337 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 338 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 339 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 340 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 341 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 342 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 343 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 344 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 345 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 346 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 347 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 348 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 349 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 350 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 351 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 352 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 353 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 354 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 355 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 356 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 357 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 358 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 359 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 360 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 361 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 362 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 363 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 364 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 365 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 366 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 367 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 368 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 369 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 370 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 371 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 372 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 373 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 374 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 375 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 376 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 377 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 378 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 379 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 380 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 381 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 382 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 383 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 384 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 385 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.24 |
| Metatranscriptomes | 0 |
| Isolates | 9.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 13.18 |
| Nodule | 0.17 |
| Rhizoplane | 3.08 |
| Rhizosphere | 69.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0025032 | 3300047472 | Bacteria | 3914 |
| 2 | SwRhRL2b_contig_314363 | 2162886007 | Bacteria | 1254 |
| 3 | SwRhRL2b_contig_3426700 | 2162886007 | Bacteria | 2356 |
| 4 | JGI24748J21848_1001571 | 3300002074 | Bacteria | 2537 |
| 5 | JGI24034J26672_10010741 | 3300002239 | Bacteria | 1366 |
| 6 | JGI24751J29686_10013157 | 3300002459 | Bacteria | 1707 |
| 7 | JGI25152J39213_1000548 | 3300002773 | Bacteria | 20669 |
| 8 | JGI25150J39212_1000114 | 3300002774 | Bacteria | 45745 |
| 9 | JGI25151J46595_10000100 | 3300003187 | Bacteria | 116522 |
| 10 | JGI25151J46595_10000128 | 3300003187 | Bacteria | 102514 |
| 11 | JGI25153J46596_10000071 | 3300003215 | Bacteria | 116950 |
| 12 | rootL2_10284264 | 3300003322 | Bacteria | 2489 |
| 13 | JGI26145J50221_1001698 | 3300003371 | Bacteria | 1728 |
| 14 | JGI25404J52841_10001389 | 3300003659 | Bacteria | 4240 |
| 15 | JGI25404J52841_10001494 | 3300003659 | Bacteria | 4131 |
| 16 | Ga0055526_1000021 | 3300003771 | Bacteria | 180007 |
| 17 | Ga0055526_1033149 | 3300003771 | Bacteria | 1440 |
| 18 | Ga0055537_1000141 | 3300003773 | Bacteria | 54030 |
| 19 | Ga0055537_1000215 | 3300003773 | Bacteria | 42710 |
| 20 | Ga0055524_1000128 | 3300003775 | Bacteria | 88986 |
| 21 | Ga0055524_1014005 | 3300003775 | Bacteria | 2994 |
| 22 | Ga0055524_1036672 | 3300003775 | Bacteria | 1313 |
| 23 | Ga0055536_1032767 | 3300003781 | Bacteria | 1338 |
| 24 | Ga0055534_1000054 | 3300003784 | Bacteria | 88986 |
| 25 | Ga0055534_1000086 | 3300003784 | Bacteria | 72299 |
| 26 | Ga0055534_1002749 | 3300003784 | Bacteria | 5898 |
| 27 | Ga0055534_1008954 | 3300003784 | Bacteria | 2218 |
| 28 | Ga0055528_1000009 | 3300003790 | Bacteria | 224150 |
| 29 | Ga0055528_1000761 | 3300003790 | Bacteria | 22501 |
| 30 | Ga0055530_10001109 | 3300003791 | Bacteria | 21055 |
| 31 | Ga0055530_10001882 | 3300003791 | Bacteria | 14399 |
| 32 | Ga0055530_10002002 | 3300003791 | Bacteria | 13806 |
| 33 | Ga0055531_10003842 | 3300003794 | Bacteria | 9406 |
| 34 | Ga0055531_10016573 | 3300003794 | Bacteria | 3169 |
| 35 | Ga0055531_10024914 | 3300003794 | Bacteria | 2191 |
| 36 | Ga0058692_1000011 | 3300003856 | Bacteria | 321321 |
| 37 | Ga0058692_1000024 | 3300003856 | Bacteria | 219702 |
| 38 | Ga0065714_10009016 | 3300005288 | Bacteria | 4227 |
| 39 | Ga0065704_10083971 | 3300005289 | Bacteria | 3393 |
| 40 | Ga0065715_10230468 | 3300005293 | Bacteria | 1236 |
| 41 | Ga0070658_10003169 | 3300005327 | Bacteria | 13581 |
| 42 | Ga0070676_10000823 | 3300005328 | Bacteria | 15347 |
| 43 | Ga0070683_100601705 | 3300005329 | Bacteria | 1052 |
| 44 | Ga0070690_100001047 | 3300005330 | Bacteria | 14161 |
| 45 | Ga0070670_100235742 | 3300005331 | Bacteria | 1593 |
| 46 | Ga0070670_100351385 | 3300005331 | Bacteria | 1295 |
| 47 | Ga0068869_100001783 | 3300005334 | Bacteria | 12898 |
| 48 | Ga0070666_10006883 | 3300005335 | Bacteria | 7004 |
| 49 | Ga0068868_100008917 | 3300005338 | Bacteria | 7192 |
| 50 | Ga0070660_100003148 | 3300005339 | Bacteria | 11336 |
| 51 | Ga0070689_100002391 | 3300005340 | Bacteria | 12238 |
| 52 | Ga0070687_100000482 | 3300005343 | Bacteria | 13313 |
| 53 | Ga0070661_100002001 | 3300005344 | Bacteria | 14102 |
| 54 | Ga0070668_100101898 | 3300005347 | Bacteria | 2276 |
| 55 | Ga0070669_100001422 | 3300005353 | Bacteria | 17301 |
| 56 | Ga0070669_100133535 | 3300005353 | Bacteria | 1907 |
| 57 | Ga0070675_100125530 | 3300005354 | Bacteria | 2183 |
| 58 | Ga0070671_100003509 | 3300005355 | Bacteria | 12254 |
| 59 | Ga0070671_100028192 | 3300005355 | Bacteria | 4623 |
| 60 | Ga0070671_100171422 | 3300005355 | Bacteria | 1835 |
| 61 | Ga0070671_100379399 | 3300005355 | Bacteria | 1208 |
| 62 | Ga0070674_100001692 | 3300005356 | Bacteria | 11936 |
| 63 | Ga0070673_100001060 | 3300005364 | Bacteria | 15669 |
| 64 | Ga0070688_100001262 | 3300005365 | Bacteria | 12614 |
| 65 | Ga0070659_100002780 | 3300005366 | Bacteria | 12456 |
| 66 | Ga0070667_100024566 | 3300005367 | Bacteria | 5006 |
| 67 | Ga0070701_10001351 | 3300005438 | Bacteria | 9039 |
| 68 | Ga0070711_100176182 | 3300005439 | Bacteria | 1634 |
| 69 | Ga0070705_100002638 | 3300005440 | Bacteria | 8976 |
| 70 | Ga0070663_100133435 | 3300005455 | Bacteria | 1888 |
| 71 | Ga0070678_100001920 | 3300005456 | Bacteria | 11205 |
