F466428

General Info

Members Datasets Scaffolds Average Seq Length
585 308 1170 166

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100260138|Ga0070700_1002601382
Length 193
Sequence LSTHSDPEVGARPRVGYLGLGSNLGDRESHLRAAVELLGERGVEVEAVSSLYETEPVGEVLDQADFLNAAIRVRTDREPEVLLDLCKEIEAERGRALDAPRHSPRPLDVDLLLLGDLQLSTDRLTLPHPEVTSRRFVLAPLLELDPGLTLPDGTRLADALASLGPDQRAERIDHPFRMSDSAMDPEKTQEGRS

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 9.57
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100260138 3300005441 Bacteria 1249
2 JGI24746J21847_1000013 3300001977 Bacteria 16828
3 JGI24740J21852_10005792 3300001979 Bacteria 5188
4 JGI24748J21848_1000495 3300002074 Bacteria 4339
5 JGI24034J26672_10000146 3300002239 Bacteria 10216
6 JGI24742J22300_10010811 3300002244 Bacteria 1512
7 Ga0070658_10105188 3300005327 Bacteria 2335
8 Ga0070683_100028965 3300005329 Bacteria 5009
9 Ga0070683_100211169 3300005329 Bacteria 1844
10 Ga0070683_100299953 3300005329 Bacteria 1528
11 Ga0070690_100120105 3300005330 Bacteria 1763
12 Ga0070690_100242953 3300005330 Unclassified 1270
13 Ga0070670_100569236 3300005331 Unclassified 1012
14 Ga0070677_10000021 3300005333 Bacteria 47171
15 Ga0070680_100090142 3300005336 Bacteria 2538
16 Ga0070680_100105810 3300005336 Bacteria 2339
17 Ga0070682_100000009 3300005337 Bacteria 291635
18 Ga0070682_100000334 3300005337 Bacteria 32362
19 Ga0070682_100289815 3300005337 Bacteria 1197
20 Ga0068868_100005148 3300005338 Bacteria 9177
21 Ga0068868_100014590 3300005338 Bacteria 5794
22 Ga0068868_100025422 3300005338 Bacteria 4505
23 Ga0070660_101382704 3300005339 Bacteria 598
24 Ga0070689_100219168 3300005340 Bacteria 1560
25 Ga0070691_10000055 3300005341 Bacteria 31550
26 Ga0070691_10006497 3300005341 Bacteria 5347
27 Ga0070687_100077891 3300005343 Bacteria 1800
28 Ga0070668_100003372 3300005347 Bacteria 11778
29 Ga0070668_100007576 3300005347 Bacteria 8058
30 Ga0070668_100576232 3300005347 Bacteria 982
31 Ga0070675_100410494 3300005354 Unclassified 1209
32 Ga0070674_100000034 3300005356 Bacteria 63783
33 Ga0070674_100000074 3300005356 Bacteria 46384
34 Ga0070674_100031852 3300005356 Bacteria 3498
35 Ga0070673_100003095 3300005364 Bacteria 10299
36 Ga0070673_100165204 3300005364 Bacteria 1885
37 Ga0070688_100001998 3300005365 Bacteria 10281
38 Ga0070688_100002953 3300005365 Bacteria 8666
39 Ga0070667_100004232 3300005367 Bacteria 12118
40 Ga0070667_100567429 3300005367 Unclassified 1044
41 Ga0070709_10218370 3300005434 Bacteria 1358
42 Ga0070714_100302253 3300005435 Bacteria 1492
43 Ga0070701_10103650 3300005438 Unclassified 1579
44 Ga0070711_100017154 3300005439 Bacteria 4607
45 Ga0070705_100846252 3300005440 Bacteria 731
46 Ga0070705_101445980 3300005440 Bacteria 574
47 Ga0070700_101206387 3300005441 Bacteria 632
48 Ga0070708_100883775 3300005445 Bacteria 839
49 Ga0070663_100215015 3300005455 Bacteria 1507
50 Ga0070663_100398122 3300005455 Bacteria 1125
51 Ga0070678_100027223 3300005456 Bacteria 3880
52 Ga0070678_100051268 3300005456 Bacteria 2990
53 Ga0070662_100000001 3300005457 Bacteria 317995
54 Ga0070681_10056139 3300005458 Bacteria 3919
55 Ga0070685_10001479 3300005466 Bacteria 12372
56 Ga0070685_10002506 3300005466 Bacteria 9427
57 Ga0070679_100000362 3300005530 Bacteria 38683
58 Ga0070684_100075935 3300005535 Bacteria 2965
59 Ga0070684_100142108 3300005535 Bacteria 2171
60 Ga0068853_100038176 3300005539 Bacteria 4090
61 Ga0070672_100000314 3300005543 Bacteria 27496
62 Ga0070672_100674088 3300005543 Bacteria 904
63 Ga0070686_100195032 3300005544 Bacteria 1448
64 Ga0070695_100218161 3300005545 Bacteria 1373
65 Ga0070693_100011281 3300005547 Bacteria 4498
66 Ga0070665_100000022 3300005548 Bacteria 379286
67 Ga0070665_100049652 3300005548 Bacteria 4209
68 Ga0070665_100050752 3300005548 Unclassified 4163
69 Ga0070665_100105430 3300005548 Bacteria 2821
70 Ga0070665_100172645 3300005548 Bacteria 2163
71 Ga0070665_100309666 3300005548 Bacteria 1583
72 Ga0070665_100975057 3300005548 Bacteria 860
73 Ga0070704_100043222 3300005549 Bacteria 3122
74 Ga0068855_100248252 3300005563 Unclassified 1986
75 Ga0070664_101595064 3300005564 Bacteria 618
76 Ga0068854_100000094 3300005578 Bacteria 62790
77 Ga0068854_100068440 3300005578 Unclassified 2589
78 Ga0068856_100012044 3300005614 Bacteria 8378
79 Ga0068856_100077943 3300005614 Bacteria 3284
80 Ga0068856_100582596 3300005614 Bacteria 1140
81 Ga0068852_100000132 3300005616 Bacteria 50593
82 Ga0068852_100759895 3300005616 Bacteria 982
83 Ga0068866_10000005 3300005718 Bacteria 196339
84 Ga0068866_10002023 3300005718 Bacteria 8441
85 Ga0068866_10036814 3300005718 Bacteria 2399
86 Ga0068861_100170752 3300005719 Bacteria 1802
87 Ga0068870_10449295 3300005840 Unclassified 849
88 Ga0068863_100000229 3300005841 Bacteria 59324
89 Ga0068863_100018447 3300005841 Bacteria 6677
90 Ga0068858_100000140 3300005842 Bacteria 76446
91 Ga0068858_100173052 3300005842 Bacteria 2037
92 Ga0068858_100611947 3300005842 Bacteria 1057
93 Ga0068858_100949333 3300005842 Bacteria 842
94 Ga0068860_100025316 3300005843 Bacteria 5727
95 Ga0068860_100269634 3300005843 Bacteria 1661
96 Ga0068860_101501302 3300005843 Bacteria 695
97 Ga0068862_100002517 3300005844 Bacteria 16213
98 Ga0081455_10430430 3300005937 Bacteria 907
99 Ga0081538_10001035 3300005981 Bacteria 29671
100 Ga0081538_10011309 3300005981 Bacteria 7239
101 Ga0081540_1000222 3300005983 Bacteria 59857
102 Ga0081539_10012068 3300005985 Bacteria 6718
103 Ga0081539_10027128 3300005985 Bacteria 3635