| 72 | Ga0070678_100128413 | 3300005456 | Bacteria | 2010 |
| 73 | Ga0070662_100001874 | 3300005457 | Bacteria | 12883 |
| 74 | Ga0070685_10001698 | 3300005466 | Bacteria | 11571 |
| 75 | Ga0070707_100420902 | 3300005468 | Bacteria | 1296 |
| 76 | Ga0070679_100023473 | 3300005530 | Bacteria | 6038 |
| 77 | Ga0068853_100000493 | 3300005539 | Bacteria | 26977 |
| 78 | Ga0070672_100002883 | 3300005543 | Bacteria | 11058 |
| 79 | Ga0070672_100004233 | 3300005543 | Bacteria | 9382 |
| 80 | Ga0070672_100006280 | 3300005543 | Bacteria | 7965 |
| 81 | Ga0070686_100003027 | 3300005544 | Bacteria | 9214 |
| 82 | Ga0070696_100014261 | 3300005546 | Bacteria | 5332 |
| 83 | Ga0070693_100000733 | 3300005547 | Bacteria | 14439 |
| 84 | Ga0070665_100163191 | 3300005548 | Bacteria | 2230 |
| 85 | Ga0070704_100033595 | 3300005549 | Bacteria | 3470 |
| 86 | Ga0068855_100006770 | 3300005563 | Bacteria | 13901 |
| 87 | Ga0070664_100004932 | 3300005564 | Bacteria | 10689 |
| 88 | Ga0070664_100005223 | 3300005564 | Bacteria | 10415 |
| 89 | Ga0068857_100009400 | 3300005577 | Bacteria | 8485 |
| 90 | Ga0068857_100027014 | 3300005577 | Bacteria | 5064 |
| 91 | Ga0068854_100001701 | 3300005578 | Bacteria | 13390 |
| 92 | Ga0068856_100004173 | 3300005614 | Bacteria | 14429 |
| 93 | Ga0068852_100002227 | 3300005616 | Bacteria | 13300 |
| 94 | Ga0068859_100007196 | 3300005617 | Bacteria | 11296 |
| 95 | Ga0068864_100002312 | 3300005618 | Bacteria | 15766 |
| 96 | Ga0068861_100001305 | 3300005719 | Bacteria | 15610 |
| 97 | Ga0068851_10000877 | 3300005834 | Bacteria | 12968 |
| 98 | Ga0068870_10000916 | 3300005840 | Bacteria | 11544 |
| 99 | Ga0068863_100013509 | 3300005841 | Bacteria | 7877 |
| 100 | Ga0068860_100005121 | 3300005843 | Bacteria | 13330 |
| 101 | Ga0081540_1000988 | 3300005983 | Bacteria | 25634 |
| 102 | Ga0075364_10000020 | 3300006051 | Bacteria | 54215 |
| 103 | Ga0075364_10305274 | 3300006051 | Bacteria | 1083 |
| 104 | Ga0097621_100004336 | 3300006237 | Bacteria | 9858 |
| 105 | Ga0097621_100038064 | 3300006237 | Bacteria | 3859 |
| 106 | Ga0068871_100030519 | 3300006358 | Bacteria | 4245 |
| 107 | Ga0068871_100045248 | 3300006358 | Bacteria | 3542 |
| 108 | Ga0075428_100145594 | 3300006844 | Bacteria | 2575 |
| 109 | Ga0068865_100001849 | 3300006881 | Bacteria | 12426 |
| 110 | Ga0097620_100007195 | 3300006931 | Bacteria | 11296 |
| 111 | Ga0075435_100047690 | 3300007076 | Bacteria | 3440 |
| 112 | Ga0105251_10003611 | 3300009011 | Bacteria | 11123 |
| 113 | Ga0105244_10073322 | 3300009036 | Bacteria | 1704 |
| 114 | Ga0105244_10101697 | 3300009036 | Bacteria | 1405 |
| 115 | Ga0105240_10003240 | 3300009093 | Bacteria | 25471 |
| 116 | Ga0111539_10055715 | 3300009094 | Bacteria | 4700 |
| 117 | Ga0111539_10337812 | 3300009094 | Bacteria | 1753 |
| 118 | Ga0111539_10554299 | 3300009094 | Bacteria | 1339 |
| 119 | Ga0105245_10004441 | 3300009098 | Bacteria | 12406 |
| 120 | Ga0105247_10001559 | 3300009101 | Bacteria | 16324 |
| 121 | Ga0105247_10003375 | 3300009101 | Bacteria | 10443 |
| 122 | Ga0105243_10004714 | 3300009148 | Bacteria | 10737 |
| 123 | Ga0105241_10092460 | 3300009174 | Bacteria | 2389 |
| 124 | Ga0105242_10000383 | 3300009176 | Bacteria | 35192 |
| 125 | Ga0105242_10061274 | 3300009176 | Bacteria | 3094 |
| 126 | Ga0105248_10001684 | 3300009177 | Bacteria | 24603 |
| 127 | Ga0105248_10480713 | 3300009177 | Bacteria | 1400 |
| 128 | Ga0105237_10001653 | 3300009545 | Bacteria | 28941 |
| 129 | Ga0105238_10006399 | 3300009551 | Bacteria | 11718 |
| 130 | Ga0105249_10000236 | 3300009553 | Bacteria | 62582 |
| 131 | Ga0105032_104247 | 3300009979 | Bacteria | 1228 |
| 132 | Ga0105028_104662 | 3300009993 | Bacteria | 1428 |
| 133 | Ga0105239_10005084 | 3300010375 | Bacteria | 15527 |
| 134 | Ga0105239_10663386 | 3300010375 | Bacteria | 1191 |
| 135 | Ga0157316_1000157 | 3300012510 | Bacteria | 3258 |
| 136 | Ga0157327_1001218 | 3300012512 | Bacteria | 1569 |
| 137 | Ga0157373_10005972 | 3300013100 | Bacteria | 9106 |
| 138 | Ga0157371_10000154 | 3300013102 | Bacteria | 100237 |
| 139 | Ga0157371_10000875 | 3300013102 | Bacteria | 34150 |
| 140 | Ga0157371_10002975 | 3300013102 | Bacteria | 15728 |
| 141 | Ga0157371_10243859 | 3300013102 | Bacteria | 1293 |
| 142 | Ga0157370_10006946 | 3300013104 | Bacteria | 12369 |
| 143 | Ga0157369_10000652 | 3300013105 | Bacteria | 44858 |
| 144 | Ga0157369_10022183 | 3300013105 | Bacteria | 7092 |
| 145 | Ga0157374_10001223 | 3300013296 | Bacteria | 21944 |
| 146 | Ga0157374_10341588 | 3300013296 | Bacteria | 1486 |
| 147 | Ga0157378_10000522 | 3300013297 | Bacteria | 36590 |
| 148 | Ga0163162_10001916 | 3300013306 | Bacteria | 19589 |
| 149 | Ga0157372_10010891 | 3300013307 | Bacteria | 9679 |
| 150 | Ga0157372_10019180 | 3300013307 | Bacteria | 7364 |
| 151 | Ga0157375_10000635 | 3300013308 | Bacteria | 31214 |
| 152 | Ga0157375_10049459 | 3300013308 | Bacteria | 4119 |
| 153 | Ga0163163_10003411 | 3300014325 | Bacteria | 13499 |
| 154 | Ga0157380_10035235 | 3300014326 | Bacteria | 3865 |
| 155 | Ga0157380_10347957 | 3300014326 | Bacteria | 1386 |
| 156 | Ga0182008_10000142 | 3300014497 | Bacteria | 55320 |
| 157 | Ga0182008_10042134 | 3300014497 | Bacteria | 2275 |
| 158 | Ga0157377_10000157 | 3300014745 | Bacteria | 41711 |
| 159 | Ga0157379_10000177 | 3300014968 | Bacteria | 48021 |
| 160 | Ga0157376_10391798 | 3300014969 | Bacteria | 1341 |
| 161 | Ga0182007_10000287 | 3300015262 | Bacteria | 33403 |
| 162 | Ga0182005_1000388 | 3300015265 | Bacteria | 24055 |
| 163 | Ga0182005_1038803 | 3300015265 | Bacteria | 1296 |
| 164 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 165 | Ga0183361_12046 | 3300016635 | Bacteria | 1076 |
| 166 | Ga0163161_10001350 | 3300017792 | Bacteria | 18251 |
| 167 | Ga0207425_1000030 | 3300025245 | Bacteria | 268200 |
| 168 | Ga0209129_1000063 | 3300025258 | Bacteria | 240205 |
| 169 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 170 | Ga0209565_1000048 | 3300025263 | Bacteria | 224961 |
| 171 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 172 | Ga0209673_1000104 | 3300025273 | Bacteria | 186569 |
| 173 | Ga0209673_1006793 | 3300025273 | Bacteria | 5435 |
| 174 | Ga0209130_1012894 | 3300025284 | Bacteria | 2164 |
| 175 | Ga0209130_1013338 | 3300025284 | Bacteria | 2108 |
| 176 | Ga0209675_1000045 | 3300025291 | Bacteria | 225750 |
| 177 | Ga0209675_1000048 | 3300025291 | Bacteria | 221457 |
| 178 | Ga0209675_1012113 | 3300025291 | Bacteria | 2802 |
| 179 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 180 | Ga0209676_1000091 | 3300025292 | Bacteria | 251328 |
| 181 | Ga0209676_1000117 | 3300025292 | Bacteria | 203251 |
| 182 | Ga0209676_1001624 | 3300025292 | Bacteria | 19895 |
| 183 | Ga0209676_1002128 | 3300025292 | Bacteria | 15135 |
| 184 | Ga0209676_1002569 | 3300025292 | Bacteria | 12546 |
| 185 | Ga0209676_1003631 | 3300025292 | Bacteria | 9275 |
| 186 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 187 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 188 | Ga0209025_1004696 | 3300025294 | Bacteria | 11657 |
| 189 | Ga0209025_1005156 | 3300025294 | Bacteria | 10822 |
| 190 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 191 | Ga0209564_1000213 | 3300025295 | Bacteria | 132985 |
| 192 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 193 | Ga0209758_1022517 | 3300025297 | Bacteria | 2884 |