104 Ga0075365_10014005 3300006038 Bacteria 4815
105 Ga0075365_10607242 3300006038 Bacteria 774
106 Ga0075363_100030900 3300006048 Bacteria 2775
107 Ga0075363_100034015 3300006048 Bacteria 2659
108 Ga0075363_100164551 3300006048 Bacteria 1257
109 Ga0075364_10015338 3300006051 Bacteria 4750
110 Ga0070715_10000041 3300006163 Bacteria 63425
111 Ga0070716_100150002 3300006173 Bacteria 1498
112 Ga0070712_100016854 3300006175 Bacteria 4724
113 Ga0070712_100196425 3300006175 Bacteria 1582
114 Ga0097621_100068633 3300006237 Bacteria 2925
115 Ga0068871_100160588 3300006358 Bacteria 1922
116 Ga0068871_100301681 3300006358 Bacteria 1406
117 Ga0075431_101520651 3300006847 Unclassified 628
118 Ga0075433_10012953 3300006852 Bacteria 6762
119 Ga0075433_10070121 3300006852 Bacteria 3080
120 Ga0075433_10218394 3300006852 Bacteria 1694
121 Ga0075433_10833547 3300006852 Bacteria 805
122 Ga0075434_100362561 3300006871 Bacteria 1470
123 Ga0075434_100574090 3300006871 Bacteria 1147
124 Ga0068865_100398303 3300006881 Bacteria 1127
125 Ga0068865_100415962 3300006881 Bacteria 1104
126 Ga0075436_100607867 3300006914 Bacteria 806
127 Ga0075435_100417940 3300007076 Bacteria 1155
128 Ga0111539_10014104 3300009094 Bacteria 9988
129 Ga0105245_10009411 3300009098 Bacteria 8521
130 Ga0105245_10015111 3300009098 Bacteria 6725
131 Ga0105245_10345819 3300009098 Bacteria 1472
132 Ga0105247_10000832 3300009101 Bacteria 23437
133 Ga0105247_10206537 3300009101 Bacteria 1323
134 Ga0114129_10116088 3300009147 Bacteria 3689
135 Ga0114129_10188609 3300009147 Bacteria 2801
136 Ga0114129_10323853 3300009147 Bacteria 2048
137 Ga0114129_10529615 3300009147 Bacteria 1535
138 Ga0114129_10696307 3300009147 Unclassified 1306
139 Ga0105241_10500244 3300009174 Bacteria 1084
140 Ga0105242_10000139 3300009176 Bacteria 52585
141 Ga0105242_10008101 3300009176 Bacteria 8084
142 Ga0105242_10031758 3300009176 Bacteria 4221
143 Ga0105242_10640037 3300009176 Bacteria 1033
144 Ga0105242_10841310 3300009176 Bacteria 912
145 Ga0105238_10000016 3300009551 Bacteria 236218
146 Ga0105249_10002045 3300009553 Bacteria 17502
147 Ga0105239_11598833 3300010375 Bacteria 754
148 Ga0105246_10415849 3300011119 Bacteria 1121
149 Ga0157371_10006777 3300013102 Bacteria 9364
150 Ga0157374_10011198 3300013296 Bacteria 7754
151 Ga0157378_10034057 3300013297 Bacteria 4505
152 Ga0157378_10045018 3300013297 Bacteria 3920
153 Ga0157378_10168539 3300013297 Bacteria 2052
154 Ga0157378_10203689 3300013297 Bacteria 1873
155 Ga0163162_10235941 3300013306 Bacteria 1959
156 Ga0157372_10000556 3300013307 Bacteria 41040
157 Ga0157372_11015001 3300013307 Bacteria 961
158 Ga0157375_10000368 3300013308 Bacteria 41066
159 Ga0157375_10019550 3300013308 Bacteria 6164
160 Ga0157375_10019793 3300013308 Bacteria 6133
161 Ga0163163_10923071 3300014325 Bacteria 936
162 Ga0163163_11015211 3300014325 Bacteria 893
163 Ga0163163_12267714 3300014325 Bacteria 602
164 Ga0157380_10000100 3300014326 Bacteria 48182
165 Ga0157380_10152448 3300014326 Bacteria 2000
166 Ga0157380_12088868 3300014326 Bacteria 629
167 Ga0157379_10039277 3300014968 Bacteria 4222
168 Ga0157379_10050878 3300014968 Bacteria 3699
169 Ga0157379_10074618 3300014968 Bacteria 3036
170 Ga0157376_10145469 3300014969 Archaea 2131
171 Ga0163161_10000103 3300017792 Bacteria 81496
172 Ga0206354_10371484 3300020081 Bacteria 1648
173 Ga0213875_10022030 3300021388 Bacteria 3049
174 Ga0207672_1005592 3300025223 Bacteria 718
175 Ga0207656_10010164 3300025321 Bacteria 3514
176 Ga0207682_10000020 3300025893 Bacteria 64537
177 Ga0207642_10000005 3300025899 Bacteria 401934
178 Ga0207642_10000136 3300025899 Bacteria 20531
179 Ga0207710_10000096 3300025900 Bacteria 116063
180 Ga0207710_10498862 3300025900 Unclassified 631
181 Ga0207688_10219754 3300025901 Bacteria 1144
182 Ga0207685_10000037 3300025905 Bacteria 63409
183 Ga0207685_10129515 3300025905 Bacteria 1118
184 Ga0207699_10100367 3300025906 Bacteria 1835
185 Ga0207643_10333640 3300025908 Unclassified 949
186 Ga0207705_10079212 3300025909 Bacteria 2392
187 Ga0207705_10138529 3300025909 Bacteria 1816
188 Ga0207707_10003109 3300025912 Bacteria 14734
189 Ga0207693_10007969 3300025915 Bacteria 8701
190 Ga0207663_10017473 3300025916 Bacteria 3998
191 Ga0207663_10019663 3300025916 Bacteria 3811
192 Ga0207660_10062700 3300025917 Bacteria 2679
193 Ga0207660_10819542 3300025917 Bacteria 759
194 Ga0207660_11253795 3300025917 Bacteria 603
195 Ga0207649_10000015 3300025920 Bacteria 245662
196 Ga0207652_10001682 3300025921 Bacteria 19376
197 Ga0207694_10000012 3300025924 Bacteria 411218
198 Ga0207687_10000094 3300025927 Bacteria 64753
199 Ga0207687_10007755 3300025927 Bacteria 7041
200 Ga0207687_10030525 3300025927 Bacteria 3635
201 Ga0207700_10000003 3300025928 Bacteria 500797
202 Ga0207664_10584340 3300025929 Bacteria 1003
203 Ga0207690_10101137 3300025932 Bacteria 2059
204 Ga0207706_10000003 3300025933 Bacteria 345011
205 Ga0207686_10000035 3300025934 Bacteria 130483
206 Ga0207686_10002089 3300025934 Bacteria 11005
207 Ga0207686_10043435 3300025934 Bacteria 2754
208 Ga0207686_10267279 3300025934 Unclassified 1257
209 Ga0207709_10069515 3300025935 Bacteria 2229
210 Ga0207670_10299894 3300025936 Bacteria 1258
211 Ga0207669_10000002 3300025937 Bacteria 377651
212 Ga0207669_10000060 3300025937 Bacteria 54757
213 Ga0207669_10037237 3300025937 Bacteria 2789
214 Ga0207704_10332722 3300025938 Bacteria 1176
215 Ga0207665_10077573 3300025939 Bacteria 2281
216 Ga0207691_10000286 3300025940 Bacteria 49918
217 Ga0207661_10007061 3300025944 Bacteria 7971
218 Ga0207661_10180336 3300025944 Bacteria 1844
219 Ga0207661_10254137 3300025944 Bacteria 1563
220 Ga0207667_10058885 3300025949 Bacteria 4027
221 Ga0207651_10004180 3300025960 Bacteria 7225
222 Ga0207712_10002660 3300025961 Bacteria 11434
223 Ga0207668_10245758 3300025972 Bacteria 1450
224 Ga0207640_10000907 3300025981 Bacteria 16634
225 Ga0207640_10064306 3300025981 Unclassified 2442
226 Ga0207658_10090233 3300025986 Bacteria 2374
227 Ga0207658_10214653 3300025986 Unclassified 1615
228 Ga0207658_10448190 3300025986 Unclassified 1142
229 Ga0207677_10000956 3300026023 Bacteria 16043
230 Ga0207677_10006755 3300026023 Bacteria 6301
231 Ga0207677_10020486 3300026023 Bacteria 4016
232 Ga0207703_10000020 3300026035 Bacteria 251603
233 Ga0207703_10181751 3300026035 Bacteria 1856
234 Ga0207703_10503976 3300026035 Bacteria 1137
235 Ga0207639_10017318 3300026041 Bacteria 5108
236 Ga0207678_10073035 3300026067 Bacteria 2940
237 Ga0207678_10170165 3300026067 Bacteria 1860
238 Ga0207678_10184774 3300026067 Unclassified 1780
239 Ga0207708_10075453 3300026075 Bacteria 2585
240 Ga0207702_10000349 3300026078 Bacteria 52941
241 Ga0207702_10019836 3300026078 Bacteria 5568
242 Ga0207702_10056339 3300026078 Bacteria 3337
243 Ga0207702_10242577 3300026078 Bacteria 1689
244 Ga0207641_10001448 3300026088 Bacteria 23281
245 Ga0207641_10168023 3300026088 Bacteria 2000
246 Ga0207641_10624667 3300026088 Bacteria 1056
247 Ga0207676_10000048 3300026095 Bacteria 147853
248 Ga0207675_100069886 3300026118 Bacteria 3282
249 Ga0207675_100567503 3300026118 Bacteria 1135
250 Ga0207675_101075065 3300026118 Bacteria 824
251 Ga0207683_10076310 3300026121 Bacteria 2967
252 Ga0207683_10220889 3300026121 Bacteria 1726
253 Ga0207698_10000014 3300026142 Bacteria 240703
254 Ga0268266_10000029 3300028379 Bacteria 424015
255 Ga0268266_10004781 3300028379 Bacteria 12874
256 Ga0268266_10022101 3300028379 Bacteria 5423
257 Ga0268266_10043348 3300028379 Bacteria 3845
258 Ga0268266_10151672 3300028379 Bacteria 2089
259 Ga0268266_10250515 3300028379 Bacteria 1638
260 Ga0268265_10124757 3300028380 Bacteria 2128
261 Ga0268264_10010176 3300028381 Bacteria 7785
262 Ga0265337_1000282 3300028556 Bacteria 27585
263 Ga0265326_10000033 3300028558 Bacteria 91972
264 Ga0265326_10039342 3300028558 Bacteria 1343
265 Ga0265319_1000037 3300028563 Bacteria 115642
266 Ga0265322_10000017 3300028654 Bacteria 114833
267 Ga0265336_10001223 3300028666 Bacteria 12183
268 Ga0265338_10000051 3300028800 Bacteria 211202
269 Ga0265324_10000479 3300029957 Bacteria 28017
270 Ga0307511_10140305 3300030521 Unclassified 1423
271 Ga0265332_10010464 3300031238 Bacteria 4128
272 Ga0265328_10001388 3300031239 Bacteria 11151
273 Ga0265320_10000010 3300031240 Bacteria 250501
274 Ga0265320_10147082 3300031240 Bacteria 1065
275 Ga0265329_10005234 3300031242 Bacteria 5271
276 Ga0265331_10000505 3300031250 Bacteria 36592
277 Ga0265331_10014753 3300031250 Bacteria 4149
278 Ga0265327_10000040 3300031251 Bacteria 291052
279 Ga0265316_10003339 3300031344 Bacteria 16267
280 Ga0307408_100168438 3300031548 Bacteria 1747
281 Ga0265314_10000803 3300031711 Bacteria 37303
282 Ga0316578_10347867 3300031728 Bacteria 882
283 Ga0307410_10067624 3300031852 Bacteria 2465
284 Ga0307410_10181407 3300031852 Bacteria 1594
285 Ga0307410_11431594 3300031852 Bacteria 607
286 Ga0307406_10123999 3300031901 Bacteria 1801
287 Ga0307406_10233340 3300031901 Bacteria 1375
288 Ga0307407_10170916 3300031903 Bacteria 1431
289 Ga0307409_100036948 3300031995 Bacteria 3595
290 Ga0307416_100275436 3300032002 Bacteria 1655
291 Ga0307416_100431181 3300032002 Bacteria 1365
292 Ga0307411_10186501 3300032005 Bacteria 1579
293 Ga0307415_101212235 3300032126 Bacteria 711
294 Ga0316583_10181908 3300032133 Bacteria 731
295 Ga0373956_0493929 3300035119 Bacteria 584
296 Ga0316574_0006646 3300035398 Bacteria 6271
297 Ga0373925_0380727 3300037068 Bacteria 1149
298 Ga0395899_0411571 3300037312 Unclassified 893
299 Ga0395899_0507047 3300037312 Unclassified 782
300 Ga0395900_0588802 3300037418 Unclassified 1054
301 Ga0395898_0121883 3300037466 Bacteria 2498
302 Ga0395898_0170937 3300037466 Bacteria 2078
303 Ga0395898_0368389 3300037466 Bacteria 1370
304 Ga0395905_0039291 3300037471 Bacteria 4439
305 Ga0395905_0688369 3300037471 Bacteria 925
306 Ga0436364_0882232 3300037853 Bacteria 9571
307 Ga0395901_0009304 3300038443 Bacteria 9957
308 Ga0395901_0045395 3300038443 Bacteria 4560
309 Ga0395901_0068125 3300038443 Bacteria 3708
310 Ga0395901_0157275 3300038443 Bacteria 2387
311 Ga0395901_0555533 3300038443 Bacteria 1163
312 Ga0395901_1288321 3300038443 Bacteria 693
313 Ga0436363_0443338 3300039450 Bacteria 2160
314 Ga0436362_1158277 3300039453 Unclassified 806
315 Ga0451800_0304270 3300041459 Bacteria 1000
316 Ga0451853_0244390 3300041512 Bacteria 5861
317 Ga0451853_2208875 3300041512 Bacteria 828
318 Ga0451853_3479922 3300041512 Bacteria 652
319 Ga0466963_0000214 3300044694 Bacteria 24729
320 Ga0466963_0014196 3300044694 Bacteria 4907
321 Ga0466963_0156339 3300044694 Bacteria 1585
322 Ga0466957_1039103 3300044842 Unclassified 589
323 Ga0466960_0051948 3300044901 Unclassified 1982
324 Ga0466959_0121567 3300045049 Bacteria 1856
325 Ga0466958_0045676 3300045836 Bacteria 2643
326 Ga0466958_0105417 3300045836 Bacteria 1756
327 Ga0466967_0013927 3300045976 Bacteria 6239
328 Ga0466967_0039087 3300045976 Bacteria 4076
329 Ga0466967_0845653 3300045976 Unclassified 909