| 194 | Ga0209050_1000603 | 3300025298 | Bacteria | 57120 |
| 195 | Ga0209050_1001495 | 3300025298 | Bacteria | 24789 |
| 196 | Ga0209050_1001888 | 3300025298 | Bacteria | 20105 |
| 197 | Ga0209050_1026023 | 3300025298 | Bacteria | 1970 |
| 198 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 199 | Ga0209256_1002292 | 3300025299 | Bacteria | 16094 |
| 200 | Ga0209256_1004498 | 3300025299 | Bacteria | 8709 |
| 201 | Ga0209256_1007996 | 3300025299 | Bacteria | 5028 |
| 202 | Ga0209256_1040932 | 3300025299 | Bacteria | 1180 |
| 203 | Ga0207426_1054761 | 3300025302 | Bacteria | 1172 |
| 204 | Ga0209051_1001112 | 3300025303 | Bacteria | 24636 |
| 205 | Ga0209051_1008525 | 3300025303 | Bacteria | 5416 |
| 206 | Ga0209257_1000062 | 3300025304 | Bacteria | 362413 |
| 207 | Ga0209257_1000122 | 3300025304 | Bacteria | 219678 |
| 208 | Ga0209257_1000217 | 3300025304 | Bacteria | 136049 |
| 209 | Ga0209257_1000243 | 3300025304 | Bacteria | 126291 |
| 210 | Ga0209257_1001409 | 3300025304 | Bacteria | 28685 |
| 211 | Ga0209257_1001747 | 3300025304 | Bacteria | 24118 |
| 212 | Ga0209257_1002061 | 3300025304 | Bacteria | 21277 |
| 213 | Ga0207697_10001596 | 3300025315 | Bacteria | 12238 |
| 214 | Ga0207656_10000282 | 3300025321 | Bacteria | 17537 |
| 215 | Ga0207655_1049487 | 3300025728 | Bacteria | 1715 |
| 216 | Ga0207713_1000327 | 3300025735 | Bacteria | 53351 |
| 217 | Ga0207642_10010727 | 3300025899 | Bacteria | 3243 |
| 218 | Ga0207710_10002180 | 3300025900 | Bacteria | 9204 |
| 219 | Ga0207710_10005312 | 3300025900 | Bacteria | 5559 |
| 220 | Ga0207688_10001775 | 3300025901 | Bacteria | 11449 |
| 221 | Ga0207680_10000618 | 3300025903 | Bacteria | 16764 |
| 222 | Ga0207647_10000971 | 3300025904 | Bacteria | 22177 |
| 223 | Ga0207645_10000048 | 3300025907 | Bacteria | 84942 |
| 224 | Ga0207643_10000122 | 3300025908 | Bacteria | 53121 |
| 225 | Ga0207705_10002690 | 3300025909 | Bacteria | 13611 |
| 226 | Ga0207705_10091151 | 3300025909 | Bacteria | 2232 |
| 227 | Ga0207695_10070094 | 3300025913 | Bacteria | 3585 |
| 228 | Ga0207671_10002485 | 3300025914 | Bacteria | 19695 |
| 229 | Ga0207663_10046160 | 3300025916 | Bacteria | 2683 |
| 230 | Ga0207660_10454099 | 3300025917 | Bacteria | 1037 |
| 231 | Ga0207662_10000265 | 3300025918 | Bacteria | 24159 |
| 232 | Ga0207657_10000091 | 3300025919 | Bacteria | 86419 |
| 233 | Ga0207649_10001088 | 3300025920 | Bacteria | 16515 |
| 234 | Ga0207646_10088847 | 3300025922 | Bacteria | 2766 |
| 235 | Ga0207681_10000696 | 3300025923 | Bacteria | 22068 |
| 236 | Ga0207681_10129243 | 3300025923 | Bacteria | 1865 |
| 237 | Ga0207681_10253784 | 3300025923 | Bacteria | 1374 |
| 238 | Ga0207650_10000831 | 3300025925 | Bacteria | 23640 |
| 239 | Ga0207650_10004381 | 3300025925 | Bacteria | 9643 |
| 240 | Ga0207650_10158098 | 3300025925 | Bacteria | 1794 |
| 241 | Ga0207650_10218226 | 3300025925 | Bacteria | 1534 |
| 242 | Ga0207650_10246237 | 3300025925 | Bacteria | 1446 |
| 243 | Ga0207659_10000335 | 3300025926 | Bacteria | 28308 |
| 244 | Ga0207687_10108946 | 3300025927 | Bacteria | 2052 |
| 245 | Ga0207664_10207997 | 3300025929 | Bacteria | 1692 |
| 246 | Ga0207644_10000651 | 3300025931 | Bacteria | 21967 |
| 247 | Ga0207644_10001250 | 3300025931 | Bacteria | 16343 |
| 248 | Ga0207644_10372624 | 3300025931 | Bacteria | 1163 |
| 249 | Ga0207690_10001654 | 3300025932 | Bacteria | 13774 |
| 250 | Ga0207706_10000753 | 3300025933 | Bacteria | 33684 |
| 251 | Ga0207706_10321204 | 3300025933 | Bacteria | 1347 |
| 252 | Ga0207686_10005878 | 3300025934 | Bacteria | 6584 |
| 253 | Ga0207709_10000562 | 3300025935 | Bacteria | 31535 |
| 254 | Ga0207709_10013019 | 3300025935 | Bacteria | 4586 |
| 255 | Ga0207709_10040468 | 3300025935 | Bacteria | 2790 |
| 256 | Ga0207670_10000412 | 3300025936 | Bacteria | 24343 |
| 257 | Ga0207669_10000372 | 3300025937 | Bacteria | 20153 |
| 258 | Ga0207704_10000994 | 3300025938 | Bacteria | 12575 |
| 259 | Ga0207691_10000058 | 3300025940 | Bacteria | 87937 |
| 260 | Ga0207691_10001348 | 3300025940 | Bacteria | 24480 |
| 261 | Ga0207691_10001351 | 3300025940 | Bacteria | 24456 |
| 262 | Ga0207691_10280120 | 3300025940 | Bacteria | 1435 |
| 263 | Ga0207711_10000401 | 3300025941 | Bacteria | 45756 |
| 264 | Ga0207689_10000636 | 3300025942 | Bacteria | 33492 |
| 265 | Ga0207679_10005224 | 3300025945 | Bacteria | 8140 |
| 266 | Ga0207679_10008833 | 3300025945 | Bacteria | 6423 |
| 267 | Ga0207679_10135097 | 3300025945 | Bacteria | 1985 |
| 268 | Ga0207667_10008470 | 3300025949 | Bacteria | 12213 |
| 269 | Ga0207651_10000315 | 3300025960 | Bacteria | 20714 |
| 270 | Ga0207712_10000518 | 3300025961 | Bacteria | 31766 |
| 271 | Ga0207668_10000761 | 3300025972 | Bacteria | 19674 |
| 272 | Ga0207668_10020163 | 3300025972 | Bacteria | 4230 |
| 273 | Ga0207640_10001807 | 3300025981 | Bacteria | 11479 |
| 274 | Ga0207658_10001028 | 3300025986 | Bacteria | 22711 |
| 275 | Ga0207677_10000116 | 3300026023 | Bacteria | 65208 |
| 276 | Ga0207677_10030917 | 3300026023 | Bacteria | 3424 |
| 277 | Ga0207703_10000226 | 3300026035 | Bacteria | 64851 |
| 278 | Ga0207639_10003726 | 3300026041 | Bacteria | 10258 |
| 279 | Ga0207678_10003479 | 3300026067 | Bacteria | 14174 |
| 280 | Ga0207702_10007041 | 3300026078 | Bacteria | 9623 |
| 281 | Ga0207641_10001536 | 3300026088 | Bacteria | 22584 |
| 282 | Ga0207641_10018128 | 3300026088 | Bacteria | 5769 |
| 283 | Ga0207648_10000769 | 3300026089 | Bacteria | 36104 |
| 284 | Ga0207676_10000570 | 3300026095 | Bacteria | 30527 |
| 285 | Ga0207674_10003927 | 3300026116 | Bacteria | 18099 |
| 286 | Ga0207674_10007691 | 3300026116 | Bacteria | 12547 |
| 287 | Ga0207675_100000045 | 3300026118 | Bacteria | 87487 |
| 288 | Ga0207683_10002376 | 3300026121 | Bacteria | 16434 |
| 289 | Ga0207683_10155613 | 3300026121 | Bacteria | 2064 |
| 290 | Ga0207683_10232195 | 3300026121 | Bacteria | 1683 |
| 291 | Ga0207698_10000612 | 3300026142 | Bacteria | 20810 |
| 292 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 293 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 294 | Ga0209984_1012835 | 3300027424 | Bacteria | 1095 |
| 295 | Ga0209999_1001293 | 3300027543 | Bacteria | 4291 |
| 296 | Ga0209982_1002155 | 3300027552 | Bacteria | 2740 |
| 297 | Ga0209983_1007591 | 3300027665 | Bacteria | 2222 |
| 298 | Ga0209971_1001898 | 3300027682 | Bacteria | 5116 |
| 299 | Ga0207428_10161778 | 3300027907 | Bacteria | 1699 |
| 300 | Ga0268266_10000240 | 3300028379 | Bacteria | 93100 |
| 301 | Ga0268266_10152633 | 3300028379 | Bacteria | 2083 |
| 302 | Ga0268265_10001030 | 3300028380 | Bacteria | 25149 |
| 303 | Ga0268264_10000769 | 3300028381 | Bacteria | 35484 |
| 304 | Ga0265319_1000259 | 3300028563 | Bacteria | 40074 |
| 305 | Ga0265318_10000150 | 3300028577 | Bacteria | 63092 |
| 306 | Ga0265318_10002234 | 3300028577 | Bacteria | 10439 |
| 307 | Ga0265338_10047622 | 3300028800 | Bacteria | 3913 |
| 308 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 309 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 310 | Ga0316176_1170776 | 3300030732 | Bacteria | 2355 |
| 311 | Ga0314311_1188486 | 3300030733 | Bacteria | 7455 |
| 312 | Ga0316178_1121146 | 3300030735 | Bacteria | 2036 |
| 313 | Ga0316181_1232513 | 3300030744 | Bacteria | 2551 |
| 314 | Ga0316181_1257729 | 3300030744 | Bacteria | 2963 |