330 Ga0495592_0000733 3300046454 Bacteria 22899
331 Ga0495603_0000254 3300046455 Bacteria 28028
332 Ga0495603_0003789 3300046455 Bacteria 8999
333 Ga0495591_140664 3300046458 Unclassified 582
334 Ga0495629_0002650 3300046459 Bacteria 13717
335 Ga0495629_0007822 3300046459 Bacteria 7863
336 Ga0495629_0009419 3300046459 Bacteria 7141
337 Ga0495629_0216524 3300046459 Bacteria 1322
338 Ga0495641_0029181 3300046461 Bacteria 2659
339 Ga0495641_0213091 3300046461 Bacteria 866
340 Ga0495653_0049412 3300046463 Bacteria 3240
341 Ga0495582_0000002 3300046473 Bacteria 219909
342 Ga0495662_0000077 3300046476 Bacteria 35063
343 Ga0495662_0017945 3300046476 Bacteria 3424
344 Ga0495664_0203393 3300046477 Bacteria 1200
345 Ga0495608_0464066 3300046511 Bacteria 769
346 Ga0495610_0197775 3300046512 Bacteria 825
347 Ga0495618_0000051 3300046514 Bacteria 87668
348 Ga0495620_0000154 3300046515 Bacteria 55875
349 Ga0495628_0000456 3300046516 Bacteria 37404
350 Ga0495628_0015683 3300046516 Bacteria 6326
351 Ga0495628_0022111 3300046516 Bacteria 5227
352 Ga0495628_0428572 3300046516 Bacteria 963
353 Ga0495628_0534698 3300046516 Bacteria 843
354 Ga0495630_0001740 3300046517 Bacteria 15204
355 Ga0495630_0116867 3300046517 Bacteria 2022
356 Ga0495630_0195614 3300046517 Bacteria 1543
357 Ga0495630_0568854 3300046517 Bacteria 869
358 Ga0495644_0002028 3300046523 Bacteria 8150
359 Ga0495644_0266264 3300046523 Bacteria 667
360 Ga0495652_0000009 3300046529 Bacteria 311000
361 Ga0495640_0033139 3300046533 Bacteria 3672
362 Ga0495640_0090623 3300046533 Bacteria 2018
363 Ga0495586_0012238 3300046535 Bacteria 4553
364 Ga0495587_0003321 3300046536 Bacteria 10737
365 Ga0495587_0052518 3300046536 Bacteria 2405
366 Ga0495587_0173373 3300046536 Bacteria 1224
367 Ga0495598_0000484 3300046537 Bacteria 7300
368 Ga0495621_0001754 3300046539 Bacteria 5685
369 Ga0495645_0018668 3300046543 Bacteria 4984
370 Ga0495645_0065210 3300046543 Bacteria 2634
371 Ga0495622_0000033 3300046557 Bacteria 124162
372 Ga0495667_0000019 3300046559 Bacteria 181645
373 Ga0495667_0085091 3300046559 Bacteria 2052
374 Ga0495667_0179559 3300046559 Unclassified 1359
375 Ga0495668_0032037 3300046616 Bacteria 2960
376 Ga0495634_0000728 3300046642 Bacteria 31906
377 Ga0495634_0002377 3300046642 Bacteria 15680
378 Ga0495634_0036516 3300046642 Bacteria 3361
379 Ga0495634_0106066 3300046642 Bacteria 1811
380 Ga0495625_0256484 3300046660 Bacteria 1133
381 Ga0495635_0000017 3300046663 Bacteria 195506
382 Ga0495635_0072164 3300046663 Bacteria 2366
383 Ga0495635_0336481 3300046663 Bacteria 1009
384 Ga0495635_0839181 3300046663 Bacteria 591
385 Ga0495588_0000204 3300046674 Bacteria 58892
386 Ga0495588_0093991 3300046674 Bacteria 1572
387 Ga0495657_0012498 3300046675 Bacteria 6307
388 Ga0495599_0005793 3300046678 Bacteria 7416
389 Ga0495599_0215129 3300046678 Bacteria 1177
390 Ga0495599_0411740 3300046678 Bacteria 804
391 Ga0495647_0000002 3300046681 Bacteria 174959
392 Ga0495647_0000645 3300046681 Bacteria 10332
393 Ga0495647_0002433 3300046681 Bacteria 5866
394 Ga0495647_0044074 3300046681 Unclassified 1710
395 Ga0495658_0000001 3300046683 Bacteria 385362
396 Ga0495658_0001925 3300046683 Bacteria 10608
397 Ga0495669_0000067 3300046684 Bacteria 68406
398 Ga0495669_0033410 3300046684 Bacteria 2264
399 Ga0495613_0000067 3300046689 Bacteria 101960
400 Ga0495613_0000261 3300046689 Bacteria 49517
401 Ga0495613_0168224 3300046689 Bacteria 1557
402 Ga0495613_0296984 3300046689 Bacteria 1119
403 Ga0495624_0000465 3300046690 Bacteria 31713
404 Ga0495624_0016129 3300046690 Bacteria 5031
405 Ga0495649_0003197 3300046694 Bacteria 11200
406 Ga0495600_0102470 3300046809 Bacteria 1865
407 Ga0495600_0222354 3300046809 Bacteria 1207
408 Ga0495604_0000252 3300047317 Bacteria 47517
409 Ga0495604_0000784 3300047317 Bacteria 26769
410 Ga0495604_0021975 3300047317 Bacteria 5092
411 Ga0495674_0000024 3300047319 Bacteria 141746
412 Ga0495672_0237591 3300047320 Bacteria 891
413 Ga0495676_0003495 3300047321 Bacteria 14222
414 Ga0495676_0106286 3300047321 Bacteria 2068
415 Ga0495676_0307010 3300047321 Bacteria 1069
416 Ga0495680_0008292 3300047322 Bacteria 9462
417 Ga0495680_0008509 3300047322 Bacteria 9322
418 Ga0495680_0022242 3300047322 Bacteria 5288
419 Ga0495680_0080042 3300047322 Bacteria 2470
420 Ga0495675_0143693 3300047444 Bacteria 1478
421 Ga0495679_010789 3300047446 Bacteria 3564
422 Ga0495684_0181288 3300047471 Bacteria 1561
423 Ga0495593_0067773 3300047673 Bacteria 1858
424 Ga0495593_0163489 3300047673 Bacteria 1123
425 Ga0495593_0166741 3300047673 Unclassified 1111
426 Ga0495602_0000548 3300048088 Bacteria 35114
427 Ga0495602_0025419 3300048088 Bacteria 5731
428 Ga0495602_0184722 3300048088 Bacteria 1604
429 Ga0495614_0066360 3300048089 Bacteria 1552
430 Ga0496101_0000005 3300048904 Bacteria 331455
431 Ga0496101_0000009 3300048904 Bacteria 297429
432 Ga0496102_0000021 3300048905 Bacteria 246920
433 Ga0496102_0111550 3300048905 Bacteria 2550
434 Ga0496102_0460244 3300048905 Bacteria 1193
435 Ga0496103_0000001 3300048906 Bacteria 643471
436 Ga0496103_0011859 3300048906 Bacteria 5172
437 Ga0496103_0176574 3300048906 Bacteria 1372
438 Ga0496103_0231315 3300048906 Unclassified 1189
439 Ga0496104_0000008 3300048907 Bacteria 516976
440 Ga0496104_0000029 3300048907 Bacteria 202968
441 Ga0496104_0002134 3300048907 Bacteria 17161
442 Ga0496105_0000002 3300048908 Bacteria 753215
443 Ga0496105_0000003 3300048908 Bacteria 713251
444 Ga0496105_0205944 3300048908 Bacteria 1604
445 Ga0496106_0000033 3300048909 Bacteria 131412