| 315 | Ga0265330_10000166 | 3300031235 | Bacteria | 52307 |
| 316 | Ga0265328_10098130 | 3300031239 | Bacteria | 1084 |
| 317 | Ga0265320_10000381 | 3300031240 | Bacteria | 35971 |
| 318 | Ga0265325_10001158 | 3300031241 | Bacteria | 18894 |
| 319 | Ga0265329_10000352 | 3300031242 | Bacteria | 24264 |
| 320 | Ga0265340_10000302 | 3300031247 | Bacteria | 25964 |
| 321 | Ga0265340_10009220 | 3300031247 | Bacteria | 5302 |
| 322 | Ga0265339_10002278 | 3300031249 | Bacteria | 13836 |
| 323 | Ga0265331_10000709 | 3300031250 | Bacteria | 28371 |
| 324 | Ga0265316_10002784 | 3300031344 | Bacteria | 17920 |
| 325 | Ga0265316_10004280 | 3300031344 | Bacteria | 14247 |
| 326 | Ga0307513_10039653 | 3300031456 | Bacteria | 5219 |
| 327 | Ga0307509_10115061 | 3300031507 | Bacteria | 2683 |
| 328 | Ga0307408_100017474 | 3300031548 | Bacteria | 4801 |
| 329 | Ga0307408_100164128 | 3300031548 | Bacteria | 1767 |
| 330 | Ga0307408_100337554 | 3300031548 | Bacteria | 1274 |
| 331 | Ga0265313_10000378 | 3300031595 | Bacteria | 48043 |
| 332 | Ga0265313_10001920 | 3300031595 | Bacteria | 18868 |
| 333 | Ga0265314_10001502 | 3300031711 | Bacteria | 25850 |
| 334 | Ga0265314_10012431 | 3300031711 | Bacteria | 6946 |
| 335 | Ga0265342_10000725 | 3300031712 | Bacteria | 34013 |
| 336 | Ga0316576_10064429 | 3300031727 | Bacteria | 2692 |
| 337 | Ga0316578_10020283 | 3300031728 | Bacteria | 3670 |
| 338 | Ga0307413_10006930 | 3300031824 | Bacteria | 5218 |
| 339 | Ga0307413_10056758 | 3300031824 | Bacteria | 2390 |
| 340 | Ga0307410_10236641 | 3300031852 | Bacteria | 1413 |
| 341 | Ga0307406_10021651 | 3300031901 | Bacteria | 3806 |
| 342 | Ga0307406_10063847 | 3300031901 | Bacteria | 2387 |
| 343 | Ga0307406_10072049 | 3300031901 | Bacteria | 2267 |
| 344 | Ga0307407_10057750 | 3300031903 | Bacteria | 2253 |
| 345 | Ga0307412_10330483 | 3300031911 | Bacteria | 1216 |
| 346 | Ga0307414_10004276 | 3300032004 | Bacteria | 7747 |
| 347 | Ga0307414_10019038 | 3300032004 | Bacteria | 4245 |
| 348 | Ga0307414_10025290 | 3300032004 | Bacteria | 3800 |
| 349 | Ga0307414_10048036 | 3300032004 | Bacteria | 2941 |
| 350 | Ga0307414_10084626 | 3300032004 | Bacteria | 2333 |
| 351 | Ga0307414_10095010 | 3300032004 | Bacteria | 2226 |
| 352 | Ga0307414_10124056 | 3300032004 | Bacteria | 1991 |
| 353 | Ga0307414_10154948 | 3300032004 | Bacteria | 1812 |
| 354 | Ga0307414_10205568 | 3300032004 | Bacteria | 1605 |
| 355 | Ga0307414_10466962 | 3300032004 | Bacteria | 1110 |
| 356 | Ga0307411_10037849 | 3300032005 | Bacteria | 3037 |
| 357 | Ga0307411_10075655 | 3300032005 | Bacteria | 2299 |
| 358 | Ga0307415_100162164 | 3300032126 | Bacteria | 1734 |
| 359 | Ga0373947_0187718 | 3300035725 | Bacteria | 1348 |
| 360 | Ga0373937_0119341 | 3300036401 | Bacteria | 2457 |
| 361 | Ga0373937_0229305 | 3300036401 | Bacteria | 1749 |
| 362 | Ga0395899_0090607 | 3300037312 | Bacteria | 2217 |
| 363 | Ga0395900_0321630 | 3300037418 | Bacteria | 1527 |
| 364 | Ga0395900_0589056 | 3300037418 | Bacteria | 1053 |
| 365 | Ga0395898_0547308 | 3300037466 | Bacteria | 1099 |
| 366 | Ga0395905_0000306 | 3300037471 | Bacteria | 71299 |
| 367 | Ga0395905_0017994 | 3300037471 | Bacteria | 6709 |
| 368 | Ga0395905_0338561 | 3300037471 | Bacteria | 1395 |
| 369 | Ga0395905_0345517 | 3300037471 | Bacteria | 1379 |
| 370 | Ga0436364_1010390 | 3300037853 | Bacteria | 973 |
| 371 | Ga0395901_0002348 | 3300038443 | Bacteria | 19240 |
| 372 | Ga0237819_00617 | 3300038705 | Bacteria | 11655 |
| 373 | Ga0237816_00655 | 3300039145 | Bacteria | 2916 |
| 374 | Ga0436365_1765442 | 3300039437 | Bacteria | 1843 |
| 375 | Ga0436360_1082159 | 3300039438 | Bacteria | 1155 |
| 376 | Ga0439436_0018848 | 3300041404 | Bacteria | 2063 |
| 377 | Ga0439436_0023498 | 3300041404 | Bacteria | 1823 |
| 378 | Ga0439439_0005994 | 3300041406 | Bacteria | 2798 |
| 379 | Ga0439439_0019516 | 3300041406 | Bacteria | 1684 |
| 380 | Ga0439447_011954 | 3300041407 | Bacteria | 2513 |
| 381 | Ga0439465_0001771 | 3300041413 | Bacteria | 7065 |
| 382 | Ga0439465_0003673 | 3300041413 | Bacteria | 5004 |
| 383 | Ga0439465_0004523 | 3300041413 | Bacteria | 4496 |
| 384 | Ga0439465_0037900 | 3300041413 | Bacteria | 1551 |
| 385 | Ga0439465_0090206 | 3300041413 | Bacteria | 1048 |
| 386 | Ga0451797_0382392 | 3300041453 | Bacteria | 2235 |
| 387 | Ga0451795_0443075 | 3300041456 | Bacteria | 2692 |
| 388 | Ga0451798_0406233 | 3300041458 | Bacteria | 997 |
| 389 | Ga0451800_0326958 | 3300041459 | Bacteria | 1533 |
| 390 | Ga0451806_516753 | 3300041462 | Bacteria | 2838 |
| 391 | Ga0451807_0785375 | 3300041486 | Bacteria | 2328 |
| 392 | Ga0451837_0162876 | 3300041494 | Bacteria | 1577 |
| 393 | Ga0451837_0572425 | 3300041494 | Bacteria | 1548 |
| 394 | Ga0451837_0578947 | 3300041494 | Bacteria | 1728 |
| 395 | Ga0451837_0713293 | 3300041494 | Bacteria | 1051 |
| 396 | Ga0451837_0773876 | 3300041494 | Bacteria | 3398 |
| 397 | Ga0451841_1303890 | 3300041498 | Bacteria | 3644 |
| 398 | Ga0451843_1035942 | 3300041509 | Bacteria | 2951 |
| 399 | Ga0439431_0018601 | 3300041997 | Bacteria | 1645 |
| 400 | Ga0439432_005521 | 3300042006 | Bacteria | 4549 |
| 401 | Ga0439432_016258 | 3300042006 | Bacteria | 2506 |
| 402 | Ga0439449_0000156 | 3300042007 | Bacteria | 23254 |
| 403 | Ga0439449_0012229 | 3300042007 | Bacteria | 3226 |
| 404 | Ga0439449_0012427 | 3300042007 | Bacteria | 3200 |
| 405 | Ga0439449_0016777 | 3300042007 | Bacteria | 2751 |
| 406 | Ga0439449_0032165 | 3300042007 | Bacteria | 1955 |
| 407 | Ga0439450_007998 | 3300042008 | Bacteria | 1959 |
| 408 | Ga0439455_0001840 | 3300042012 | Bacteria | 3702 |
| 409 | Ga0450901_003263 | 3300042533 | Bacteria | 1703 |
| 410 | Ga0451577_0042380 | 3300042876 | Bacteria | 4083 |
| 411 | Ga0466966_0059036 | 3300044684 | Bacteria | 2423 |
| 412 | Ga0453684_0014277 | 3300044712 | Bacteria | 12736 |
| 413 | Ga0453684_0072777 | 3300044712 | Bacteria | 4337 |
| 414 | Ga0495638_0001842 | 3300046460 | Bacteria | 18352 |
| 415 | Ga0495638_0051744 | 3300046460 | Bacteria | 2561 |
| 416 | Ga0495606_0086909 | 3300046507 | Bacteria | 1931 |
| 417 | Ga0495610_0004733 | 3300046512 | Bacteria | 9931 |
| 418 | Ga0495631_0002006 | 3300046518 | Bacteria | 11866 |
| 419 | Ga0495643_0001695 | 3300046522 | Bacteria | 19192 |
| 420 | Ga0495663_0001507 | 3300046525 | Bacteria | 7317 |
| 421 | Ga0495663_0007487 | 3300046525 | Bacteria | 3018 |
| 422 | Ga0495663_0030882 | 3300046525 | Bacteria | 1589 |
| 423 | Ga0495598_0000742 | 3300046537 | Bacteria | 6218 |
| 424 | Ga0495621_0004671 | 3300046539 | Bacteria | 3873 |
| 425 | Ga0495622_0060002 | 3300046557 | Bacteria | 1761 |
| 426 | Ga0495633_0016986 | 3300046558 | Bacteria | 3733 |
| 427 | Ga0495656_0009800 | 3300046615 | Bacteria | 3458 |
| 428 | Ga0495656_0033683 | 3300046615 | Bacteria | 2092 |
| 429 | Ga0495659_0142024 | 3300046664 | Bacteria | 959 |
| 430 | Ga0495671_0010539 | 3300046692 | Bacteria | 5113 |
| 431 | Ga0495636_0003452 | 3300047318 | Bacteria | 6132 |
| 432 | Ga0495636_0008887 | 3300047318 | Bacteria | 3956 |
| 433 | Ga0495636_0014005 | 3300047318 | Bacteria | 3187 |
| 434 | Ga0495636_0044107 | 3300047318 | Bacteria | 1856 |
| 435 | Ga0495672_0000073 | 3300047320 | Bacteria | 179398 |
| 436 | Ga0495686_0026392 | 3300047472 | Bacteria | 3800 |
| 437 | Ga0496101_0087253 | 3300048904 | Bacteria | 2316 |