446 Ga0496106_0000072 3300048909 Bacteria 80978
447 Ga0496106_0001725 3300048909 Bacteria 16309
448 Ga0496106_0275962 3300048909 Bacteria 1346
449 Ga0496106_0723582 3300048909 Unclassified 792
450 Ga0496107_0000004 3300048910 Bacteria 297680
451 Ga0496107_0000015 3300048910 Bacteria 173644
452 Ga0496107_0034951 3300048910 Bacteria 3602
453 Ga0496107_0236316 3300048910 Bacteria 1360
454 Ga0496107_0455323 3300048910 Bacteria 950
455 Ga0496107_0825892 3300048910 Bacteria 678
456 Ga0496108_0000904 3300048911 Bacteria 23112
457 Ga0496108_0000929 3300048911 Bacteria 22852
458 Ga0496108_0134675 3300048911 Bacteria 2124
459 Ga0496109_0000031 3300048912 Bacteria 163998
460 Ga0496109_0000304 3300048912 Bacteria 46522
461 Ga0496109_0001164 3300048912 Bacteria 21895
462 Ga0496109_0215484 3300048912 Bacteria 1806
463 Ga0496109_0830690 3300048912 Bacteria 862
464 Ga0496110_0001599 3300048913 Bacteria 16558
465 Ga0496110_0010694 3300048913 Bacteria 7474
466 Ga0496110_0015147 3300048913 Bacteria 6411
467 Ga0496110_0035633 3300048913 Bacteria 4318
468 Ga0496110_0090969 3300048913 Bacteria 2729
469 Ga0496110_0302322 3300048913 Bacteria 1457
470 Ga0496111_0000838 3300048914 Bacteria 16598
471 Ga0496111_0033845 3300048914 Bacteria 3645
472 Ga0496111_0074969 3300048914 Bacteria 2465
473 Ga0496111_0290307 3300048914 Bacteria 1213
474 Ga0496112_0015640 3300048915 Bacteria 7087
475 Ga0496112_0139802 3300048915 Bacteria 2391
476 Ga0496113_0000204 3300048916 Bacteria 27481
477 Ga0496113_0015038 3300048916 Bacteria 5301
478 Ga0496113_0562625 3300048916 Bacteria 914
479 Ga0496114_0000003 3300048917 Bacteria 630981
480 Ga0496114_0016570 3300048917 Bacteria 5940
481 Ga0496114_0094730 3300048917 Bacteria 2540
482 Ga0496115_0000022 3300048918 Bacteria 164224
483 Ga0496115_0000027 3300048918 Bacteria 145505
484 Ga0496115_0022739 3300048918 Bacteria 4861
485 Ga0496119_0029173 3300048922 Bacteria 3748
486 Ga0496120_0025524 3300048923 Bacteria 3666
487 Ga0496125_0161665 3300048928 Bacteria 1520
488 Ga0496125_0248481 3300048928 Bacteria 1124
489 Ga0501031_0002938 3300049568 Bacteria 10903
490 Ga0501032_0003803 3300049569 Bacteria 11462
491 Ga0501033_0001536 3300049570 Bacteria 20404
492 Ga0501034_0011192 3300049571 Bacteria 9313
493 Ga0501034_0035336 3300049571 Bacteria 5066
494 Ga0501034_0981269 3300049571 Bacteria 729
495 Ga0501036_0001168 3300049572 Bacteria 19971
496 Ga0501037_0001248 3300049573 Bacteria 18749
497 Ga0501038_0006315 3300049574 Bacteria 10963
498 Ga0501039_0003095 3300049575 Bacteria 12440
499 Ga0501042_0081740 3300049578 Bacteria 2316
500 Ga0501042_0130100 3300049578 Bacteria 1814
501 Ga0501042_0161422 3300049578 Bacteria 1617
502 Ga0501042_0378910 3300049578 Bacteria 1024
503 Ga0501043_0002606 3300049579 Bacteria 15213
504 Ga0501043_0656560 3300049579 Bacteria 770
505 Ga0501046_0000450 3300049580 Bacteria 41377
506 Ga0501047_0001405 3300049581 Bacteria 23600
507 Ga0501047_0186043 3300049581 Bacteria 1942
508 Ga0501048_0008575 3300049582 Bacteria 7717
509 Ga0501068_0018631 3300049584 Bacteria 4020
510 Ga0501068_0203312 3300049584 Bacteria 1256
511 Ga0501070_0000625 3300049586 Bacteria 32508
512 Ga0501071_0329116 3300049587 Unclassified 1161
513 Ga0501072_0051100 3300049588 Bacteria 3255
514 Ga0501073_0012831 3300049589 Bacteria 6107
515 Ga0501074_0022027 3300049590 Bacteria 4629
516 Ga0501074_0082105 3300049590 Bacteria 2311
517 Ga0501075_0043881 3300049591 Bacteria 3353
518 Ga0501077_0268616 3300049593 Unclassified 1085
519 Ga0501079_0003224 3300049741 Bacteria 11949
520 Ga0501079_0383462 3300049741 Bacteria 1102
521 Ga0501079_0768053 3300049741 Bacteria 759
522 Ga0501080_0010717 3300049742 Bacteria 8387
523 Ga0501080_0021879 3300049742 Bacteria 5922
524 Ga0501080_0099840 3300049742 Bacteria 2693
525 Ga0501081_0259318 3300049743 Unclassified 1270
526 Ga0501081_0459947 3300049743 Bacteria 946
527 Ga0501081_1116127 3300049743 Unclassified 597
528 Ga0501083_0035339 3300049744 Bacteria 3414
529 Ga0501035_0000693 3300049822 Bacteria 36690
530 Ga0501035_0208687 3300049822 Bacteria 1672
531 Ga0501044_0001351 3300049823 Bacteria 28828
532 Ga0501044_0027582 3300049823 Bacteria 5999
533 Ga0501044_0029142 3300049823 Bacteria 5822
534 nmdc:mga03n38_39998_c1 3300050490 Bacteria 2036
535 nmdc:mga00v17_244163_c1 3300050491 Unclassified 1164
536 nmdc:mga00v17_65431_c1 3300050491 Bacteria 2243
537 nmdc:mga0yw44_171820_c1 3300050492 Bacteria 1423
538 nmdc:mga0yw44_22505_c1 3300050492 Bacteria 3536
539 nmdc:mga0yw44_4943_c1 3300050492 Bacteria 6209
540 nmdc:mga0yw44_542635_c1 3300050492 Bacteria 789
541 nmdc:mga06z11_32216_c1 3300050494 Bacteria 2554
542 nmdc:mga06z11_590836_c1 3300050494 Bacteria 675
543 nmdc:mga05p37_143263_c1 3300050507 Bacteria 2927
544 nmdc:mga05p37_49388_c1 3300050507 Bacteria 5174
545 nmdc:mga05p37_511729_c1 3300050507 Bacteria 1375
546 nmdc:mga0qj67_266255_c1 3300050509 Bacteria 1390
547 nmdc:mga0qj67_347558_c1 3300050509 Bacteria 1199
548 nmdc:mga0qj67_378063_c1 3300050509 Bacteria 1144
549 nmdc:mga06r32_3072_c1 3300050510 Bacteria 14942
550 nmdc:mga06r32_444448_c1 3300050510 Bacteria 1276
551 nmdc:mga0n895_309881_c1 3300050512 Bacteria 1600
552 nmdc:mga0n895_544431_c1 3300050512 Bacteria 1167
553 nmdc:mga0n895_549510_c1 3300050512 Bacteria 1161
554 nmdc:mga0rr50_218164_c1 3300050513 Unclassified 1574
555 nmdc:mga0a205_1036129_c1 3300050515 Unclassified 668
556 nmdc:mga0a205_36960_c2 3300050515 Bacteria 2898
557 nmdc:mga0a205_491_c1 3300050515 Bacteria 30978
558 nmdc:mga0a205_82266_c1 3300050515 Bacteria 3110
559 Ga0495601_0001870 3300053077 Bacteria 11727
560 Ga0495601_0003507 3300053077 Bacteria 9009
561 Ga0495601_0021107 3300053077 Bacteria 3985
562 Ga0495601_0095437 3300053077 Bacteria 1917
563 Ga0495601_0301944 3300053077 Bacteria 1043
564 Ga0495612_0000962 3300053078 Bacteria 11833
565 Ga0495612_0107681 3300053078 Bacteria 1191
566 Ga0495655_0000008 3300053083 Bacteria 153535
567 Ga0495655_0000581 3300053083 Bacteria 6004
568 Ga0495655_0076746 3300053083 Bacteria 947
569 Ga0495595_0001165 3300053084 Bacteria 10189
570 Ga0495595_0034437 3300053084 Bacteria 2290
571 Ga0495619_0000001 3300053085 Bacteria 586054
572 Ga0495619_0000649 3300053085 Bacteria 22812
573 Ga0495619_0006787 3300053085 Bacteria 7241
574 Ga0495619_0066208 3300053085 Bacteria 2411
575 Ga0495619_0113592 3300053085 Bacteria 1852
576 Ga0500566_0049433 3300053094 Bacteria 2409
577 Ga0500628_000074 3300053129 Bacteria 25753
578 Ga0501084_0229795 3300054114 Bacteria 1566
579 Ga0501082_0010303 3300060353 Bacteria 8048
580 Ga0501082_0113538 3300060353 Bacteria 2346
581 Ga0501082_0542546 3300060353 Bacteria 1017
582 Ga0501082_0722510 3300060353 Bacteria 872
583 Ga0466962_0025755 3300061719 Bacteria 2823
584 Ga0466962_0094400 3300061719 Unclassified 1434
585 Ga0530510_0042664 3300061734 Bacteria 3277
586 Ga0070700_100260138
587 JGI24746J21847_1000013
588 JGI24740J21852_10005792
589 JGI24748J21848_1000495
590 JGI24034J26672_10000146
591 JGI24742J22300_10010811
592 Ga0070658_10105188
593 Ga0070683_100028965
594 Ga0070683_100211169
595 Ga0070683_100299953
596 Ga0070690_100120105
597 Ga0070690_100242953
598 Ga0070670_100569236
599 Ga0070677_10000021
600 Ga0070680_100090142
601 Ga0070680_100105810
602 Ga0070682_100000009
603 Ga0070682_100000334
604 Ga0070682_100289815
605 Ga0068868_100005148
606 Ga0068868_100014590
607 Ga0068868_100025422
608 Ga0070660_101382704
609 Ga0070689_100219168
610 Ga0070691_10000055
611 Ga0070691_10006497
612 Ga0070687_100077891
613 Ga0070668_100003372
614 Ga0070668_100007576
615 Ga0070668_100576232
616 Ga0070675_100410494
617 Ga0070674_100000034
618 Ga0070674_100000074
619 Ga0070674_100031852
620 Ga0070673_100003095
621 Ga0070673_100165204
622 Ga0070688_100001998
623 Ga0070688_100002953
624 Ga0070667_100004232
625 Ga0070667_100567429
626 Ga0070709_10218370
627 Ga0070714_100302253
628 Ga0070701_10103650
629 Ga0070711_100017154
630 Ga0070705_100846252
631 Ga0070705_101445980
632 Ga0070700_101206387
633 Ga0070708_100883775
634 Ga0070663_100215015
635 Ga0070663_100398122
636 Ga0070678_100027223
637 Ga0070678_100051268
638 Ga0070662_100000001
639 Ga0070681_10056139
640 Ga0070685_10001479
641 Ga0070685_10002506
642 Ga0070679_100000362
643 Ga0070684_100075935
644 Ga0070684_100142108
645 Ga0068853_100038176
646 Ga0070672_100000314
647 Ga0070672_100674088
648 Ga0070686_100195032
649 Ga0070695_100218161
650 Ga0070693_100011281
651 Ga0070665_100000022
652 Ga0070665_100049652
653 Ga0070665_100050752
654 Ga0070665_100105430
655 Ga0070665_100172645
656 Ga0070665_100309666
657 Ga0070665_100975057
658 Ga0070704_100043222
659 Ga0068855_100248252
660 Ga0070664_101595064
661 Ga0068854_100000094
662 Ga0068854_100068440
663 Ga0068856_100012044
664 Ga0068856_100077943
665 Ga0068856_100582596
666 Ga0068852_100000132
667 Ga0068852_100759895
668 Ga0068866_10000005
669 Ga0068866_10002023
670 Ga0068866_10036814
671 Ga0068861_100170752
672 Ga0068870_10449295
673 Ga0068863_100000229
674 Ga0068863_100018447
675 Ga0068858_100000140
676 Ga0068858_100173052
677 Ga0068858_100611947
678 Ga0068858_100949333
679 Ga0068860_100025316
680 Ga0068860_100269634
681 Ga0068860_101501302
682 Ga0068862_100002517
683 Ga0081455_10430430
684 Ga0081538_10001035
685 Ga0081538_10011309
686 Ga0081540_1000222
687 Ga0081539_10012068
688 Ga0081539_10027128
689 Ga0075365_10014005
690 Ga0075365_10607242
691 Ga0075363_100030900
692 Ga0075363_100034015
693 Ga0075363_100164551
694 Ga0075364_10015338
695 Ga0070715_10000041
696 Ga0070716_100150002
697 Ga0070712_100016854
698 Ga0070712_100196425
699 Ga0097621_100068633
700 Ga0068871_100160588
701 Ga0068871_100301681
702 Ga0075431_101520651
703 Ga0075433_10012953
704 Ga0075433_10070121
705 Ga0075433_10218394
706 Ga0075433_10833547
707 Ga0075434_100362561
708 Ga0075434_100574090
709 Ga0068865_100398303
710 Ga0068865_100415962
711 Ga0075436_100607867
712 Ga0075435_100417940
713 Ga0111539_10014104
714 Ga0105245_10009411
715 Ga0105245_10015111
716 Ga0105245_10345819
717 Ga0105247_10000832
718 Ga0105247_10206537
719 Ga0114129_10116088
720 Ga0114129_10188609
721 Ga0114129_10323853
722 Ga0114129_10529615
723 Ga0114129_10696307
724 Ga0105241_10500244
725 Ga0105242_10000139
726 Ga0105242_10008101
727 Ga0105242_10031758
728 Ga0105242_10640037
729 Ga0105242_10841310
730 Ga0105238_10000016
731 Ga0105249_10002045
732 Ga0105239_11598833
733 Ga0105246_10415849
734 Ga0157371_10006777
735 Ga0157374_10011198
736 Ga0157378_10034057
737 Ga0157378_10045018
738 Ga0157378_10168539
739 Ga0157378_10203689
740 Ga0163162_10235941
741 Ga0157372_10000556
742 Ga0157372_11015001
743 Ga0157375_10000368
744 Ga0157375_10019550
745 Ga0157375_10019793
746 Ga0163163_10923071
747 Ga0163163_11015211
748 Ga0163163_12267714
749 Ga0157380_10000100
750 Ga0157380_10152448
751 Ga0157380_12088868
752 Ga0157379_10039277
753 Ga0157379_10050878
754 Ga0157379_10074618
755 Ga0157376_10145469
756 Ga0163161_10000103
757 Ga0206354_10371484
758 Ga0213875_10022030
759 Ga0207672_1005592
760 Ga0207656_10010164