| 438 | Ga0496101_0177725 | 3300048904 | Bacteria | 1638 |
| 439 | Ga0496102_0004532 | 3300048905 | Bacteria | 11741 |
| 440 | Ga0496106_0001090 | 3300048909 | Bacteria | 20066 |
| 441 | Ga0496106_0030699 | 3300048909 | Bacteria | 4006 |
| 442 | Ga0496107_0044662 | 3300048910 | Bacteria | 3186 |
| 443 | Ga0496108_0090168 | 3300048911 | Bacteria | 2606 |
| 444 | Ga0496109_0038143 | 3300048912 | Bacteria | 4343 |
| 445 | Ga0496109_0090422 | 3300048912 | Bacteria | 2831 |
| 446 | Ga0496112_0008685 | 3300048915 | Bacteria | 9111 |
| 447 | Ga0496114_0006407 | 3300048917 | Bacteria | 9269 |
| 448 | Ga0496115_0237052 | 3300048918 | Bacteria | 1504 |
| 449 | Ga0496117_0002324 | 3300048920 | Bacteria | 24332 |
| 450 | Ga0496117_0002722 | 3300048920 | Bacteria | 21720 |
| 451 | Ga0496117_0090355 | 3300048920 | Bacteria | 1973 |
| 452 | Ga0496118_0000344 | 3300048921 | Bacteria | 78989 |
| 453 | Ga0496118_0001379 | 3300048921 | Bacteria | 36605 |
| 454 | Ga0496118_0013072 | 3300048921 | Bacteria | 7892 |
| 455 | Ga0496118_0018080 | 3300048921 | Bacteria | 6379 |
| 456 | Ga0496118_0070648 | 3300048921 | Bacteria | 2519 |
| 457 | Ga0496119_0003326 | 3300048922 | Bacteria | 16773 |
| 458 | Ga0496119_0014839 | 3300048922 | Bacteria | 6059 |
| 459 | Ga0496119_0131850 | 3300048922 | Bacteria | 1361 |
| 460 | Ga0496120_0002285 | 3300048923 | Bacteria | 19880 |
| 461 | Ga0496120_0003024 | 3300048923 | Bacteria | 15923 |
| 462 | Ga0496121_0006284 | 3300048924 | Bacteria | 14851 |
| 463 | Ga0496121_0008043 | 3300048924 | Bacteria | 12572 |
| 464 | Ga0496122_0003858 | 3300048925 | Bacteria | 19242 |
| 465 | Ga0496122_0005074 | 3300048925 | Bacteria | 15901 |
| 466 | Ga0496122_0008107 | 3300048925 | Bacteria | 11448 |
| 467 | Ga0496122_0039435 | 3300048925 | Bacteria | 3766 |
| 468 | Ga0496122_0041940 | 3300048925 | Bacteria | 3608 |
| 469 | Ga0496122_0042161 | 3300048925 | Bacteria | 3594 |
| 470 | Ga0496122_0114519 | 3300048925 | Bacteria | 1759 |
| 471 | Ga0496123_0000669 | 3300048926 | Bacteria | 56717 |
| 472 | Ga0496123_0004123 | 3300048926 | Bacteria | 15561 |
| 473 | Ga0496123_0009080 | 3300048926 | Bacteria | 9004 |
| 474 | Ga0496123_0013609 | 3300048926 | Bacteria | 6811 |
| 475 | Ga0496123_0033730 | 3300048926 | Bacteria | 3678 |
| 476 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 477 | Ga0496124_0003480 | 3300048927 | Bacteria | 19168 |
| 478 | Ga0496124_0004112 | 3300048927 | Bacteria | 17192 |
| 479 | Ga0496124_0007146 | 3300048927 | Bacteria | 11949 |
| 480 | Ga0496124_0014062 | 3300048927 | Bacteria | 7763 |
| 481 | Ga0496124_0014864 | 3300048927 | Bacteria | 7499 |
| 482 | Ga0496124_0022002 | 3300048927 | Bacteria | 5860 |
| 483 | Ga0496125_0004477 | 3300048928 | Bacteria | 16098 |
| 484 | Ga0496125_0049749 | 3300048928 | Bacteria | 3478 |
| 485 | Ga0496125_0053334 | 3300048928 | Bacteria | 3315 |
| 486 | Ga0496126_0051425 | 3300048929 | Bacteria | 3750 |
| 487 | Ga0501290_000334 | 3300049513 | Bacteria | 7750 |
| 488 | Ga0501031_0015466 | 3300049568 | Bacteria | 4954 |
| 489 | Ga0501031_0040249 | 3300049568 | Bacteria | 3051 |
| 490 | Ga0501032_0003474 | 3300049569 | Bacteria | 12065 |
| 491 | Ga0501033_0002438 | 3300049570 | Bacteria | 15799 |
| 492 | Ga0501034_0000122 | 3300049571 | Bacteria | 144085 |
| 493 | Ga0501034_0001021 | 3300049571 | Bacteria | 40111 |
| 494 | Ga0501034_0002909 | 3300049571 | Bacteria | 19882 |
| 495 | Ga0501034_0007363 | 3300049571 | Bacteria | 11724 |
| 496 | Ga0501034_0087102 | 3300049571 | Bacteria | 3123 |
| 497 | Ga0501036_0120311 | 3300049572 | Bacteria | 2217 |
| 498 | Ga0501037_0030670 | 3300049573 | Bacteria | 3972 |
| 499 | Ga0501037_0061087 | 3300049573 | Bacteria | 2748 |
| 500 | Ga0501038_0005011 | 3300049574 | Bacteria | 12292 |
| 501 | Ga0501038_0046025 | 3300049574 | Bacteria | 3784 |
| 502 | Ga0501039_0031363 | 3300049575 | Bacteria | 4097 |
| 503 | Ga0501043_0006239 | 3300049579 | Bacteria | 9571 |
| 504 | Ga0501043_0026118 | 3300049579 | Bacteria | 4582 |
| 505 | Ga0501047_0068457 | 3300049581 | Bacteria | 3419 |
| 506 | Ga0501047_0178552 | 3300049581 | Bacteria | 1990 |
| 507 | Ga0501070_0009112 | 3300049586 | Bacteria | 8394 |
| 508 | Ga0501070_0138686 | 3300049586 | Bacteria | 2008 |
| 509 | Ga0501071_0094032 | 3300049587 | Bacteria | 2204 |
| 510 | Ga0501073_0015658 | 3300049589 | Bacteria | 5499 |
| 511 | Ga0501225_0016531 | 3300049705 | Bacteria | 2052 |
| 512 | Ga0501080_0105402 | 3300049742 | Bacteria | 2614 |
| 513 | Ga0501241_002421 | 3300049758 | Bacteria | 3605 |
| 514 | Ga0501265_001185 | 3300049762 | Bacteria | 2944 |
| 515 | Ga0501266_003663 | 3300049763 | Bacteria | 1903 |
| 516 | Ga0501275_000033 | 3300049772 | Bacteria | 14296 |
| 517 | Ga0501035_0104849 | 3300049822 | Bacteria | 2479 |
| 518 | Ga0501044_0046980 | 3300049823 | Bacteria | 4467 |
| 519 | Ga0501044_0420528 | 3300049823 | Bacteria | 1246 |
| 520 | nmdc:mga00v17_202_c2 | 3300050491 | Bacteria | 31082 |
| 521 | nmdc:mga00v17_55844_c1 | 3300050491 | Bacteria | 2413 |
| 522 | nmdc:mga08y16_277275_c1 | 3300050511 | Bacteria | 1730 |
| 523 | nmdc:mga08y16_41561_c1 | 3300050511 | Bacteria | 4816 |
| 524 | nmdc:mga08y16_449515_c1 | 3300050511 | Bacteria | 1314 |
| 525 | nmdc:mga0rr50_155503_c1 | 3300050513 | Bacteria | 1852 |
| 526 | Ga0500634_0000048 | 3300053161 | Bacteria | 55497 |
| 527 | Ga0500565_002311 | 3300053734 | Bacteria | 1411 |
| 528 | 2547500017 | 2547132130 | Bacteria | 4660562 |
| 529 | 2572253562 | 2571042365 | Bacteria | 3289345 |
| 530 | 2578457593 | 2576861471 | Bacteria | 4648976 |
| 531 | 2643815267 | 2643221559 | Bacteria | 4424915 |
| 532 | 2643879306 | 2643221573 | Bacteria | 4784121 |
| 533 | 2643908752 | 2643221579 | Bacteria | 4443405 |
| 534 | 2643916180 | 2643221581 | Bacteria | 3893603 |
| 535 | 2643939945 | 2643221586 | Bacteria | 4446529 |
| 536 | 2643976192 | 2643221593 | Bacteria | 6296053 |
| 537 | 2644077003 | 2643221612 | Bacteria | 4361984 |
| 538 | 2644528898 | 2643221695 | Bacteria | 3441323 |
| 539 | 2644660605 | 2643221720 | Bacteria | 4694283 |
| 540 | 2644695317 | 2643221727 | Bacteria | 4415595 |
| 541 | 2644697966 | 2643221728 | Bacteria | 4797149 |
| 542 | 2747948104 | 2747842428 | Bacteria | 4689383 |
| 543 | 2748018289 | 2747842501 | Bacteria | 5293829 |
| 544 | 2765579889 | 2765235840 | Bacteria | 4663337 |
| 545 | 2816519068 | 2816332141 | Bacteria | 4436036 |
| 546 | 2819660075 | 2818991457 | Bacteria | 5323295 |
| 547 | 2842394852 | 2842391507 | Bacteria | 4486072 |
| 548 | 2842760618 | 2842757796 | Bacteria | 3981385 |
| 549 | 2842781110 | 2842780639 | Bacteria | 4337790 |
| 550 | 2852650010 | 2852649853 | Bacteria | 4036942 |
| 551 | 2852685109 | 2852684882 | Bacteria | 5463342 |
| 552 | 2857445550 | 2857442823 | Bacteria | 4562550 |
| 553 | 2874222572 | 2874220319 | Bacteria | 4594709 |
| 554 | 2894415894 | 2894414249 | Bacteria | 4405451 |
| 555 | 2895500817 | 2895498888 | Bacteria | 5283788 |
| 556 | 2895516313 | 2895511927 | Bacteria | 6802080 |
| 557 | 2895523768 | 2895522137 | Bacteria | 3284416 |
| 558 | 2895526651 | 2895525241 | Bacteria | 3388457 |
| 559 | 2919090513 | 2919089067 | Bacteria | 4560942 |
| 560 | 2919130649 | 2919130084 | Bacteria | 5301837 |
| 561 | 2919137554 | 2919134579 | Bacteria | 4480386 |
| 562 | 2919516122 | 2919513703 | Bacteria | 3844312 |