761 Ga0207682_10000020
762 Ga0207642_10000005
763 Ga0207642_10000136
764 Ga0207710_10000096
765 Ga0207710_10498862
766 Ga0207688_10219754
767 Ga0207685_10000037
768 Ga0207685_10129515
769 Ga0207699_10100367
770 Ga0207643_10333640
771 Ga0207705_10079212
772 Ga0207705_10138529
773 Ga0207707_10003109
774 Ga0207693_10007969
775 Ga0207663_10017473
776 Ga0207663_10019663
777 Ga0207660_10062700
778 Ga0207660_10819542
779 Ga0207660_11253795
780 Ga0207649_10000015
781 Ga0207652_10001682
782 Ga0207694_10000012
783 Ga0207687_10000094
784 Ga0207687_10007755
785 Ga0207687_10030525
786 Ga0207700_10000003
787 Ga0207664_10584340
788 Ga0207690_10101137
789 Ga0207706_10000003
790 Ga0207686_10000035
791 Ga0207686_10002089
792 Ga0207686_10043435
793 Ga0207686_10267279
794 Ga0207709_10069515
795 Ga0207670_10299894
796 Ga0207669_10000002
797 Ga0207669_10000060
798 Ga0207669_10037237
799 Ga0207704_10332722
800 Ga0207665_10077573
801 Ga0207691_10000286
802 Ga0207661_10007061
803 Ga0207661_10180336
804 Ga0207661_10254137
805 Ga0207667_10058885
806 Ga0207651_10004180
807 Ga0207712_10002660
808 Ga0207668_10245758
809 Ga0207640_10000907
810 Ga0207640_10064306
811 Ga0207658_10090233
812 Ga0207658_10214653
813 Ga0207658_10448190
814 Ga0207677_10000956
815 Ga0207677_10006755
816 Ga0207677_10020486
817 Ga0207703_10000020
818 Ga0207703_10181751
819 Ga0207703_10503976
820 Ga0207639_10017318
821 Ga0207678_10073035
822 Ga0207678_10170165
823 Ga0207678_10184774
824 Ga0207708_10075453
825 Ga0207702_10000349
826 Ga0207702_10019836
827 Ga0207702_10056339
828 Ga0207702_10242577
829 Ga0207641_10001448
830 Ga0207641_10168023
831 Ga0207641_10624667
832 Ga0207676_10000048
833 Ga0207675_100069886
834 Ga0207675_100567503
835 Ga0207675_101075065
836 Ga0207683_10076310
837 Ga0207683_10220889
838 Ga0207698_10000014
839 Ga0268266_10000029
840 Ga0268266_10004781
841 Ga0268266_10022101
842 Ga0268266_10043348
843 Ga0268266_10151672
844 Ga0268266_10250515
845 Ga0268265_10124757
846 Ga0268264_10010176
847 Ga0265337_1000282
848 Ga0265326_10000033
849 Ga0265326_10039342
850 Ga0265319_1000037
851 Ga0265322_10000017
852 Ga0265336_10001223
853 Ga0265338_10000051
854 Ga0265324_10000479
855 Ga0307511_10140305
856 Ga0265332_10010464
857 Ga0265328_10001388
858 Ga0265320_10000010
859 Ga0265320_10147082
860 Ga0265329_10005234
861 Ga0265331_10000505
862 Ga0265331_10014753
863 Ga0265327_10000040
864 Ga0265316_10003339
865 Ga0307408_100168438
866 Ga0265314_10000803
867 Ga0316578_10347867
868 Ga0307410_10067624
869 Ga0307410_10181407
870 Ga0307410_11431594
871 Ga0307406_10123999
872 Ga0307406_10233340
873 Ga0307407_10170916
874 Ga0307409_100036948
875 Ga0307416_100275436
876 Ga0307416_100431181
877 Ga0307411_10186501
878 Ga0307415_101212235
879 Ga0316583_10181908
880 Ga0373956_0493929
881 Ga0316574_0006646
882 Ga0373925_0380727
883 Ga0395899_0411571
884 Ga0395899_0507047
885 Ga0395900_0588802
886 Ga0395898_0121883
887 Ga0395898_0170937
888 Ga0395898_0368389
889 Ga0395905_0039291
890 Ga0395905_0688369
891 Ga0436364_0882232
892 Ga0395901_0009304
893 Ga0395901_0045395
894 Ga0395901_0068125
895 Ga0395901_0157275
896 Ga0395901_0555533
897 Ga0395901_1288321
898 Ga0436363_0443338
899 Ga0436362_1158277
900 Ga0451800_0304270
901 Ga0451853_0244390
902 Ga0451853_2208875
903 Ga0451853_3479922
904 Ga0466963_0000214
905 Ga0466963_0014196
906 Ga0466963_0156339
907 Ga0466957_1039103
908 Ga0466960_0051948
909 Ga0466959_0121567
910 Ga0466958_0045676
911 Ga0466958_0105417
912 Ga0466967_0013927
913 Ga0466967_0039087
914 Ga0466967_0845653
915 Ga0495592_0000733
916 Ga0495603_0000254
917 Ga0495603_0003789
918 Ga0495591_140664
919 Ga0495629_0002650
920 Ga0495629_0007822
921 Ga0495629_0009419
922 Ga0495629_0216524
923 Ga0495641_0029181
924 Ga0495641_0213091
925 Ga0495653_0049412
926 Ga0495582_0000002
927 Ga0495662_0000077
928 Ga0495662_0017945
929 Ga0495664_0203393
930 Ga0495608_0464066
931 Ga0495610_0197775
932 Ga0495618_0000051
933 Ga0495620_0000154
934 Ga0495628_0000456
935 Ga0495628_0015683
936 Ga0495628_0022111
937 Ga0495628_0428572
938 Ga0495628_0534698
939 Ga0495630_0001740
940 Ga0495630_0116867
941 Ga0495630_0195614
942 Ga0495630_0568854
943 Ga0495644_0002028
944 Ga0495644_0266264
945 Ga0495652_0000009
946 Ga0495640_0033139
947 Ga0495640_0090623
948 Ga0495586_0012238
949 Ga0495587_0003321
950 Ga0495587_0052518
951 Ga0495587_0173373
952 Ga0495598_0000484
953 Ga0495621_0001754
954 Ga0495645_0018668
955 Ga0495645_0065210
956 Ga0495622_0000033
957 Ga0495667_0000019
958 Ga0495667_0085091
959 Ga0495667_0179559
960 Ga0495668_0032037
961 Ga0495634_0000728
962 Ga0495634_0002377
963 Ga0495634_0036516
964 Ga0495634_0106066
965 Ga0495625_0256484
966 Ga0495635_0000017
967 Ga0495635_0072164
968 Ga0495635_0336481
969 Ga0495635_0839181
970 Ga0495588_0000204
971 Ga0495588_0093991
972 Ga0495657_0012498
973 Ga0495599_0005793
974 Ga0495599_0215129
975 Ga0495599_0411740
976 Ga0495647_0000002
977 Ga0495647_0000645
978 Ga0495647_0002433
979 Ga0495647_0044074
980 Ga0495658_0000001
981 Ga0495658_0001925
982 Ga0495669_0000067
983 Ga0495669_0033410
984 Ga0495613_0000067
985 Ga0495613_0000261
986 Ga0495613_0168224
987 Ga0495613_0296984
988 Ga0495624_0000465
989 Ga0495624_0016129
990 Ga0495649_0003197
991 Ga0495600_0102470
992 Ga0495600_0222354
993 Ga0495604_0000252
994 Ga0495604_0000784
995 Ga0495604_0021975
996 Ga0495674_0000024
997 Ga0495672_0237591
998 Ga0495676_0003495
999 Ga0495676_0106286
1000 Ga0495676_0307010
1001 Ga0495680_0008292
1002 Ga0495680_0008509
1003 Ga0495680_0022242