| 563 | 2919677954 | 2919675420 | Bacteria | 3969095 |
| 564 | 2923517962 | 2923516293 | Bacteria | 3716336 |
| 565 | 2928498348 | 2928496128 | Bacteria | 4631123 |
| 566 | 2929198348 | 2929195423 | Bacteria | 5325372 |
| 567 | 2931383971 | 2931380184 | Bacteria | 4455911 |
| 568 | 2937614469 | 2937610967 | Bacteria | 4618818 |
| 569 | 2939591115 | 2939589442 | Bacteria | 4214238 |
| 570 | 2939624609 | 2939622612 | Bacteria | 4698046 |
| 571 | 2939628317 | 2939626828 | Bacteria | 4695272 |
| 572 | 2941476646 | 2941475908 | Bacteria | 4145589 |
| 573 | 2941491140 | 2941489479 | Bacteria | 6313767 |
| 574 | 2961049337 | 2961047084 | Bacteria | 4594415 |
| 575 | 2961065971 | 2961064222 | Bacteria | 4749990 |
| 576 | 2974308213 | 2974307012 | Bacteria | 4172388 |
| 577 | 2977248971 | 2977247770 | Bacteria | 4160543 |
| 578 | 2984516578 | 2984514374 | Bacteria | 4172479 |
| 579 | 2987607370 | 2987605356 | Bacteria | 4187822 |
| 580 | 2995952071 | 2995948881 | Bacteria | 6358104 |
| 581 | 8003014577 | 8003014200 | Bacteria | 4059994 |
| 582 | 8021624514 | 8021622325 | Bacteria | 4844743 |
| 583 | 8021627618 | 8021626552 | Bacteria | 4665214 |
| 584 | 8021650741 | 8021648035 | Bacteria | 4772378 |
| 585 | Ga0495686_0025032 | |||
| 586 | SwRhRL2b_contig_314363 | |||
| 587 | SwRhRL2b_contig_3426700 | |||
| 588 | JGI24748J21848_1001571 | |||
| 589 | JGI24034J26672_10010741 | |||
| 590 | JGI24751J29686_10013157 | |||
| 591 | JGI25152J39213_1000548 | |||
| 592 | JGI25150J39212_1000114 | |||
| 593 | JGI25151J46595_10000100 | |||
| 594 | JGI25151J46595_10000128 | |||
| 595 | JGI25153J46596_10000071 | |||
| 596 | rootL2_10284264 | |||
| 597 | JGI26145J50221_1001698 | |||
| 598 | JGI25404J52841_10001389 | |||
| 599 | JGI25404J52841_10001494 | |||
| 600 | Ga0055526_1000021 | |||
| 601 | Ga0055526_1033149 | |||
| 602 | Ga0055537_1000141 | |||
| 603 | Ga0055537_1000215 | |||
| 604 | Ga0055524_1000128 | |||
| 605 | Ga0055524_1014005 | |||
| 606 | Ga0055524_1036672 | |||
| 607 | Ga0055536_1032767 | |||
| 608 | Ga0055534_1000054 | |||
| 609 | Ga0055534_1000086 | |||
| 610 | Ga0055534_1002749 | |||
| 611 | Ga0055534_1008954 | |||
| 612 | Ga0055528_1000009 | |||
| 613 | Ga0055528_1000761 | |||
| 614 | Ga0055530_10001109 | |||
| 615 | Ga0055530_10001882 | |||
| 616 | Ga0055530_10002002 | |||
| 617 | Ga0055531_10003842 | |||
| 618 | Ga0055531_10016573 | |||
| 619 | Ga0055531_10024914 | |||
| 620 | Ga0058692_1000011 | |||
| 621 | Ga0058692_1000024 | |||
| 622 | Ga0065714_10009016 | |||
| 623 | Ga0065704_10083971 | |||
| 624 | Ga0065715_10230468 | |||
| 625 | Ga0070658_10003169 | |||
| 626 | Ga0070676_10000823 | |||
| 627 | Ga0070683_100601705 | |||
| 628 | Ga0070690_100001047 | |||
| 629 | Ga0070670_100235742 | |||
| 630 | Ga0070670_100351385 | |||
| 631 | Ga0068869_100001783 | |||
| 632 | Ga0070666_10006883 | |||
| 633 | Ga0068868_100008917 | |||
| 634 | Ga0070660_100003148 | |||
| 635 | Ga0070689_100002391 | |||
| 636 | Ga0070687_100000482 | |||
| 637 | Ga0070661_100002001 | |||
| 638 | Ga0070668_100101898 | |||
| 639 | Ga0070669_100001422 | |||
| 640 | Ga0070669_100133535 | |||
| 641 | Ga0070675_100125530 | |||
| 642 | Ga0070671_100003509 | |||
| 643 | Ga0070671_100028192 | |||
| 644 | Ga0070671_100171422 | |||
| 645 | Ga0070671_100379399 | |||
| 646 | Ga0070674_100001692 | |||
| 647 | Ga0070673_100001060 | |||
| 648 | Ga0070688_100001262 | |||
| 649 | Ga0070659_100002780 | |||
| 650 | Ga0070667_100024566 | |||
| 651 | Ga0070701_10001351 | |||
| 652 | Ga0070711_100176182 | |||
| 653 | Ga0070705_100002638 | |||
| 654 | Ga0070663_100133435 | |||
| 655 | Ga0070678_100001920 | |||
| 656 | Ga0070678_100128413 | |||
| 657 | Ga0070662_100001874 | |||
| 658 | Ga0070685_10001698 | |||
| 659 | Ga0070707_100420902 | |||
| 660 | Ga0070679_100023473 | |||
| 661 | Ga0068853_100000493 | |||
| 662 | Ga0070672_100002883 | |||
| 663 | Ga0070672_100004233 | |||
| 664 | Ga0070672_100006280 | |||
| 665 | Ga0070686_100003027 | |||
| 666 | Ga0070696_100014261 | |||
| 667 | Ga0070693_100000733 | |||
| 668 | Ga0070665_100163191 | |||
| 669 | Ga0070704_100033595 | |||
| 670 | Ga0068855_100006770 | |||
| 671 | Ga0070664_100004932 | |||
| 672 | Ga0070664_100005223 | |||
| 673 | Ga0068857_100009400 | |||
| 674 | Ga0068857_100027014 | |||
| 675 | Ga0068854_100001701 | |||
| 676 | Ga0068856_100004173 | |||
| 677 | Ga0068852_100002227 | |||
| 678 | Ga0068859_100007196 | |||
| 679 | Ga0068864_100002312 | |||
| 680 | Ga0068861_100001305 | |||
| 681 | Ga0068851_10000877 | |||
| 682 | Ga0068870_10000916 | |||
| 683 | Ga0068863_100013509 | |||
| 684 | Ga0068860_100005121 | |||
| 685 | Ga0081540_1000988 | |||
| 686 | Ga0075364_10000020 | |||
| 687 | Ga0075364_10305274 | |||
| 688 | Ga0097621_100004336 | |||
| 689 | Ga0097621_100038064 | |||
| 690 | Ga0068871_100030519 | |||
| 691 | Ga0068871_100045248 | |||
| 692 | Ga0075428_100145594 | |||
| 693 | Ga0068865_100001849 | |||
| 694 | Ga0097620_100007195 | |||
| 695 | Ga0075435_100047690 | |||
| 696 | Ga0105251_10003611 | |||
| 697 | Ga0105244_10073322 | |||
| 698 | Ga0105244_10101697 | |||
| 699 | Ga0105240_10003240 | |||
| 700 | Ga0111539_10055715 | |||
| 701 | Ga0111539_10337812 | |||
| 702 | Ga0111539_10554299 | |||
| 703 | Ga0105245_10004441 | |||
| 704 | Ga0105247_10001559 | |||
| 705 | Ga0105247_10003375 | |||
| 706 | Ga0105243_10004714 | |||
| 707 | Ga0105241_10092460 | |||
| 708 | Ga0105242_10000383 | |||
| 709 | Ga0105242_10061274 | |||
| 710 | Ga0105248_10001684 | |||
| 711 | Ga0105248_10480713 | |||
| 712 | Ga0105237_10001653 | |||
| 713 | Ga0105238_10006399 | |||
| 714 | Ga0105249_10000236 | |||
| 715 | Ga0105032_104247 | |||
| 716 | Ga0105028_104662 | |||
| 717 | Ga0105239_10005084 | |||
| 718 | Ga0105239_10663386 | |||
| 719 | Ga0157316_1000157 | |||
| 720 | Ga0157327_1001218 | |||
| 721 | Ga0157373_10005972 | |||
| 722 | Ga0157371_10000154 | |||
| 723 | Ga0157371_10000875 | |||
| 724 | Ga0157371_10002975 | |||
| 725 | Ga0157371_10243859 | |||
| 726 | Ga0157370_10006946 | |||
| 727 | Ga0157369_10000652 | |||
| 728 | Ga0157369_10022183 | |||
| 729 | Ga0157374_10001223 | |||
| 730 | Ga0157374_10341588 | |||
| 731 | Ga0157378_10000522 | |||
| 732 | Ga0163162_10001916 | |||
| 733 | Ga0157372_10010891 | |||
| 734 | Ga0157372_10019180 | |||
| 735 | Ga0157375_10000635 | |||
| 736 | Ga0157375_10049459 | |||
| 737 | Ga0163163_10003411 | |||
| 738 | Ga0157380_10035235 | |||
| 739 | Ga0157380_10347957 | |||
| 740 | Ga0182008_10000142 | |||
| 741 | Ga0182008_10042134 | |||
| 742 | Ga0157377_10000157 | |||
| 743 | Ga0157379_10000177 | |||
| 744 | Ga0157376_10391798 | |||
| 745 | Ga0182007_10000287 | |||
| 746 | Ga0182005_1000388 | |||
| 747 | Ga0182005_1038803 | |||
| 748 | Ga0183360_10001 | |||
| 749 | Ga0183361_12046 | |||
| 750 | Ga0163161_10001350 | |||
| 751 | Ga0207425_1000030 | |||
| 752 | Ga0209129_1000063 | |||
| 753 | Ga0209565_1000022 | |||
| 754 | Ga0209565_1000048 | |||
| 755 | Ga0209673_1000001 | |||
| 756 | Ga0209673_1000104 | |||
| 757 | Ga0209673_1006793 | |||
| 758 | Ga0209130_1012894 | |||
| 759 | Ga0209130_1013338 | |||
| 760 | Ga0209675_1000045 | |||
| 761 | Ga0209675_1000048 | |||
| 762 | Ga0209675_1012113 | |||
| 763 | Ga0209676_1000024 | |||
| 764 | Ga0209676_1000091 | |||
| 765 | Ga0209676_1000117 | |||
| 766 | Ga0209676_1001624 | |||
| 767 | Ga0209676_1002128 | |||
| 768 | Ga0209676_1002569 | |||
| 769 | Ga0209676_1003631 | |||
| 770 | Ga0209025_1000005 | |||
| 771 | Ga0209025_1000013 | |||
| 772 | Ga0209025_1004696 | |||
| 773 | Ga0209025_1005156 | |||
| 774 | Ga0209564_1000001 | |||
| 775 | Ga0209564_1000213 | |||
| 776 | Ga0209758_1000014 | |||
| 777 | Ga0209758_1022517 | |||
| 778 | Ga0209050_1000603 | |||
| 779 | Ga0209050_1001495 | |||
| 780 | Ga0209050_1001888 | |||
| 781 | Ga0209050_1026023 | |||
| 782 | Ga0209256_1000002 | |||
| 783 | Ga0209256_1002292 | |||
| 784 | Ga0209256_1004498 | |||
| 785 | Ga0209256_1007996 | |||
| 786 | Ga0209256_1040932 | |||
| 787 | Ga0207426_1054761 | |||
| 788 | Ga0209051_1001112 | |||
| 789 | Ga0209051_1008525 | |||
| 790 | Ga0209257_1000062 | |||
| 791 | Ga0209257_1000122 | |||
| 792 | Ga0209257_1000217 | |||
| 793 | Ga0209257_1000243 | |||
| 794 | Ga0209257_1001409 | |||
| 795 | Ga0209257_1001747 | |||
| 796 | Ga0209257_1002061 | |||
| 797 | Ga0207697_10001596 | |||
| 798 | Ga0207656_10000282 | |||
| 799 | Ga0207655_1049487 | |||
| 800 | Ga0207713_1000327 | |||
| 801 | Ga0207642_10010727 | |||
| 802 | Ga0207710_10002180 | |||
| 803 | Ga0207710_10005312 | |||
| 804 | Ga0207688_10001775 | |||
| 805 | Ga0207680_10000618 | |||
| 806 | Ga0207647_10000971 | |||
| 807 | Ga0207645_10000048 | |||
| 808 | Ga0207643_10000122 | |||
| 809 | Ga0207705_10002690 | |||
| 810 | Ga0207705_10091151 | |||
| 811 | Ga0207695_10070094 | |||
| 812 | Ga0207671_10002485 | |||
| 813 | Ga0207663_10046160 | |||
| 814 | Ga0207660_10454099 | |||
| 815 | Ga0207662_10000265 | |||
| 816 | Ga0207657_10000091 | |||
| 817 | Ga0207649_10001088 | |||
| 818 | Ga0207646_10088847 | |||
| 819 | Ga0207681_10000696 | |||
| 820 | Ga0207681_10129243 | |||
| 821 | Ga0207681_10253784 | |||
| 822 | Ga0207650_10000831 | |||
| 823 | Ga0207650_10004381 | |||
| 824 | Ga0207650_10158098 | |||
| 825 | Ga0207650_10218226 | |||
| 826 | Ga0207650_10246237 | |||
| 827 | Ga0207659_10000335 | |||
| 828 | Ga0207687_10108946 | |||
| 829 | Ga0207664_10207997 | |||
| 830 | Ga0207644_10000651 | |||
| 831 | Ga0207644_10001250 | |||
| 832 | Ga0207644_10372624 | |||
| 833 | Ga0207690_10001654 | |||
| 834 | Ga0207706_10000753 | |||
| 835 | Ga0207706_10321204 | |||
| 836 | Ga0207686_10005878 | |||
| 837 | Ga0207709_10000562 | |||
| 838 | Ga0207709_10013019 | |||
| 839 | Ga0207709_10040468 | |||
| 840 | Ga0207670_10000412 | |||
| 841 | Ga0207669_10000372 | |||
| 842 | Ga0207704_10000994 | |||
| 843 | Ga0207691_10000058 | |||
| 844 | Ga0207691_10001348 | |||
| 845 | Ga0207691_10001351 | |||
| 846 | Ga0207691_10280120 | |||
| 847 | Ga0207711_10000401 | |||
| 848 | Ga0207689_10000636 | |||
| 849 | Ga0207679_10005224 | |||
| 850 | Ga0207679_10008833 | |||
| 851 | Ga0207679_10135097 | |||
| 852 | Ga0207667_10008470 | |||
| 853 | Ga0207651_10000315 | |||
| 854 | Ga0207712_10000518 | |||
| 855 | Ga0207668_10000761 | |||
| 856 | Ga0207668_10020163 | |||
| 857 | Ga0207640_10001807 | |||
| 858 | Ga0207658_10001028 | |||
| 859 | Ga0207677_10000116 | |||
| 860 | Ga0207677_10030917 | |||
| 861 | Ga0207703_10000226 | |||
| 862 | Ga0207639_10003726 | |||
| 863 | Ga0207678_10003479 | |||
| 864 | Ga0207702_10007041 | |||
| 865 | Ga0207641_10001536 | |||
| 866 | Ga0207641_10018128 | |||
| 867 | Ga0207648_10000769 | |||
| 868 | Ga0207676_10000570 | |||
| 869 | Ga0207674_10003927 | |||
| 870 | Ga0207674_10007691 | |||
| 871 | Ga0207675_100000045 | |||
| 872 | Ga0207683_10002376 | |||
| 873 | Ga0207683_10155613 | |||
| 874 | Ga0207683_10232195 | |||
| 875 | Ga0207698_10000612 | |||
| 876 | Ga0209371_1000007 | |||
| 877 | Ga0209371_1000016 | |||
| 878 | Ga0209984_1012835 | |||
| 879 | Ga0209999_1001293 | |||
| 880 | Ga0209982_1002155 | |||
| 881 | Ga0209983_1007591 | |||
| 882 | Ga0209971_1001898 | |||
| 883 | Ga0207428_10161778 | |||
| 884 | Ga0268266_10000240 | |||
| 885 | Ga0268266_10152633 | |||
| 886 | Ga0268265_10001030 | |||
| 887 | Ga0268264_10000769 | |||
| 888 | Ga0265319_1000259 | |||
| 889 | Ga0265318_10000150 | |||
| 890 | Ga0265318_10002234 | |||
| 891 | Ga0265338_10047622 | |||
| 892 | Ga0268256_1000008 | |||
| 893 | Ga0268256_1000015 | |||
| 894 | Ga0316176_1170776 | |||
| 895 | Ga0314311_1188486 | |||
| 896 | Ga0316178_1121146 | |||
| 897 | Ga0316181_1232513 | |||
| 898 | Ga0316181_1257729 | |||
| 899 | Ga0265330_10000166 | |||
| 900 | Ga0265328_10098130 | |||
| 901 | Ga0265320_10000381 | |||
| 902 | Ga0265325_10001158 | |||
| 903 | Ga0265329_10000352 | |||
| 904 | Ga0265340_10000302 | |||
| 905 | Ga0265340_10009220 | |||
| 906 | Ga0265339_10002278 | |||
| 907 | Ga0265331_10000709 | |||
| 908 | Ga0265316_10002784 | |||
| 909 | Ga0265316_10004280 | |||
| 910 | Ga0307513_10039653 | |||
| 911 | Ga0307509_10115061 | |||
| 912 | Ga0307408_100017474 | |||
| 913 | Ga0307408_100164128 | |||
| 914 | Ga0307408_100337554 | |||
| 915 | Ga0265313_10000378 | |||
| 916 | Ga0265313_10001920 | |||
| 917 | Ga0265314_10001502 | |||
| 918 | Ga0265314_10012431 | |||
| 919 | Ga0265342_10000725 | |||
| 920 | Ga0316576_10064429 | |||
| 921 | Ga0316578_10020283 | |||
| 922 | Ga0307413_10006930 | |||
| 923 | Ga0307413_10056758 | |||
| 924 | Ga0307410_10236641 | |||
| 925 | Ga0307406_10021651 | |||
| 926 | Ga0307406_10063847 | |||
| 927 | Ga0307406_10072049 | |||
| 928 | Ga0307407_10057750 | |||
| 929 | Ga0307412_10330483 | |||
| 930 | Ga0307414_10004276 | |||
| 931 | Ga0307414_10019038 | |||
| 932 | Ga0307414_10025290 | |||
| 933 | Ga0307414_10048036 | |||
| 934 | Ga0307414_10084626 | |||
| 935 | Ga0307414_10095010 | |||
| 936 | Ga0307414_10124056 | |||
| 937 | Ga0307414_10154948 | |||
| 938 | Ga0307414_10205568 | |||
| 939 | Ga0307414_10466962 | |||
| 940 | Ga0307411_10037849 | |||
| 941 | Ga0307411_10075655 | |||
| 942 | Ga0307415_100162164 | |||
| 943 | Ga0373947_0187718 | |||
| 944 | Ga0373937_0119341 | |||
| 945 | Ga0373937_0229305 | |||
| 946 | Ga0395899_0090607 | |||
| 947 | Ga0395900_0321630 | |||
| 948 | Ga0395900_0589056 | |||
| 949 | Ga0395898_0547308 | |||
| 950 | Ga0395905_0000306 | |||
| 951 | Ga0395905_0017994 | |||
| 952 | Ga0395905_0338561 | |||
| 953 | Ga0395905_0345517 | |||
| 954 | Ga0436364_1010390 | |||
| 955 | Ga0395901_0002348 | |||
| 956 | Ga0237819_00617 | |||
| 957 | Ga0237816_00655 | |||
| 958 | Ga0436365_1765442 | |||
| 959 | Ga0436360_1082159 | |||
| 960 | Ga0439436_0018848 | |||
| 961 | Ga0439436_0023498 | |||
| 962 | Ga0439439_0005994 | |||
| 963 | Ga0439439_0019516 | |||
| 964 | Ga0439447_011954 | |||
| 965 | Ga0439465_0001771 | |||
| 966 | Ga0439465_0003673 | |||
| 967 | Ga0439465_0004523 | |||
| 968 | Ga0439465_0037900 | |||
| 969 | Ga0439465_0090206 | |||
| 970 | Ga0451797_0382392 | |||
| 971 | Ga0451795_0443075 | |||
| 972 | Ga0451798_0406233 | |||
| 973 | Ga0451800_0326958 | |||
| 974 | Ga0451806_516753 | |||
| 975 | Ga0451807_0785375 | |||
| 976 | Ga0451837_0162876 | |||
| 977 | Ga0451837_0572425 | |||
| 978 | Ga0451837_0578947 | |||
| 979 | Ga0451837_0713293 | |||
| 980 | Ga0451837_0773876 | |||
| 981 | Ga0451841_1303890 | |||
| 982 | Ga0451843_1035942 | |||
| 983 | Ga0439431_0018601 | |||
| 984 | Ga0439432_005521 | |||
| 985 | Ga0439432_016258 | |||
| 986 | Ga0439449_0000156 | |||
| 987 | Ga0439449_0012229 | |||
| 988 | Ga0439449_0012427 | |||
| 989 | Ga0439449_0016777 | |||
| 990 | Ga0439449_0032165 | |||
| 991 | Ga0439450_007998 | |||
| 992 | Ga0439455_0001840 | |||