1004 Ga0495680_0080042
1005 Ga0495675_0143693
1006 Ga0495679_010789
1007 Ga0495684_0181288
1008 Ga0495593_0067773
1009 Ga0495593_0163489
1010 Ga0495593_0166741
1011 Ga0495602_0000548
1012 Ga0495602_0025419
1013 Ga0495602_0184722
1014 Ga0495614_0066360
1015 Ga0496101_0000005
1016 Ga0496101_0000009
1017 Ga0496102_0000021
1018 Ga0496102_0111550
1019 Ga0496102_0460244
1020 Ga0496103_0000001
1021 Ga0496103_0011859
1022 Ga0496103_0176574
1023 Ga0496103_0231315
1024 Ga0496104_0000008
1025 Ga0496104_0000029
1026 Ga0496104_0002134
1027 Ga0496105_0000002
1028 Ga0496105_0000003
1029 Ga0496105_0205944
1030 Ga0496106_0000033
1031 Ga0496106_0000072
1032 Ga0496106_0001725
1033 Ga0496106_0275962
1034 Ga0496106_0723582
1035 Ga0496107_0000004
1036 Ga0496107_0000015
1037 Ga0496107_0034951
1038 Ga0496107_0236316
1039 Ga0496107_0455323
1040 Ga0496107_0825892
1041 Ga0496108_0000904
1042 Ga0496108_0000929
1043 Ga0496108_0134675
1044 Ga0496109_0000031
1045 Ga0496109_0000304
1046 Ga0496109_0001164
1047 Ga0496109_0215484
1048 Ga0496109_0830690
1049 Ga0496110_0001599
1050 Ga0496110_0010694
1051 Ga0496110_0015147
1052 Ga0496110_0035633
1053 Ga0496110_0090969
1054 Ga0496110_0302322
1055 Ga0496111_0000838
1056 Ga0496111_0033845
1057 Ga0496111_0074969
1058 Ga0496111_0290307
1059 Ga0496112_0015640
1060 Ga0496112_0139802
1061 Ga0496113_0000204
1062 Ga0496113_0015038
1063 Ga0496113_0562625
1064 Ga0496114_0000003
1065 Ga0496114_0016570
1066 Ga0496114_0094730
1067 Ga0496115_0000022
1068 Ga0496115_0000027
1069 Ga0496115_0022739
1070 Ga0496119_0029173
1071 Ga0496120_0025524
1072 Ga0496125_0161665
1073 Ga0496125_0248481
1074 Ga0501031_0002938
1075 Ga0501032_0003803
1076 Ga0501033_0001536
1077 Ga0501034_0011192
1078 Ga0501034_0035336
1079 Ga0501034_0981269
1080 Ga0501036_0001168
1081 Ga0501037_0001248
1082 Ga0501038_0006315
1083 Ga0501039_0003095
1084 Ga0501042_0081740
1085 Ga0501042_0130100
1086 Ga0501042_0161422
1087 Ga0501042_0378910
1088 Ga0501043_0002606
1089 Ga0501043_0656560
1090 Ga0501046_0000450
1091 Ga0501047_0001405
1092 Ga0501047_0186043
1093 Ga0501048_0008575
1094 Ga0501068_0018631
1095 Ga0501068_0203312
1096 Ga0501070_0000625
1097 Ga0501071_0329116
1098 Ga0501072_0051100
1099 Ga0501073_0012831
1100 Ga0501074_0022027
1101 Ga0501074_0082105
1102 Ga0501075_0043881
1103 Ga0501077_0268616
1104 Ga0501079_0003224
1105 Ga0501079_0383462
1106 Ga0501079_0768053
1107 Ga0501080_0010717
1108 Ga0501080_0021879
1109 Ga0501080_0099840
1110 Ga0501081_0259318
1111 Ga0501081_0459947
1112 Ga0501081_1116127
1113 Ga0501083_0035339
1114 Ga0501035_0000693
1115 Ga0501035_0208687
1116 Ga0501044_0001351
1117 Ga0501044_0027582
1118 Ga0501044_0029142
1119 nmdc:mga03n38_39998_c1
1120 nmdc:mga00v17_244163_c1
1121 nmdc:mga00v17_65431_c1
1122 nmdc:mga0yw44_171820_c1
1123 nmdc:mga0yw44_22505_c1
1124 nmdc:mga0yw44_4943_c1
1125 nmdc:mga0yw44_542635_c1
1126 nmdc:mga06z11_32216_c1
1127 nmdc:mga06z11_590836_c1
1128 nmdc:mga05p37_143263_c1
1129 nmdc:mga05p37_49388_c1
1130 nmdc:mga05p37_511729_c1
1131 nmdc:mga0qj67_266255_c1
1132 nmdc:mga0qj67_347558_c1
1133 nmdc:mga0qj67_378063_c1
1134 nmdc:mga06r32_3072_c1
1135 nmdc:mga06r32_444448_c1
1136 nmdc:mga0n895_309881_c1
1137 nmdc:mga0n895_544431_c1
1138 nmdc:mga0n895_549510_c1
1139 nmdc:mga0rr50_218164_c1
1140 nmdc:mga0a205_1036129_c1
1141 nmdc:mga0a205_36960_c2
1142 nmdc:mga0a205_491_c1
1143 nmdc:mga0a205_82266_c1
1144 Ga0495601_0001870
1145 Ga0495601_0003507
1146 Ga0495601_0021107
1147 Ga0495601_0095437
1148 Ga0495601_0301944
1149 Ga0495612_0000962
1150 Ga0495612_0107681
1151 Ga0495655_0000008
1152 Ga0495655_0000581
1153 Ga0495655_0076746
1154 Ga0495595_0001165
1155 Ga0495595_0034437
1156 Ga0495619_0000001
1157 Ga0495619_0000649
1158 Ga0495619_0006787
1159 Ga0495619_0066208
1160 Ga0495619_0113592
1161 Ga0500566_0049433
1162 Ga0500628_000074
1163 Ga0501084_0229795
1164 Ga0501082_0010303
1165 Ga0501082_0113538
1166 Ga0501082_0542546
1167 Ga0501082_0722510
1168 Ga0466962_0025755
1169 Ga0466962_0094400
1170 Ga0530510_0042664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

17

146

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9522 2 149
1ru1-assembly1.cif.gz_A crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form) 0.9479 3 149
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9463 2 149
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.944 1 160
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.94 2 149
ID Description Score Start End Superfamily
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.965 2 151 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9489 1 164 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9462 2 151 3.30.70.560
af_A0A1D8PN03_274_470_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9404 2 151 3.30.70.560
3mcoA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9235 1 161 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A538A829-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9925 2 160 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A538E9P4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9913 3 160 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7V9GTX4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9899 2 160 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7W0APL9-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9898 3 115 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A838PK28-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9865 3 160 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map