| 993 | Ga0450901_003263 | |||
| 994 | Ga0451577_0042380 | |||
| 995 | Ga0466966_0059036 | |||
| 996 | Ga0453684_0014277 | |||
| 997 | Ga0453684_0072777 | |||
| 998 | Ga0495638_0001842 | |||
| 999 | Ga0495638_0051744 | |||
| 1000 | Ga0495606_0086909 | |||
| 1001 | Ga0495610_0004733 | |||
| 1002 | Ga0495631_0002006 | |||
| 1003 | Ga0495643_0001695 | |||
| 1004 | Ga0495663_0001507 | |||
| 1005 | Ga0495663_0007487 | |||
| 1006 | Ga0495663_0030882 | |||
| 1007 | Ga0495598_0000742 | |||
| 1008 | Ga0495621_0004671 | |||
| 1009 | Ga0495622_0060002 | |||
| 1010 | Ga0495633_0016986 | |||
| 1011 | Ga0495656_0009800 | |||
| 1012 | Ga0495656_0033683 | |||
| 1013 | Ga0495659_0142024 | |||
| 1014 | Ga0495671_0010539 | |||
| 1015 | Ga0495636_0003452 | |||
| 1016 | Ga0495636_0008887 | |||
| 1017 | Ga0495636_0014005 | |||
| 1018 | Ga0495636_0044107 | |||
| 1019 | Ga0495672_0000073 | |||
| 1020 | Ga0495686_0026392 | |||
| 1021 | Ga0496101_0087253 | |||
| 1022 | Ga0496101_0177725 | |||
| 1023 | Ga0496102_0004532 | |||
| 1024 | Ga0496106_0001090 | |||
| 1025 | Ga0496106_0030699 | |||
| 1026 | Ga0496107_0044662 | |||
| 1027 | Ga0496108_0090168 | |||
| 1028 | Ga0496109_0038143 | |||
| 1029 | Ga0496109_0090422 | |||
| 1030 | Ga0496112_0008685 | |||
| 1031 | Ga0496114_0006407 | |||
| 1032 | Ga0496115_0237052 | |||
| 1033 | Ga0496117_0002324 | |||
| 1034 | Ga0496117_0002722 | |||
| 1035 | Ga0496117_0090355 | |||
| 1036 | Ga0496118_0000344 | |||
| 1037 | Ga0496118_0001379 | |||
| 1038 | Ga0496118_0013072 | |||
| 1039 | Ga0496118_0018080 | |||
| 1040 | Ga0496118_0070648 | |||
| 1041 | Ga0496119_0003326 | |||
| 1042 | Ga0496119_0014839 | |||
| 1043 | Ga0496119_0131850 | |||
| 1044 | Ga0496120_0002285 | |||
| 1045 | Ga0496120_0003024 | |||
| 1046 | Ga0496121_0006284 | |||
| 1047 | Ga0496121_0008043 | |||
| 1048 | Ga0496122_0003858 | |||
| 1049 | Ga0496122_0005074 | |||
| 1050 | Ga0496122_0008107 | |||
| 1051 | Ga0496122_0039435 | |||
| 1052 | Ga0496122_0041940 | |||
| 1053 | Ga0496122_0042161 | |||
| 1054 | Ga0496122_0114519 | |||
| 1055 | Ga0496123_0000669 | |||
| 1056 | Ga0496123_0004123 | |||
| 1057 | Ga0496123_0009080 | |||
| 1058 | Ga0496123_0013609 | |||
| 1059 | Ga0496123_0033730 | |||
| 1060 | Ga0496124_0000009 | |||
| 1061 | Ga0496124_0003480 | |||
| 1062 | Ga0496124_0004112 | |||
| 1063 | Ga0496124_0007146 | |||
| 1064 | Ga0496124_0014062 | |||
| 1065 | Ga0496124_0014864 | |||
| 1066 | Ga0496124_0022002 | |||
| 1067 | Ga0496125_0004477 | |||
| 1068 | Ga0496125_0049749 | |||
| 1069 | Ga0496125_0053334 | |||
| 1070 | Ga0496126_0051425 | |||
| 1071 | Ga0501290_000334 | |||
| 1072 | Ga0501031_0015466 | |||
| 1073 | Ga0501031_0040249 | |||
| 1074 | Ga0501032_0003474 | |||
| 1075 | Ga0501033_0002438 | |||
| 1076 | Ga0501034_0000122 | |||
| 1077 | Ga0501034_0001021 | |||
| 1078 | Ga0501034_0002909 | |||
| 1079 | Ga0501034_0007363 | |||
| 1080 | Ga0501034_0087102 | |||
| 1081 | Ga0501036_0120311 | |||
| 1082 | Ga0501037_0030670 | |||
| 1083 | Ga0501037_0061087 | |||
| 1084 | Ga0501038_0005011 | |||
| 1085 | Ga0501038_0046025 | |||
| 1086 | Ga0501039_0031363 | |||
| 1087 | Ga0501043_0006239 | |||
| 1088 | Ga0501043_0026118 | |||
| 1089 | Ga0501047_0068457 | |||
| 1090 | Ga0501047_0178552 | |||
| 1091 | Ga0501070_0009112 | |||
| 1092 | Ga0501070_0138686 | |||
| 1093 | Ga0501071_0094032 | |||
| 1094 | Ga0501073_0015658 | |||
| 1095 | Ga0501225_0016531 | |||
| 1096 | Ga0501080_0105402 | |||
| 1097 | Ga0501241_002421 | |||
| 1098 | Ga0501265_001185 | |||
| 1099 | Ga0501266_003663 | |||
| 1100 | Ga0501275_000033 | |||
| 1101 | Ga0501035_0104849 | |||
| 1102 | Ga0501044_0046980 | |||
| 1103 | Ga0501044_0420528 | |||
| 1104 | nmdc:mga00v17_202_c2 | |||
| 1105 | nmdc:mga00v17_55844_c1 | |||
| 1106 | nmdc:mga08y16_277275_c1 | |||
| 1107 | nmdc:mga08y16_41561_c1 | |||
| 1108 | nmdc:mga08y16_449515_c1 | |||
| 1109 | nmdc:mga0rr50_155503_c1 | |||
| 1110 | Ga0500634_0000048 | |||
| 1111 | Ga0500565_002311 | |||
| 1112 | 2547500017 | |||
| 1113 | 2572253562 | |||
| 1114 | 2578457593 | |||
| 1115 | 2643815267 | |||
| 1116 | 2643879306 | |||
| 1117 | 2643908752 | |||
| 1118 | 2643916180 | |||
| 1119 | 2643939945 | |||
| 1120 | 2643976192 | |||
| 1121 | 2644077003 | |||
| 1122 | 2644528898 | |||
| 1123 | 2644660605 | |||
| 1124 | 2644695317 | |||
| 1125 | 2644697966 | |||
| 1126 | 2747948104 | |||
| 1127 | 2748018289 | |||
| 1128 | 2765579889 | |||
| 1129 | 2816519068 | |||
| 1130 | 2819660075 | |||
| 1131 | 2842394852 | |||
| 1132 | 2842760618 | |||
| 1133 | 2842781110 | |||
| 1134 | 2852650010 | |||
| 1135 | 2852685109 | |||
| 1136 | 2857445550 | |||
| 1137 | 2874222572 | |||
| 1138 | 2894415894 | |||
| 1139 | 2895500817 | |||
| 1140 | 2895516313 | |||
| 1141 | 2895523768 | |||
| 1142 | 2895526651 | |||
| 1143 | 2919090513 | |||
| 1144 | 2919130649 | |||
| 1145 | 2919137554 | |||
| 1146 | 2919516122 | |||
| 1147 | 2919677954 | |||
| 1148 | 2923517962 | |||
| 1149 | 2928498348 | |||
| 1150 | 2929198348 | |||
| 1151 | 2931383971 | |||
| 1152 | 2937614469 | |||
| 1153 | 2939591115 | |||
| 1154 | 2939624609 | |||
| 1155 | 2939628317 | |||
| 1156 | 2941476646 | |||
| 1157 | 2941491140 | |||
| 1158 | 2961049337 | |||
| 1159 | 2961065971 | |||
| 1160 | 2974308213 | |||
| 1161 | 2977248971 | |||
| 1162 | 2984516578 | |||
| 1163 | 2987607370 | |||
| 1164 | 2995952071 | |||
| 1165 | 8003014577 | |||
| 1166 | 8021624514 | |||
| 1167 | 8021627618 | |||
| 1168 | 8021650741 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9i-assembly1.cif.gz_D | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9279 | 29 | 282 |
| 2f9y-assembly1.cif.gz_B-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9276 | 29 | 287 |
| 2f9i-assembly1.cif.gz_D | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9071 | 29 | 282 |
| 2f9y-assembly1.cif.gz_B-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9069 | 29 | 287 |
| 5kdr-assembly1.cif.gz_B-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.8984 | 29 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f9yB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9276 | 29 | 287 | 3.90.226.10 |
| af_P49158_165_424_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9169 | 28 | 282 | 3.90.226.10 |
| 2f9yB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9069 | 29 | 287 | 3.90.226.10 |
| 5kdrB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8984 | 29 | 287 | 3.90.226.10 |
| af_P49158_165_424_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8968 | 28 | 282 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522GU42-F1-model_v4 | Acetyl-CoA carboxylase carboxyl transferase subunit beta | 0.9344 | 190 | 287 |
GO:0003989
GO:0006633 GO:0009329 GO:0016740 GO:2001295 |
| AF-A0A3Q0KZV0-F1-model_v4 | Acetyl-CoA carboxylase beta subunit | 0.9339 | 181 | 287 |
GO:0003989
GO:0006633 GO:0009329 GO:2001295 |
| AF-A0A1B8QA07-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) | 0.9338 | 29 | 284 |
GO:0003989
GO:0005524 GO:0006633 GO:0008270 GO:0009329 GO:0016743 GO:2001295 |
| AF-A0A126QHE5-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) | 0.9333 | 39 | 288 |
GO:0003989
GO:0005524 GO:0006633 GO:0009329 GO:0016743 GO:2001295 |
| AF-H9UL55-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) | 0.9333 | 31 | 283 |
GO:0003989
GO:0005524 GO:0006633 GO:0008270 GO:0009317 GO:0016743 GO:2001295 |